F430188

General Info

Members Datasets Scaffolds Average Seq Length
385 226 383 143

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10755899|Ga0105242_107558992
Length 158
Sequence VSPAPREDAIHSEDAPRPVGTYPHARRVGNLLFLSGIGPRDRQTNSIPGNELYADGRVRRYDIDAQVRAVFANVRTVLEASGARWEDLVDVTVYLTDMLRDFRIYNAIWAEYFPDPAQAPCRTTVGITALPTPIAIELKCMAAVGRRPSSSPPSPDAD

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221695 Lysobacter sp. Root494 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
206 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
207 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
208 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
212 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 3.12
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3073903 2162886011 Unclassified 3038
2 JGI24751J29686_10005089 3300002459 Bacteria 2678
3 rootH1_10241551 3300003323 Unclassified 2197
4 Ga0065714_10095655 3300005288 Bacteria 1781
5 Ga0065715_10018126 3300005293 Bacteria 2680
6 Ga0065715_10190471 3300005293 Bacteria 1416
7 Ga0065707_10446692 3300005295 Unclassified 804
8 Ga0070670_100073918 3300005331 Unclassified 2928
9 Ga0070670_100402788 3300005331 Unclassified 1208
10 Ga0070670_100627713 3300005331 Bacteria 963
11 Ga0070670_100782539 3300005331 Bacteria 861
12 Ga0070670_101230269 3300005331 Bacteria 685
13 Ga0070677_10489049 3300005333 Bacteria 665
14 Ga0068869_100067651 3300005334 Bacteria 2636
15 Ga0070680_100490392 3300005336 Bacteria 1051
16 Ga0070682_100608692 3300005337 Bacteria 864
17 Ga0070689_100111408 3300005340 Unclassified 2177
18 Ga0070689_100669312 3300005340 Bacteria 904
19 Ga0070687_100425111 3300005343 Unclassified 877
20 Ga0070661_100320782 3300005344 Bacteria 1210
21 Ga0070668_100146952 3300005347 Bacteria 1903
22 Ga0070668_101642961 3300005347 Unclassified 589
23 Ga0070669_100001238 3300005353 Bacteria 18500
24 Ga0070669_100448285 3300005353 Bacteria 1063
25 Ga0070669_101318132 3300005353 Bacteria 625
26 Ga0070669_101787291 3300005353 Unclassified 536
27 Ga0070675_100317501 3300005354 Bacteria 1376
28 Ga0070674_100267567 3300005356 Bacteria 1349
29 Ga0070674_101942924 3300005356 Bacteria 535
30 Ga0070673_100077901 3300005364 Bacteria 2680
31 Ga0070673_100949871 3300005364 Bacteria 799
32 Ga0070688_100459578 3300005365 Bacteria 953
33 Ga0070659_100339407 3300005366 Unclassified 1258
34 Ga0070667_100048119 3300005367 Bacteria 3589
35 Ga0070667_100786228 3300005367 Unclassified 883
36 Ga0070663_100638758 3300005455 Bacteria 899
37 Ga0070662_100096902 3300005457 Unclassified 2226
38 Ga0070662_100606547 3300005457 Bacteria 921
39 Ga0070681_10934989 3300005458 Bacteria 786
40 Ga0068867_100327688 3300005459 Bacteria 1271
41 Ga0070685_10575730 3300005466 Unclassified 807
42 Ga0070707_100160323 3300005468 Unclassified 2192
43 Ga0070698_100325031 3300005471 Bacteria 1469
44 Ga0070679_100156022 3300005530 Bacteria 2257
45 Ga0070679_101413282 3300005530 Bacteria 642
46 Ga0068853_100068874 3300005539 Bacteria 3077
47 Ga0070672_100086762 3300005543 Bacteria 2517
48 Ga0070672_100628120 3300005543 Bacteria 937
49 Ga0070693_100282518 3300005547 Bacteria 1112
50 Ga0070665_100163200 3300005548 Unclassified 2230
51 Ga0070704_100424445 3300005549 Unclassified 1139
52 Ga0070704_101075033 3300005549 Unclassified 730
53 Ga0070664_100189978 3300005564 Bacteria 1830
54 Ga0070664_101109928 3300005564 Bacteria 745
55 Ga0068857_100066752 3300005577 Unclassified 3202
56 Ga0068856_100103208 3300005614 Bacteria 2845
57 Ga0068852_102539404 3300005616 Unclassified 532
58 Ga0068859_100275309 3300005617 Bacteria 1775
59 Ga0068859_100765902 3300005617 Bacteria 1054
60 Ga0068859_100856419 3300005617 Bacteria 995
61 Ga0068859_102457244 3300005617 Bacteria 574
62 Ga0068864_100043947 3300005618 Bacteria 3827
63 Ga0068864_100922550 3300005618 Bacteria 863
64 Ga0068861_100009559 3300005719 Bacteria 6699
65 Ga0068861_101022976 3300005719 Bacteria 790
66 Ga0068870_10009469 3300005840 Unclassified 4434
67 Ga0068863_100677803 3300005841 Unclassified 1024
68 Ga0068860_100025165 3300005843 Bacteria 5744
69 Ga0068860_101223582 3300005843 Bacteria 771
70 Ga0068862_100119792 3300005844 Bacteria 2319
71 Ga0068862_100813915 3300005844 Bacteria 913
72 Ga0070716_101328607 3300006173 Bacteria 582
73 Ga0075366_10150111 3300006195 Bacteria 1411
74 Ga0068871_100365761 3300006358 Bacteria 1278
75 Ga0068871_101152578 3300006358 Unclassified 726
76 Ga0075428_100025956 3300006844 Bacteria 6488
77 Ga0075428_100056973 3300006844 Bacteria 4279
78 Ga0075428_100091856 3300006844 Bacteria 3310
79 Ga0075430_100009129 3300006846 Bacteria 8374
80 Ga0075431_100094852 3300006847 Bacteria 3079
81 Ga0075429_100330003 3300006880 Bacteria 1335
82 Ga0068865_101113956 3300006881 Bacteria 696
83 Ga0097620_100275304 3300006931 Bacteria 1775
84 Ga0097620_100765921 3300006931 Bacteria 1054
85 Ga0097620_100856497 3300006931 Bacteria 995
86 Ga0097620_102457593 3300006931 Bacteria 574
87 Ga0111539_10007058 3300009094 Bacteria 14409
88 Ga0111539_10145197 3300009094 Bacteria 2778
89 Ga0111539_12182683 3300009094 Bacteria 642
90 Ga0111539_12586622 3300009094 Bacteria 588
91 Ga0105245_13112786 3300009098 Bacteria 514
92 Ga0114129_10299737 3300009147 Bacteria 2143
93 Ga0105243_13067908 3300009148 Unclassified 506
94 Ga0105241_10178096 3300009174 Bacteria 1761
95 Ga0105242_10006695 3300009176 Bacteria 8892
96 Ga0105242_10755899 3300009176 Bacteria 957
97 Ga0105248_12621321 3300009177 Bacteria 575
98 Ga0105237_10166841 3300009545 Bacteria 2201
