F430146

General Info

Members Datasets Scaffolds Average Seq Length
385 220 770 333

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100177608|Ga0068856_1001776083
Length 384
Sequence MDRGSCATSFGLEKQRSEAERAALFNVSNVSHAKPGLSRACGKAIPLSLVVFVMRAIQISAVDRLEILPVPDPIPAAGEAIVAIRAAALNHRDVWIKTGEYAGLKWPCIPGSDGAGVVIAVGEGADPTWIGREVVINPSLDWGDNEHAQGGKFSILGLPRHGTLAEQVSVPVAQLSPKPAHLSWEEAAALPLAGLTAWRAVSSRGQLKGGERMLITGVGGGVAVFALQFAVPHGAEVWVTSSSTEKIARAVELGAKGGANYTTADWAKGLKEAVGGFDLIVDSAGGQGFESLFELTTPGGRIVSYGATRGNPPVLPMRKIFWRQISLLGTTMGSPADWWAMTSYVTQYRLKPIVSEVLPFDRAGDAFDLMQRGGQFGKIVVRVA

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
209 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
210 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
218 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
219 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
220 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0.52
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 0.26
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100177608 3300005614 Unclassified 2142
2 SwRhRL2b_contig_2880178 2162886007 Bacteria 4516
3 JGI24737J22298_10011426 3300001990 Bacteria 2910
4 JGI24743J22301_10007909 3300001991 Bacteria 1855
5 rootH2_10018539 3300003320 Bacteria 22550
6 rootH2_10081434 3300003320 Unclassified 3523
7 rootH2_10199364 3300003320 Bacteria 2491
8 rootL2_10175888 3300003322 Bacteria 3853
9 rootL2_10218372 3300003322 Bacteria 2051
10 rootH1_10112302 3300003323 Bacteria 7634
11 rootH1_10130318 3300003323 Bacteria 1503
12 Ga0058863_10156147 3300004799 Bacteria 4652
13 Ga0058862_10010797 3300004803 Bacteria 1973
14 Ga0065704_10003795 3300005289 Bacteria 5706
15 Ga0065715_10101048 3300005293 Bacteria 3242
16 Ga0065707_10001818 3300005295 Bacteria 6819
17 Ga0065707_10092896 3300005295 Bacteria 3702
18 Ga0070683_100016597 3300005329 Bacteria 6498
19 Ga0070670_100013733 3300005331 Bacteria 6940
20 Ga0070670_100171703 3300005331 Bacteria 1881
21 Ga0070670_100172413 3300005331 Bacteria 1877
22 Ga0068869_100000177 3300005334 Bacteria 32439
23 Ga0068869_100001892 3300005334 Bacteria 12589
24 Ga0070680_100011953 3300005336 Bacteria 6737
25 Ga0070680_100304516 3300005336 Bacteria 1351
26 Ga0068868_100004199 3300005338 Bacteria 10072
27 Ga0068868_100364628 3300005338 Bacteria 1240
28 Ga0070660_100024566 3300005339 Bacteria 4471
29 Ga0070689_100002744 3300005340 Bacteria 11548
30 Ga0070689_100025763 3300005340 Unclassified 4420
31 Ga0070687_100010167 3300005343 Bacteria 4057
32 Ga0070668_100041928 3300005347 Bacteria 3507
33 Ga0070669_100024744 3300005353 Unclassified 4308
34 Ga0070669_100038572 3300005353 Bacteria 3469
35 Ga0070675_100000142 3300005354 Bacteria 42794
36 Ga0070671_100018611 3300005355 Bacteria 5644
37 Ga0070659_100006520 3300005366 Bacteria 8429
38 Ga0070713_100002548 3300005436 Bacteria 11913
39 Ga0070701_10011500 3300005438 Bacteria 3960