99 Ga0105249_10042764 3300009553 Bacteria 4122
100 Ga0105249_10053626 3300009553 Unclassified 3686
101 Ga0105249_10086696 3300009553 Unclassified 2920
102 Ga0105249_11792541 3300009553 Bacteria 686
103 Ga0105239_10004403 3300010375 Bacteria 16858
104 Ga0105239_10360314 3300010375 Bacteria 1642
105 Ga0157345_1017355 3300012498 Bacteria 700
106 Ga0157371_10033892 3300013102 Bacteria 3666
107 Ga0157371_10044445 3300013102 Bacteria 3162
108 Ga0157371_10049511 3300013102 Bacteria 2985
109 Ga0157371_10628074 3300013102 Bacteria 800
110 Ga0157369_10758160 3300013105 Bacteria 998
111 Ga0157374_10056986 3300013296 Bacteria 3649
112 Ga0157378_10000006 3300013297 Bacteria 192683
113 Ga0157378_10172236 3300013297 Bacteria 2031
114 Ga0157378_10441800 3300013297 Bacteria 1290
115 Ga0157378_10653541 3300013297 Bacteria 1067
116 Ga0157378_11701492 3300013297 Bacteria 678
117 Ga0157378_12230335 3300013297 Unclassified 599
118 Ga0163162_10013266 3300013306 Bacteria 8049
119 Ga0157372_10135021 3300013307 Bacteria 2841
120 Ga0157372_10686256 3300013307 Bacteria 1192
121 Ga0157372_10847092 3300013307 Bacteria 1061
122 Ga0157375_10000867 3300013308 Bacteria 26326
123 Ga0157375_10010729 3300013308 Bacteria 8073
124 Ga0157375_10028482 3300013308 Bacteria 5236
125 Ga0157375_10264611 3300013308 Bacteria 1881
126 Ga0157375_10273773 3300013308 Bacteria 1850
127 Ga0163163_10516332 3300014325 Unclassified 1257
128 Ga0157380_10005627 3300014326 Bacteria 8758
129 Ga0157377_10000827 3300014745 Bacteria 12822
130 Ga0157379_10089866 3300014968 Bacteria 2755
131 Ga0157379_10437640 3300014968 Bacteria 1206
132 Ga0157376_10028950 3300014969 Bacteria 4409
133 Ga0157376_10687452 3300014969 Bacteria 1027
134 Ga0163161_11774669 3300017792 Bacteria 548
135 Ga0213876_10136107 3300021384 Bacteria 1307
136 Ga0209257_1000145 3300025304 Bacteria 195152
137 Ga0207697_10049509 3300025315 Bacteria 1734
138 Ga0207647_10134182 3300025904 Bacteria 1453
139 Ga0207643_10013333 3300025908 Unclassified 4448
140 Ga0207657_10131780 3300025919 Bacteria 2048
141 Ga0207657_10505647 3300025919 Bacteria 946
142 Ga0207649_10925777 3300025920 Bacteria 684
143 Ga0207646_10302689 3300025922 Unclassified 1444
144 Ga0207681_10056545 3300025923 Bacteria 2677
145 Ga0207681_10234739 3300025923 Bacteria 1425
146 Ga0207681_10253629 3300025923 Unclassified 1374
147 Ga0207681_11113240 3300025923 Unclassified 663
148 Ga0207681_11484889 3300025923 Unclassified 568
149 Ga0207650_10053250 3300025925 Unclassified 2999
150 Ga0207650_10418496 3300025925 Bacteria 1111
151 Ga0207650_10588027 3300025925 Bacteria 935
152 Ga0207650_10928887 3300025925 Bacteria 739
153 Ga0207659_10351497 3300025926 Unclassified 1223
154 Ga0207659_10733438 3300025926 Bacteria 847
155 Ga0207687_10677732 3300025927 Bacteria 874
156 Ga0207644_10019889 3300025931 Bacteria 4559
157 Ga0207644_10708540 3300025931 Bacteria 840
158 Ga0207690_10576615 3300025932 Bacteria 917
159 Ga0207706_10010994 3300025933 Bacteria 8252
160 Ga0207706_10388030 3300025933 Bacteria 1211
161 Ga0207686_10066409 3300025934 Bacteria 2304
162 Ga0207709_10417921 3300025935 Unclassified 1029
163 Ga0207670_10076455 3300025936 Bacteria 2330
164 Ga0207670_10246129 3300025936 Bacteria 1379
165 Ga0207691_10042094 3300025940 Bacteria 4212
166 Ga0207689_10079803 3300025942 Unclassified 2689
167 Ga0207689_10654555 3300025942 Bacteria 885
168 Ga0207679_10463267 3300025945 Bacteria 1126
169 Ga0207679_10661223 3300025945 Bacteria 946
170 Ga0207651_10182380 3300025960 Unclassified 1666
171 Ga0207651_10655631 3300025960 Bacteria 922
172 Ga0207651_11539190 3300025960 Bacteria 599
173 Ga0207712_10019585 3300025961 Bacteria 4423
174 Ga0207712_10087905 3300025961 Unclassified 2280
175 Ga0207668_10033289 3300025972 Bacteria 3413
176 Ga0207668_10092689 3300025972 Unclassified 2224
177 Ga0207658_10097250 3300025986 Bacteria 2298
178 Ga0207658_10371137 3300025986 Bacteria 1251
179 Ga0207639_10061955 3300026041 Bacteria 2891
180 Ga0207639_10763234 3300026041 Bacteria 900
181 Ga0207641_10270846 3300026088 Unclassified 1593
182 Ga0207641_10582448 3300026088 Bacteria 1094
183 Ga0207641_11252207 3300026088 Bacteria 742
184 Ga0207648_10146253 3300026089 Bacteria 2084
185 Ga0207648_10194184 3300026089 Bacteria 1800
186 Ga0207648_10258610 3300026089 Bacteria 1553
187 Ga0207648_10501544 3300026089 Unclassified 1110
188 Ga0207676_10142198 3300026095 Bacteria 2055
189 Ga0207674_10183436 3300026116 Unclassified 2043
190 Ga0207674_10464887 3300026116 Bacteria 1223
191 Ga0207675_100000762 3300026118 Bacteria 32039
192 Ga0207675_101097881 3300026118 Bacteria 815
193 Ga0207683_10781670 3300026121 Bacteria 886
194 Ga0209982_1031615 3300027552 Bacteria 833
195 Ga0210002_1012521 3300027617 Bacteria 1319
196 Ga0207428_10267346 3300027907 Bacteria 1272
197 Ga0268265_10038538 3300028380 Bacteria 3516
198 Ga0268265_10100084 3300028380 Bacteria 2339
199 Ga0268264_10028239 3300028381 Bacteria 4587
200 Ga0316177_1153421 3300030731 Bacteria 2900
201 Ga0314311_1040974 3300030733 Bacteria 4728
202 Ga0316181_1058634 3300030744 Bacteria 882
203 Ga0316182_1323048 3300030745 Bacteria 827
204 Ga0307513_10345547 3300031456 Bacteria 1237
205 Ga0307509_10488596 3300031507 Bacteria 918
206 Ga0307408_100254352 3300031548 Bacteria 1450
207 Ga0307408_100276342 3300031548 Bacteria 1397
208 Ga0307408_100804653 3300031548 Bacteria 853
209 Ga0307408_101301264 3300031548 Bacteria 681
210 Ga0307508_10012852 3300031616 Bacteria 7655
211 Ga0307516_10136241 3300031730 Bacteria 2229
212 Ga0307405_10298793 3300031731 Bacteria 1220
213 Ga0307405_10586625 3300031731 Bacteria 907
214 Ga0307405_10891423 3300031731 Bacteria 752
215 Ga0307413_10046607 3300031824 Bacteria 2579
216 Ga0307413_10330724 3300031824 Bacteria 1168
217 Ga0307413_10818872 3300031824 Bacteria 784
218 Ga0307413_11662737 3300031824 Bacteria 568
219 Ga0307413_11666252 3300031824 Bacteria 568
220 Ga0307410_10279501 3300031852 Bacteria 1309
221 Ga0307410_10381469 3300031852 Bacteria 1134
222 Ga0307410_10404287 3300031852 Bacteria 1104
223 Ga0307410_11189070 3300031852 Unclassified 664
224 Ga0307410_11760169 3300031852 Unclassified 550
225 Ga0307406_10497240 3300031901 Bacteria 988
226 Ga0307406_10683068 3300031901 Bacteria 855
227 Ga0307412_10186234 3300031911 Bacteria 1566
228 Ga0307412_10209788 3300031911 Bacteria 1485
229 Ga0307412_10293007 3300031911 Unclassified 1283
230 Ga0307412_10637961 3300031911 Bacteria 907
231 Ga0307412_11151202 3300031911 Bacteria 692
232 Ga0307412_11271715 3300031911 Bacteria 661
233 Ga0307409_100104473 3300031995 Bacteria 2359
234 Ga0307409_100123988 3300031995 Bacteria 2194
235 Ga0307409_100383025 3300031995 Bacteria 1338
236 Ga0307409_101953264 3300031995 Bacteria 616
237 Ga0307414_10029242 3300032004 Bacteria 3584
238 Ga0307414_10047418 3300032004 Bacteria 2956
239 Ga0307414_10350945 3300032004 Bacteria 1266
240 Ga0307414_10596602 3300032004 Bacteria 990
241 Ga0307414_10788278 3300032004 Bacteria 866
242 Ga0307414_11229836 3300032004 Bacteria 694
243 Ga0307414_11415383 3300032004 Bacteria 646
244 Ga0307414_11581267 3300032004 Bacteria 611
245 Ga0307414_11819474 3300032004 Bacteria 568
246 Ga0307411_10037108 3300032005 Bacteria 3060
247 Ga0307411_10125552 3300032005 Bacteria 1865
248 Ga0307411_10254234 3300032005 Bacteria 1383
249 Ga0307411_10889496 3300032005 Bacteria 790
250 Ga0307411_11075564 3300032005 Bacteria 724
251 Ga0307415_100234919 3300032126 Bacteria 1479
252 Ga0307415_100866476 3300032126 Bacteria 830
253 Ga0307415_100868556 3300032126 Bacteria 829
254 Ga0307415_101341929 3300032126 Unclassified 679
255 Ga0373944_0010152 3300035089 Bacteria 2562
256 Ga0373955_0784650 3300035172 Unclassified 585
257 Ga0373924_0317139 3300035410 Unclassified 693
258 Ga0373935_0920175 3300035692 Unclassified 648
259 Ga0373937_0015568 3300036401 Bacteria 6730
260 Ga0373925_0055015 3300037068 Bacteria 2978
261 Ga0395899_0011678 3300037312 Bacteria 6723
262 Ga0395899_0243511 3300037312 Bacteria 1237
263 Ga0395899_0673859 3300037312 Bacteria 651
264 Ga0395900_0016564 3300037418 Bacteria 7520
265 Ga0395900_0348076 3300037418 Bacteria 1456
266 Ga0395900_1504374 3300037418 Bacteria 585
267 Ga0395898_0108711 3300037466 Bacteria 2659
268 Ga0395898_0591380 3300037466 Bacteria 1052
269 Ga0395898_1057533 3300037466 Bacteria 746
270 Ga0395905_0000577 3300037471 Bacteria 49489
271 Ga0395905_0017095 3300037471 Bacteria 6889
272 Ga0395905_0155418 3300037471 Bacteria 2151
273 Ga0395905_1339649 3300037471 Bacteria 620
274 Ga0395901_0080831 3300038443 Bacteria 3394
275 Ga0395901_0256436 3300038443 Bacteria 1821
276 Ga0436365_1382606 3300039437 Bacteria 3124
277 Ga0439436_0009189 3300041404 Bacteria 3032
278 Ga0439436_0009600 3300041404 Bacteria 2968
279 Ga0439466_0044935 3300041411 Bacteria 1462
280 Ga0439466_0234428 3300041411 Bacteria 556
281 Ga0451791_0327995 3300041451 Bacteria 967
282 Ga0451791_0458004 3300041451 Bacteria 636
283 Ga0451791_1340207 3300041451 Unclassified 693
284 Ga0451797_0947407 3300041453 Bacteria 573
285 Ga0451802_0658139 3300041460 Bacteria 3106
286 Ga0451807_0858499 3300041486 Bacteria 540
287 Ga0451837_1152312 3300041494 Bacteria 1606
288 Ga0451837_1659530 3300041494 Bacteria 686
289 Ga0451843_1243019 3300041509 Bacteria 1946
290 Ga0439433_0099767 3300041999 Bacteria 720
291 Ga0439445_0006193 3300042004 Bacteria 2747
292 Ga0439445_0107977 3300042004 Bacteria 793
293 Ga0439432_004313 3300042006 Bacteria 5201
294 Ga0439432_008823 3300042006 Bacteria 3526
295 Ga0439432_030073 3300042006 Bacteria 1763
296 Ga0439449_0000062 3300042007 Bacteria 33240
297 Ga0439449_0006778 3300042007 Bacteria 4370
298 Ga0439449_0102457 3300042007 Bacteria 1058
299 Ga0439449_0231403 3300042007 Bacteria 694
300 Ga0439462_0036674 3300042015 Bacteria 1305
301 Ga0439462_0189940 3300042015 Bacteria 583
302 Ga0450923_000888 3300042125 Bacteria 3672
303 Ga0450906_046246 3300042145 Bacteria 768
304 Ga0439434_0310375 3300042435 Unclassified 546
305 Ga0439460_0135692 3300042461 Bacteria 813
306 Ga0439440_0060925 3300042993 Bacteria 963
307 Ga0451576_0358171 3300045051 Bacteria 1528
308 Ga0451576_1005863 3300045051 Unclassified 874
309 Ga0495629_0221854 3300046459 Bacteria 1304
310 Ga0495638_0231116 3300046460 Bacteria 1029
311 Ga0495638_0251776 3300046460 Bacteria 973
312 Ga0495582_0022480 3300046473 Bacteria 3451
313 Ga0495639_0457844 3300046475 Unclassified 648
314 Ga0495630_0199746 3300046517 Bacteria 1526
315 Ga0495643_0045130 3300046522 Bacteria 2393
316 Ga0495643_0344820 3300046522 Bacteria 668
317 Ga0495663_0054936 3300046525 Bacteria 1241
318 Ga0495665_0018756 3300046531 Bacteria 3716
319 Ga0495587_0185308 3300046536 Bacteria 1179
320 Ga0495598_0020915 3300046537 Bacteria 1733
321 Ga0495598_0067289 3300046537 Bacteria 1120
322 Ga0495621_0010154 3300046539 Bacteria 2873
323 Ga0495659_0053577 3300046664 Bacteria 1474
324 Ga0495647_0104734 3300046681 Unclassified 1174
325 Ga0495658_0006329 3300046683 Bacteria 5816
326 Ga0495636_0011105 3300047318 Bacteria 3563