40 Ga0070701_10107737 3300005438 Bacteria 1552
41 Ga0070705_100148008 3300005440 Bacteria 1554
42 Ga0070708_100028684 3300005445 Bacteria 4792
43 Ga0070663_100030640 3300005455 Bacteria 3689
44 Ga0070678_100096676 3300005456 Bacteria 2279
45 Ga0070662_100172734 3300005457 Bacteria 1698
46 Ga0070681_10004335 3300005458 Bacteria 13482
47 Ga0068867_100009825 3300005459 Bacteria 6743
48 Ga0068867_100019273 3300005459 Bacteria 4863
49 Ga0070706_100047834 3300005467 Bacteria 3948
50 Ga0070707_100000001 3300005468 Bacteria 320358
51 Ga0070698_100008348 3300005471 Bacteria 11193
52 Ga0070699_100000678 3300005518 Bacteria 31777
53 Ga0070699_100001984 3300005518 Bacteria 18453
54 Ga0070699_100040666 3300005518 Bacteria 4025
55 Ga0070699_100082468 3300005518 Unclassified 2803
56 Ga0070679_100007384 3300005530 Bacteria 10271
57 Ga0070679_100072137 3300005530 Unclassified 3444
58 Ga0070696_100009167 3300005546 Bacteria 6624
59 Ga0070696_100009547 3300005546 Bacteria 6496
60 Ga0070693_100126099 3300005547 Bacteria 1594
61 Ga0070704_100001350 3300005549 Bacteria 13007
62 Ga0070704_100015011 3300005549 Bacteria 4852
63 Ga0068855_100062094 3300005563 Bacteria 4363
64 Ga0068855_100112511 3300005563 Bacteria 3124
65 Ga0068855_100464976 3300005563 Unclassified 1379
66 Ga0068857_100018872 3300005577 Bacteria 6051
67 Ga0068857_100019850 3300005577 Bacteria 5906
68 Ga0068857_100091424 3300005577 Bacteria 2724
69 Ga0068856_100006147 3300005614 Bacteria 11781
70 Ga0068856_100055379 3300005614 Bacteria 3914
71 Ga0068859_100000875 3300005617 Bacteria 30715
72 Ga0068859_100013050 3300005617 Bacteria 8348
73 Ga0068859_100179843 3300005617 Unclassified 2197
74 Ga0068864_100307378 3300005618 Bacteria 1486
75 Ga0068866_10010773 3300005718 Bacteria 3931
76 Ga0068861_100004101 3300005719 Bacteria 9769
77 Ga0068861_100161086 3300005719 Bacteria 1851
78 Ga0068870_10001393 3300005840 Bacteria 9764
79 Ga0068863_100049110 3300005841 Bacteria 4001
80 Ga0068858_100250175 3300005842 Bacteria 1683
81 Ga0068860_100000039 3300005843 Bacteria 232543
82 Ga0068860_100003543 3300005843 Bacteria 16050
83 Ga0068860_100050911 3300005843 Bacteria 3942
84 Ga0068860_100057823 3300005843 Bacteria 3687
85 Ga0068860_100059373 3300005843 Bacteria 3636
86 Ga0068860_100119958 3300005843 Unclassified 2518
87 Ga0068860_100132400 3300005843 Bacteria 2394
88 Ga0068862_100000478 3300005844 Bacteria 42908
89 Ga0068862_100018543 3300005844 Bacteria 5797
90 Ga0068862_100018815 3300005844 Bacteria 5756
91 Ga0081455_10030506 3300005937 Bacteria 4895
92 Ga0081538_10001285 3300005981 Bacteria 26085
93 Ga0070717_10000037 3300006028 Bacteria 121470
94 Ga0075366_10019194 3300006195 Bacteria 3953
95 Ga0097621_100001832 3300006237 Bacteria 14564
96 Ga0097621_100063377 3300006237 Bacteria 3038
97 Ga0068871_100018887 3300006358 Bacteria 5253
98 Ga0068871_100073161 3300006358 Bacteria 2825