327 Ga0495636_0131448 3300047318 Bacteria 1113
328 Ga0495636_0195332 3300047318 Bacteria 922
329 Ga0495672_0208228 3300047320 Bacteria 973
330 Ga0495680_0215176 3300047322 Bacteria 1374
331 Ga0495684_0468884 3300047471 Bacteria 871
332 Ga0495686_0017403 3300047472 Unclassified 4845
333 Ga0495686_0353226 3300047472 Bacteria 798
334 Ga0496104_0000011 3300048907 Bacteria 459358
335 Ga0496105_0000071 3300048908 Bacteria 79908
336 Ga0496109_0174386 3300048912 Bacteria 2018
337 Ga0496109_0724547 3300048912 Bacteria 932
338 Ga0496113_0064034 3300048916 Bacteria 2779
339 Ga0496115_0000153 3300048918 Bacteria 64207
340 Ga0496126_0000199 3300048929 Bacteria 133742
341 Ga0501031_0082241 3300049568 Bacteria 2099
342 Ga0501032_0006180 3300049569 Bacteria 8816
343 Ga0501032_0058017 3300049569 Bacteria 2599
344 Ga0501033_0000085 3300049570 Bacteria 88350
345 Ga0501034_0000115 3300049571 Bacteria 146825
346 Ga0501034_0000308 3300049571 Bacteria 86738
347 Ga0501036_0007342 3300049572 Bacteria 8979
348 Ga0501037_0000672 3300049573 Bacteria 26170
349 Ga0501037_0071337 3300049573 Bacteria 2527
350 Ga0501038_0005333 3300049574 Bacteria 11945
351 Ga0501039_0005033 3300049575 Bacteria 10022
352 Ga0501043_0001252 3300049579 Bacteria 22398
353 Ga0501047_0244739 3300049581 Bacteria 1643
354 Ga0501070_0370857 3300049586 Bacteria 1160
355 Ga0501223_015847 3300049663 Bacteria 1492
356 Ga0501242_020067 3300049674 Bacteria 857
357 Ga0501243_087712 3300049675 Bacteria 613
358 Ga0501249_053852 3300049679 Bacteria 926
359 Ga0501249_157987 3300049679 Bacteria 574
360 Ga0501251_010861 3300049681 Bacteria 1076
361 Ga0501225_0115309 3300049705 Bacteria 795
362 Ga0501083_0065660 3300049744 Bacteria 2417
363 Ga0501266_020873 3300049763 Bacteria 893
364 Ga0501266_021999 3300049763 Bacteria 875
365 Ga0501270_012786 3300049767 Bacteria 1152
366 Ga0501035_0020512 3300049822 Bacteria 6070
367 Ga0501035_0907737 3300049822 Bacteria 697
368 Ga0501044_0000180 3300049823 Bacteria 78387
369 Ga0501044_0022696 3300049823 Bacteria 6683
370 Ga0501045_0000206 3300049824 Bacteria 33751
371 Ga0501212_102369 3300049851 Bacteria 539
372 nmdc:mga05p37_248217_c2 3300050507 Unclassified 1421
373 nmdc:mga09592_1502710_c1 3300050508 Bacteria 548
374 nmdc:mga0qj67_330892_c1 3300050509 Unclassified 1233
375 nmdc:mga06r32_73181_c1 3300050510 Bacteria 3319
376 nmdc:mga08y16_1007754_c1 3300050511 Bacteria 812
377 nmdc:mga08y16_1365951_c1 3300050511 Bacteria 673
378 nmdc:mga08y16_26384_c1 3300050511 Bacteria 6126
379 Ga0500566_0078691 3300053094 Bacteria 1839
380 Ga0500568_0004712 3300053139 Bacteria 7234
381 Ga0500616_0268501 3300053153 Bacteria 721
382 Ga0500611_000077 3300053727 Bacteria 38126
383 Ga0501084_1713583 3300054114 Bacteria 525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0327995 Ga0451791_0327995_367_753 122
2 3300032004 Ga0307414_10788278 Ga0307414_107882782 124
3 3300005617 Ga0068859_100856419 Ga0068859_1008564192 125
4 3300006931 Ga0097620_100856497 Ga0097620_1008564972 125
5 3300041404 Ga0439436_0009600 Ga0439436_0009600_1458_1910 130
6 3300041451 Ga0451791_0458004 Ga0451791_0458004_16_429 133
7 3300041453 Ga0451797_0947407 Ga0451797_0947407_57_476 133
8 3300041460 Ga0451802_0658139 Ga0451802_0658139_2191_2604 133
9 3300041494 Ga0451837_1152312 Ga0451837_1152312_414_827 133
10 3300041509 Ga0451843_1243019 Ga0451843_1243019_1398_1811 133
11 iso_pu_bacteria 2571042365 2572255016 133
12 iso_pu_bacteria 2643221695 2644529426 133
13 3300031456 Ga0307513_10345547 Ga0307513_103455472 136
14 3300031911 Ga0307412_10186234 Ga0307412_101862343 136
15 3300049568 Ga0501031_0082241 Ga0501031_0082241_1329_1739 136
16 3300049569 Ga0501032_0006180 Ga0501032_0006180_5638_6048 136
17 3300049569 Ga0501032_0058017 Ga0501032_0058017_361_771 136
18 3300049570 Ga0501033_0000085 Ga0501033_0000085_35226_35636 136
19 3300049571 Ga0501034_0000308 Ga0501034_0000308_27958_28368 136
20 3300049572 Ga0501036_0007342 Ga0501036_0007342_5784_6194 136
21 3300049573 Ga0501037_0000672 Ga0501037_0000672_1286_1696 136
22 3300049574 Ga0501038_0005333 Ga0501038_0005333_4310_4720 136
23 3300049575 Ga0501039_0005033 Ga0501039_0005033_3385_3795 136
24 3300049579 Ga0501043_0001252 Ga0501043_0001252_19120_19530 136
25 3300049581 Ga0501047_0244739 Ga0501047_0244739_752_1162 136
26 3300049586 Ga0501070_0370857 Ga0501070_0370857_371_781 136
27 3300049822 Ga0501035_0020512 Ga0501035_0020512_1155_1565 136
28 3300049823 Ga0501044_0000180 Ga0501044_0000180_58205_58615 136
29 3300049824 Ga0501045_0000206 Ga0501045_0000206_5740_6150 136
30 3300003323 rootH1_10241551 rootH1_102415513 137
31 3300005288 Ga0065714_10095655 Ga0065714_100956553 137
32 3300005293 Ga0065715_10018126 Ga0065715_100181263 137
33 3300005293 Ga0065715_10190471 Ga0065715_101904713 137
34 3300005331 Ga0070670_100402788 Ga0070670_1004027881 137
35 3300005336 Ga0070680_100490392 Ga0070680_1004903922 137
36 3300005337 Ga0070682_100608692 Ga0070682_1006086922 137
37 3300005343 Ga0070687_100425111 Ga0070687_1004251111 137
38 3300005347 Ga0070668_100146952 Ga0070668_1001469521 137
39 3300005347 Ga0070668_101642961 Ga0070668_1016429611 137
40 3300005353 Ga0070669_100448285 Ga0070669_1004482851 137
41 3300005353 Ga0070669_101318132 Ga0070669_1013181322 137
42 3300005353 Ga0070669_101787291 Ga0070669_1017872911 137
43 3300005356 Ga0070674_100267567 Ga0070674_1002675672 137
44 3300005367 Ga0070667_100048119 Ga0070667_1000481191 137
45 3300005455 Ga0070663_100638758 Ga0070663_1006387582 137
46 3300005457 Ga0070662_100606547 Ga0070662_1006065472 137
47 3300005458 Ga0070681_10934989 Ga0070681_109349892 137
48 3300005459 Ga0068867_100327688 Ga0068867_1003276882 137
49 3300005471 Ga0070698_100325031 Ga0070698_1003250312 137
50 3300005530 Ga0070679_100156022 Ga0070679_1001560223 137
51 3300005539 Ga0068853_100068874 Ga0068853_1000688742 137
52 3300005547 Ga0070693_100282518 Ga0070693_1002825182 137
53 3300005548 Ga0070665_100163200 Ga0070665_1001632003 137
54 3300005549 Ga0070704_101075033 Ga0070704_1010750332 137
55 3300005564 Ga0070664_101109928 Ga0070664_1011099281 137
56 3300005614 Ga0068856_100103208 Ga0068856_1001032082 137
57 3300005616 Ga0068852_102539404 Ga0068852_1025394041 137
58 3300005617 Ga0068859_102457244 Ga0068859_1024572441 137
59 3300005618 Ga0068864_100043947 Ga0068864_1000439472 137
60 3300005841 Ga0068863_100677803 Ga0068863_1006778032 137
61 3300006173 Ga0070716_101328607 Ga0070716_1013286072 137
62 3300006195 Ga0075366_10150111 Ga0075366_101501112 137
63 3300006358 Ga0068871_100365761 Ga0068871_1003657612 137
64 3300006931 Ga0097620_102457593 Ga0097620_1024575931 137
65 3300009094 Ga0111539_10145197 Ga0111539_101451972 137
66 3300009148 Ga0105243_13067908 Ga0105243_130679081 137
67 3300009174 Ga0105241_10178096 Ga0105241_101780962 137
68 3300009176 Ga0105242_10006695 Ga0105242_100066953 137
69 3300009177 Ga0105248_12621321 Ga0105248_126213211 137
70 3300009545 Ga0105237_10166841 Ga0105237_101668413 137
71 3300010375 Ga0105239_10004403 Ga0105239_1000440317 137
72 3300010375 Ga0105239_10360314 Ga0105239_103603142 137
73 3300013102 Ga0157371_10033892 Ga0157371_100338923 137
74 3300013102 Ga0157371_10044445 Ga0157371_100444453 137
75 3300013102 Ga0157371_10049511 Ga0157371_100495113 137
76 3300013102 Ga0157371_10628074 Ga0157371_106280741 137
77 3300013105 Ga0157369_10758160 Ga0157369_107581602 137
78 3300013296 Ga0157374_10056986 Ga0157374_100569863 137
79 3300013297 Ga0157378_10000006 Ga0157378_1000000645 137
80 3300013297 Ga0157378_10441800 Ga0157378_104418002 137
81 3300013297 Ga0157378_12230335 Ga0157378_122303352 137
82 3300013306 Ga0163162_10013266 Ga0163162_100132662 137
83 3300013307 Ga0157372_10135021 Ga0157372_101350213 137
84 3300013307 Ga0157372_10686256 Ga0157372_106862562 137
85 3300013307 Ga0157372_10847092 Ga0157372_108470922 137
86 3300013308 Ga0157375_10000867 Ga0157375_100008675 137
87 3300013308 Ga0157375_10264611 Ga0157375_102646112 137
88 3300014325 Ga0163163_10516332 Ga0163163_105163322 137
89 3300014968 Ga0157379_10089866 Ga0157379_100898662 137
90 3300014969 Ga0157376_10028950 Ga0157376_100289502 137
91 3300021384 Ga0213876_10136107 Ga0213876_101361072 137
92 3300025304 Ga0209257_1000145 Ga0209257_100014570 137
93 3300025919 Ga0207657_10131780 Ga0207657_101317803 137
94 3300025919 Ga0207657_10505647 Ga0207657_105056472 137
95 3300025923 Ga0207681_11113240 Ga0207681_111132401 137
96 3300025923 Ga0207681_11484889 Ga0207681_114848891 137
97 3300025927 Ga0207687_10677732 Ga0207687_106777323 137
98 3300025931 Ga0207644_10708540 Ga0207644_107085402 137
99 3300025933 Ga0207706_10388030 Ga0207706_103880302 137
100 3300025934 Ga0207686_10066409 Ga0207686_100664093 137
101 3300025935 Ga0207709_10417921 Ga0207709_104179211 137
102 3300025942 Ga0207689_10654555 Ga0207689_106545551 137
103 3300025945 Ga0207679_10463267 Ga0207679_104632673 137
104 3300025972 Ga0207668_10033289 Ga0207668_100332894 137
105 3300025986 Ga0207658_10371137 Ga0207658_103711371 137
106 3300026041 Ga0207639_10061955 Ga0207639_100619553 137
107 3300026041 Ga0207639_10763234 Ga0207639_107632341 137
108 3300026088 Ga0207641_10270846 Ga0207641_102708462 137
109 3300026088 Ga0207641_11252207 Ga0207641_112522072 137
110 3300026089 Ga0207648_10258610 Ga0207648_102586102 137
111 3300026116 Ga0207674_10464887 Ga0207674_104648872 137
112 3300027552 Ga0209982_1031615 Ga0209982_10316152 137
113 3300027617 Ga0210002_1012521 Ga0210002_10125212 137
114 3300030731 Ga0316177_1153421 Ga0316177_11534212 137
115 3300030733 Ga0314311_1040974 Ga0314311_10409743 137
116 3300030744 Ga0316181_1058634 Ga0316181_10586342 137
117 3300030745 Ga0316182_1323048 Ga0316182_13230482 137
118 3300031507 Ga0307509_10488596 Ga0307509_104885961 137
119 3300031548 Ga0307408_100254352 Ga0307408_1002543522 137
120 3300031548 Ga0307408_100276342 Ga0307408_1002763422 137
121 3300031548 Ga0307408_101301264 Ga0307408_1013012642 137
122 3300031730 Ga0307516_10136241 Ga0307516_101362412 137
123 3300031731 Ga0307405_10298793 Ga0307405_102987932 137
124 3300031731 Ga0307405_10586625 Ga0307405_105866251 137
125 3300031731 Ga0307405_10891423 Ga0307405_108914232 137
126 3300031824 Ga0307413_10046607 Ga0307413_100466074 137
127 3300031824 Ga0307413_10330724 Ga0307413_103307242 137
128 3300031852 Ga0307410_10279501 Ga0307410_102795013 137
129 3300031852 Ga0307410_10381469 Ga0307410_103814692 137
130 3300031852 Ga0307410_10404287 Ga0307410_104042872 137
131 3300031852 Ga0307410_11189070 Ga0307410_111890702 137
132 3300031852 Ga0307410_11760169 Ga0307410_117601691 137
133 3300031901 Ga0307406_10497240 Ga0307406_104972402 137
134 3300031901 Ga0307406_10683068 Ga0307406_106830682 137
135 3300031911 Ga0307412_10209788 Ga0307412_102097882 137
136 3300031911 Ga0307412_10293007 Ga0307412_102930072 137
137 3300031911 Ga0307412_10637961 Ga0307412_106379612 137
138 3300031911 Ga0307412_11151202 Ga0307412_111512022 137
139 3300031911 Ga0307412_11271715 Ga0307412_112717152 137
140 3300031995 Ga0307409_100104473 Ga0307409_1001044733 137
141 3300031995 Ga0307409_100123988 Ga0307409_1001239884 137
142 3300031995 Ga0307409_100383025 Ga0307409_1003830253 137
143 3300032004 Ga0307414_10029242 Ga0307414_100292424 137
144 3300032004 Ga0307414_10596602 Ga0307414_105966022 137
145 3300032004 Ga0307414_11229836 Ga0307414_112298362 137
146 3300032004 Ga0307414_11415383 Ga0307414_114153832 137
147 3300032004 Ga0307414_11581267 Ga0307414_115812672 137
148 3300032004 Ga0307414_11819474 Ga0307414_118194742 137
149 3300032005 Ga0307411_10037108 Ga0307411_100371083 137
150 3300032005 Ga0307411_10125552 Ga0307411_101255523 137
151 3300032005 Ga0307411_10254234 Ga0307411_102542342 137
152 3300032005 Ga0307411_10889496 Ga0307411_108894962 137
153 3300032005 Ga0307411_11075564 Ga0307411_110755642 137
154 3300032126 Ga0307415_100234919 Ga0307415_1002349192 137
155 3300032126 Ga0307415_100866476 Ga0307415_1008664762 137
156 3300032126 Ga0307415_100868556 Ga0307415_1008685562 137
157 3300032126 Ga0307415_101341929 Ga0307415_1013419291 137
158 3300035089 Ga0373944_0010152 Ga0373944_0010152_911_1342 137
159 3300035172 Ga0373955_0784650 Ga0373955_0784650_135_566 137
160 3300035410 Ga0373924_0317139 Ga0373924_0317139_133_564 137
161 3300035692 Ga0373935_0920175 Ga0373935_0920175_56_487 137
162 3300036401 Ga0373937_0015568 Ga0373937_0015568_2837_3268 137
163 3300037068 Ga0373925_0055015 Ga0373925_0055015_2024_2455 137
164 3300037312 Ga0395899_0243511 Ga0395899_0243511_728_1153 137
165 3300037312 Ga0395899_0673859 Ga0395899_0673859_72_512 137
166 3300037466 Ga0395898_1057533 Ga0395898_1057533_167_592 137
167 3300037471 Ga0395905_1339649 Ga0395905_1339649_49_474 137
168 3300039437 Ga0436365_1382606 Ga0436365_1382606_766_1191 137
169 3300041404 Ga0439436_0009189 Ga0439436_0009189_996_1421 137
170 3300041411 Ga0439466_0234428 Ga0439466_0234428_81_521 137
171 3300041451 Ga0451791_1340207 Ga0451791_1340207_199_612 137
172 3300041486 Ga0451807_0858499 Ga0451807_0858499_62_493 137
173 3300041494 Ga0451837_1659530 Ga0451837_1659530_207_638 137
174 3300041999 Ga0439433_0099767 Ga0439433_0099767_174_587 137
175 3300042004 Ga0439445_0006193 Ga0439445_0006193_1248_1691 137
176 3300042004 Ga0439445_0107977 Ga0439445_0107977_176_616 137
177 3300042006 Ga0439432_004313 Ga0439432_004313_4731_5171 137
178 3300042006 Ga0439432_008823 Ga0439432_008823_456_896 137
179 3300042006 Ga0439432_030073 Ga0439432_030073_15_455 137
180 3300042007 Ga0439449_0000062 Ga0439449_0000062_11131_11574 137
181 3300042007 Ga0439449_0006778 Ga0439449_0006778_2931_3356 137
182 3300042007 Ga0439449_0102457 Ga0439449_0102457_390_830 137
183 3300042007 Ga0439449_0231403 Ga0439449_0231403_77_508 137
184 3300042015 Ga0439462_0036674 Ga0439462_0036674_17_442 137
185 3300042015 Ga0439462_0189940 Ga0439462_0189940_89_529 137
186 3300042125 Ga0450923_000888 Ga0450923_000888_1325_1759 137
187 3300042145 Ga0450906_046246 Ga0450906_046246_288_719 137
188 3300042435 Ga0439434_0310375 Ga0439434_0310375_74_490 137
189 3300042461 Ga0439460_0135692 Ga0439460_0135692_57_476 137
190 3300045051 Ga0451576_1005863 Ga0451576_1005863_190_606 137
191 3300046459 Ga0495629_0221854 Ga0495629_0221854_408_839 137
192 3300046460 Ga0495638_0231116 Ga0495638_0231116_587_1009 137
193 3300046460 Ga0495638_0251776 Ga0495638_0251776_55_486 137
194 3300046473 Ga0495582_0022480 Ga0495582_0022480_1684_2115 137
195 3300046475 Ga0495639_0457844 Ga0495639_0457844_129_560 137
196 3300046517 Ga0495630_0199746 Ga0495630_0199746_626_1057 137
197 3300046522 Ga0495643_0045130 Ga0495643_0045130_608_1021 137
198 3300046522 Ga0495643_0344820 Ga0495643_0344820_174_587 137
199 3300046531 Ga0495665_0018756 Ga0495665_0018756_3147_3578 137
200 3300046536 Ga0495587_0185308 Ga0495587_0185308_671_1102 137
201 3300046664 Ga0495659_0053577 Ga0495659_0053577_801_1241 137
202 3300046681 Ga0495647_0104734 Ga0495647_0104734_673_1104 137
203 3300046683 Ga0495658_0006329 Ga0495658_0006329_3325_3756 137
204 3300047318 Ga0495636_0011105 Ga0495636_0011105_892_1317 137
205 3300047318 Ga0495636_0131448 Ga0495636_0131448_406_846 137
206 3300047320 Ga0495672_0208228 Ga0495672_0208228_224_640 137
207 3300047322 Ga0495680_0215176 Ga0495680_0215176_34_465 137
208 3300047471 Ga0495684_0468884 Ga0495684_0468884_21_452 137
209 3300047472 Ga0495686_0017403 Ga0495686_0017403_2526_2939 137
210 3300047472 Ga0495686_0353226 Ga0495686_0353226_72_494 137
211 3300048907 Ga0496104_0000011 Ga0496104_0000011_234898_235329 137
212 3300048908 Ga0496105_0000071 Ga0496105_0000071_14051_14482 137
213 3300048918 Ga0496115_0000153 Ga0496115_0000153_23185_23610 137
214 3300048929 Ga0496126_0000199 Ga0496126_0000199_62525_62950 137
215 3300049663 Ga0501223_015847 Ga0501223_015847_427_867 137
216 3300049674 Ga0501242_020067 Ga0501242_020067_376_816 137
217 3300049675 Ga0501243_087712 Ga0501243_087712_29_469 137
218 3300049679 Ga0501249_053852 Ga0501249_053852_235_651 137
219 3300049679 Ga0501249_157987 Ga0501249_157987_117_557 137
220 3300049681 Ga0501251_010861 Ga0501251_010861_57_482 137
221 3300049705 Ga0501225_0115309 Ga0501225_0115309_70_486 137
222 3300049744 Ga0501083_0065660 Ga0501083_0065660_62_478 137
223 3300049763 Ga0501266_020873 Ga0501266_020873_113_538 137
224 3300049763 Ga0501266_021999 Ga0501266_021999_313_753 137
225 3300049767 Ga0501270_012786 Ga0501270_012786_648_1088 137
226 3300049851 Ga0501212_102369 Ga0501212_102369_86_526 137
227 3300053094 Ga0500566_0078691 Ga0500566_0078691_667_1098 137
228 3300053139 Ga0500568_0004712 Ga0500568_0004712_647_1063 137
229 3300053727 Ga0500611_000077 Ga0500611_000077_20817_21239 137
230 3300002459 JGI24751J29686_10005089 JGI24751J29686_100050892 138
231 3300005331 Ga0070670_100073918 Ga0070670_1000739181 138
232 3300005334 Ga0068869_100067651 Ga0068869_1000676513 138
233 3300005356 Ga0070674_101942924 Ga0070674_1019429241 138
234 3300005468 Ga0070707_100160323 Ga0070707_1001603232 138
235 3300005617 Ga0068859_100275309 Ga0068859_1002753091 138
236 3300005843 Ga0068860_100025165 Ga0068860_1000251654 138
237 3300005843 Ga0068860_101223582 Ga0068860_1012235822 138
238 3300005844 Ga0068862_100119792 Ga0068862_1001197922 138
239 3300006358 Ga0068871_101152578 Ga0068871_1011525782 138
240 3300006844 Ga0075428_100056973 Ga0075428_1000569735 138
241 3300006844 Ga0075428_100091856 Ga0075428_1000918562 138
242 3300006846 Ga0075430_100009129 Ga0075430_1000091293 138
243 3300006847 Ga0075431_100094852 Ga0075431_1000948521 138
244 3300006931 Ga0097620_100275304 Ga0097620_1002753041 138
245 3300009147 Ga0114129_10299737 Ga0114129_102997371 138
246 3300009553 Ga0105249_10042764 Ga0105249_100427643 138
247 3300009553 Ga0105249_10086696 Ga0105249_100866963 138
248 3300012498 Ga0157345_1017355 Ga0157345_10173552 138
249 3300013297 Ga0157378_10653541 Ga0157378_106535411 138
250 3300013297 Ga0157378_11701492 Ga0157378_117014921 138
251 3300013308 Ga0157375_10028482 Ga0157375_100284825 138
252 3300025922 Ga0207646_10302689 Ga0207646_103026892 138
253 3300025925 Ga0207650_10053250 Ga0207650_100532502 138
254 3300025961 Ga0207712_10019585 Ga0207712_100195853 138
255 3300025986 Ga0207658_10097250 Ga0207658_100972502 138
256 3300026088 Ga0207641_10582448 Ga0207641_105824482 138
257 3300026089 Ga0207648_10146253 Ga0207648_101462532 138
258 3300026095 Ga0207676_10142198 Ga0207676_101421983 138
259 3300028380 Ga0268265_10100084 Ga0268265_101000842 138
260 3300028381 Ga0268264_10028239 Ga0268264_100282393 138
261 3300042993 Ga0439440_0060925 Ga0439440_0060925_391_831 138
262 3300049573 Ga0501037_0071337 Ga0501037_0071337_857_1288 138
263 3300049822 Ga0501035_0907737 Ga0501035_0907737_253_684 138
264 3300049823 Ga0501044_0022696 Ga0501044_0022696_3457_3888 138
265 3300050507 nmdc:mga05p37_248217_c2 nmdc:mga05p37_248217_c2_857_1294 138
266 3300050509 nmdc:mga0qj67_330892_c1 nmdc:mga0qj67_330892_c1_227_664 138
267 3300050510 nmdc:mga06r32_73181_c1 nmdc:mga06r32_73181_c1_2588_3025 138
268 3300050511 nmdc:mga08y16_1007754_c1 nmdc:mga08y16_1007754_c1_283_738 138
269 3300053153 Ga0500616_0268501 Ga0500616_0268501_117_536 138
270 3300005340 Ga0070689_100669312 Ga0070689_1006693121 139
271 3300009098 Ga0105245_13112786 Ga0105245_131127861 139
272 3300014969 Ga0157376_10687452 Ga0157376_106874522 139
273 3300031616 Ga0307508_10012852 Ga0307508_100128522 139
274 3300046537 Ga0495598_0067289 Ga0495598_0067289_366_797 139
275 3300047318 Ga0495636_0195332 Ga0495636_0195332_307_738 139
276 3300054114 Ga0501084_1713583 Ga0501084_1713583_69_491 139
277 3300005331 Ga0070670_101230269 Ga0070670_1012302692 140
278 3300005333 Ga0070677_10489049 Ga0070677_104890491 140
279 3300005344 Ga0070661_100320782 Ga0070661_1003207822 140
280 3300005354 Ga0070675_100317501 Ga0070675_1003175012 140
281 3300005364 Ga0070673_100949871 Ga0070673_1009498712 140
282 3300005365 Ga0070688_100459578 Ga0070688_1004595782 140
283 3300005543 Ga0070672_100628120 Ga0070672_1006281202 140
284 3300005564 Ga0070664_100189978 Ga0070664_1001899782 140
285 3300005617 Ga0068859_100765902 Ga0068859_1007659022 140
286 3300005618 Ga0068864_100922550 Ga0068864_1009225502 140
287 3300005844 Ga0068862_100813915 Ga0068862_1008139152 140
288 3300006844 Ga0075428_100025956 Ga0075428_1000259566 140
289 3300006880 Ga0075429_100330003 Ga0075429_1003300032 140
290 3300006931 Ga0097620_100765921 Ga0097620_1007659212 140
291 3300009094 Ga0111539_12182683 Ga0111539_121826832 140
292 3300009094 Ga0111539_12586622 Ga0111539_125866222 140
293 3300009553 Ga0105249_11792541 Ga0105249_117925411 140
294 3300014968 Ga0157379_10437640 Ga0157379_104376402 140
295 3300025920 Ga0207649_10925777 Ga0207649_109257772 140
296 3300025923 Ga0207681_10234739 Ga0207681_102347392 140
297 3300025926 Ga0207659_10733438 Ga0207659_107334382 140
298 3300025936 Ga0207670_10076455 Ga0207670_100764552 140
299 3300025945 Ga0207679_10661223 Ga0207679_106612231 140
300 3300025960 Ga0207651_10655631 Ga0207651_106556312 140
301 3300025960 Ga0207651_11539190 Ga0207651_115391901 140
302 3300026121 Ga0207683_10781670 Ga0207683_107816702 140
303 3300028380 Ga0268265_10038538 Ga0268265_100385386 140
304 3300031548 Ga0307408_100804653 Ga0307408_1008046532 140
305 3300031824 Ga0307413_11666252 Ga0307413_116662522 140
306 3300032004 Ga0307414_10047418 Ga0307414_100474182 140
307 3300032004 Ga0307414_10350945 Ga0307414_103509452 140
308 3300045051 Ga0451576_0358171 Ga0451576_0358171_213_638 140
309 3300050508 nmdc:mga09592_1502710_c1 nmdc:mga09592_1502710_c1_15_440 140
310 3300050511 nmdc:mga08y16_1365951_c1 nmdc:mga08y16_1365951_c1_42_467 140
311 3300005530 Ga0070679_101413282 Ga0070679_1014132821 141
312 3300031824 Ga0307413_10818872 Ga0307413_108188722 141
313 3300031824 Ga0307413_11662737 Ga0307413_116627371 141
314 3300031995 Ga0307409_101953264 Ga0307409_1019532642 141
315 3300005543 Ga0070672_100086762 Ga0070672_1000867622 142
316 3300005719 Ga0068861_101022976 Ga0068861_1010229762 142
317 3300006881 Ga0068865_101113956 Ga0068865_1011139562 142
318 3300009176 Ga0105242_10755899 Ga0105242_107558992 142
319 3300013308 Ga0157375_10273773 Ga0157375_102737733 142
320 3300017792 Ga0163161_11774669 Ga0163161_117746691 142
321 3300025923 Ga0207681_10056545 Ga0207681_100565453 142
322 3300025925 Ga0207650_10928887 Ga0207650_109288872 142
323 3300025940 Ga0207691_10042094 Ga0207691_100420944 142
324 3300026089 Ga0207648_10194184 Ga0207648_101941842 142
325 3300026118 Ga0207675_101097881 Ga0207675_1010978812 142
326 3300046525 Ga0495663_0054936 Ga0495663_0054936_19_468 142
327 3300046537 Ga0495598_0020915 Ga0495598_0020915_1124_1579 142
328 3300046539 Ga0495621_0010154 Ga0495621_0010154_2298_2753 142
329 2162886011 MRS1b_contig_3073903 MRS1b_0182.00002590 143
330 3300005295 Ga0065707_10446692 Ga0065707_104466921 143
331 3300005331 Ga0070670_100627713 Ga0070670_1006277131 143
332 3300005331 Ga0070670_100782539 Ga0070670_1007825392 143
333 3300005340 Ga0070689_100111408 Ga0070689_1001114082 143
334 3300005353 Ga0070669_100001238 Ga0070669_10000123822 143
335 3300005364 Ga0070673_100077901 Ga0070673_1000779012 143
336 3300005366 Ga0070659_100339407 Ga0070659_1003394072 143
337 3300005367 Ga0070667_100786228 Ga0070667_1007862282 143
338 3300005457 Ga0070662_100096902 Ga0070662_1000969021 143
339 3300005466 Ga0070685_10575730 Ga0070685_105757302 143
340 3300005549 Ga0070704_100424445 Ga0070704_1004244452 143
341 3300005577 Ga0068857_100066752 Ga0068857_1000667522 143
342 3300005719 Ga0068861_100009559 Ga0068861_1000095597 143
343 3300005840 Ga0068870_10009469 Ga0068870_100094693 143
344 3300009094 Ga0111539_10007058 Ga0111539_1000705813 143
345 3300009553 Ga0105249_10053626 Ga0105249_100536263 143
346 3300013297 Ga0157378_10172236 Ga0157378_101722362 143
347 3300013308 Ga0157375_10010729 Ga0157375_100107296 143
348 3300014326 Ga0157380_10005627 Ga0157380_100056277 143
349 3300014745 Ga0157377_10000827 Ga0157377_100008275 143
350 3300025315 Ga0207697_10049509 Ga0207697_100495092 143
351 3300025904 Ga0207647_10134182 Ga0207647_101341822 143
352 3300025908 Ga0207643_10013333 Ga0207643_100133333 143
353 3300025923 Ga0207681_10253629 Ga0207681_102536292 143
354 3300025925 Ga0207650_10418496 Ga0207650_104184962 143
355 3300025925 Ga0207650_10588027 Ga0207650_105880272 143
356 3300025926 Ga0207659_10351497 Ga0207659_103514972 143
357 3300025931 Ga0207644_10019889 Ga0207644_100198895 143
358 3300025932 Ga0207690_10576615 Ga0207690_105766152 143
359 3300025933 Ga0207706_10010994 Ga0207706_100109948 143
360 3300025936 Ga0207670_10246129 Ga0207670_102461292 143
361 3300025942 Ga0207689_10079803 Ga0207689_100798033 143
362 3300025960 Ga0207651_10182380 Ga0207651_101823802 143
363 3300025961 Ga0207712_10087905 Ga0207712_100879052 143
364 3300025972 Ga0207668_10092689 Ga0207668_100926892 143
365 3300026089 Ga0207648_10501544 Ga0207648_105015441 143
366 3300026116 Ga0207674_10183436 Ga0207674_101834362 143
367 3300026118 Ga0207675_100000762 Ga0207675_1000007627 143
368 3300027907 Ga0207428_10267346 Ga0207428_102673462 143
369 3300037312 Ga0395899_0011678 Ga0395899_0011678_6139_6603 143
370 3300037418 Ga0395900_0016564 Ga0395900_0016564_81_545 143
371 3300037418 Ga0395900_0348076 Ga0395900_0348076_665_1129 143
372 3300037418 Ga0395900_1504374 Ga0395900_1504374_71_538 143
373 3300037466 Ga0395898_0108711 Ga0395898_0108711_510_974 143
374 3300037466 Ga0395898_0591380 Ga0395898_0591380_561_1025 143
375 3300037471 Ga0395905_0000577 Ga0395905_0000577_2974_3438 143
376 3300037471 Ga0395905_0017095 Ga0395905_0017095_387_854 143
377 3300037471 Ga0395905_0155418 Ga0395905_0155418_1162_1626 143
378 3300038443 Ga0395901_0080831 Ga0395901_0080831_2576_3040 143
379 3300038443 Ga0395901_0256436 Ga0395901_0256436_768_1232 143
380 3300041411 Ga0439466_0044935 Ga0439466_0044935_926_1438 143
381 3300048912 Ga0496109_0174386 Ga0496109_0174386_394_858 143
382 3300048912 Ga0496109_0724547 Ga0496109_0724547_330_794 143
383 3300048916 Ga0496113_0064034 Ga0496113_0064034_763_1227 143
384 3300049571 Ga0501034_0000115 Ga0501034_0000115_81773_82231 143
385 3300050511 nmdc:mga08y16_26384_c1 nmdc:mga08y16_26384_c1_3383_3814 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

12

144

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyy-assembly2.cif.gz_E crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9651 10 143
3quw-assembly1.cif.gz_A crystal structure of yeast mmf1 0.9537 10 142
6l8p-assembly1.cif.gz_B crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 0.9534 8 143
3mqw-assembly1.cif.gz_B crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9488 10 143
6tcc-assembly1.cif.gz_A crystal structure of salmo salar rida-1 0.9481 10 143
ID Description Score Start End Superfamily
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9565 10 142 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.951 10 143 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9495 25 143 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9484 10 142 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.947 8 143 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A4V1UUP2-F1-model_v4 RidA family protein 0.9972 21 143 GO:0005829
GO:0019239
AF-A0A832XZR7-F1-model_v4 RidA family protein 0.9949 10 143 GO:0005829
GO:0019239
AF-A0A3Q9G741-F1-model_v4 RidA family protein 0.9863 10 143 GO:0005829
GO:0019239
AF-A0A534PE41-F1-model_v4 RidA family protein 0.986 11 142 GO:0005829
GO:0019239
AF-A0A3D3JGR0-F1-model_v4 2-aminomuconate deaminase 0.984 48 143 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
93.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map