99 Ga0075428_100002788 3300006844 Bacteria 19013
100 Ga0075428_100491248 3300006844 Unclassified 1313
101 Ga0075428_100533788 3300006844 Bacteria 1254
102 Ga0075430_100097198 3300006846 Bacteria 2460
103 Ga0075431_100112060 3300006847 Bacteria 2815
104 Ga0075431_100176753 3300006847 Bacteria 2192
105 Ga0075433_10025152 3300006852 Bacteria 5032
106 Ga0075433_10025695 3300006852 Bacteria 4980
107 Ga0075433_10071500 3300006852 Bacteria 3049
108 Ga0075433_10117512 3300006852 Bacteria 2360
109 Ga0075434_100002983 3300006871 Bacteria 15057
110 Ga0075434_100006610 3300006871 Bacteria 10635
111 Ga0075434_100039389 3300006871 Bacteria 4683
112 Ga0075434_100092518 3300006871 Bacteria 3027
113 Ga0075434_100172712 3300006871 Bacteria 2181
114 Ga0075429_100050569 3300006880 Bacteria 3616
115 Ga0068865_100003098 3300006881 Bacteria 9954
116 Ga0068865_100058813 3300006881 Bacteria 2686
117 Ga0097620_100000875 3300006931 Bacteria 30715
118 Ga0097620_100013050 3300006931 Bacteria 8348
119 Ga0097620_100179850 3300006931 Unclassified 2197
120 Ga0075435_100044273 3300007076 Bacteria 3564
121 Ga0075435_100159363 3300007076 Bacteria 1900
122 Ga0105240_10007861 3300009093 Bacteria 15391
123 Ga0105240_10069394 3300009093 Bacteria 4362
124 Ga0105240_10073488 3300009093 Bacteria 4222
125 Ga0111539_10000715 3300009094 Bacteria 43156
126 Ga0111539_10013822 3300009094 Bacteria 10089
127 Ga0111539_10069603 3300009094 Bacteria 4155
128 Ga0111539_10228551 3300009094 Bacteria 2167
129 Ga0111539_10289143 3300009094 Unclassified 1907
130 Ga0111539_10436729 3300009094 Bacteria 1524
131 Ga0114129_10013599 3300009147 Bacteria 11597
132 Ga0114129_10093045 3300009147 Bacteria 4177
133 Ga0114129_10109116 3300009147 Bacteria 3820
134 Ga0114129_10246916 3300009147 Unclassified 2397
135 Ga0105243_10049802 3300009148 Bacteria 3306
136 Ga0105243_10070482 3300009148 Unclassified 2823
137 Ga0105243_10177571 3300009148 Bacteria 1849
138 Ga0105248_10031974 3300009177 Bacteria 5880
139 Ga0105248_10075418 3300009177 Unclassified 3791
140 Ga0105237_10010157 3300009545 Bacteria 10032
141 Ga0105237_10042524 3300009545 Bacteria 4581
142 Ga0105237_10130290 3300009545 Bacteria 2510
143 Ga0105238_10065845 3300009551 Bacteria 3624
144 Ga0105249_10017000 3300009553 Bacteria 6453
145 Ga0105249_10140860 3300009553 Bacteria 2313
146 Ga0105239_10000015 3300010375 Bacteria 319892
147 Ga0105239_10060393 3300010375 Bacteria 4161
148 Ga0105239_10201055 3300010375 Bacteria 2232
149 Ga0157373_10002882 3300013100 Bacteria 13007
150 Ga0157371_10000229 3300013102 Bacteria 81458
151 Ga0157371_10005552 3300013102 Bacteria 10604
152 Ga0157370_10004701 3300013104 Bacteria 15566
153 Ga0157370_10096649 3300013104 Bacteria 2771
154 Ga0157370_10152332 3300013104 Bacteria 2151
155 Ga0157369_10000101 3300013105 Bacteria 118683
156 Ga0157369_10031926 3300013105 Bacteria 5794
157 Ga0157374_10018889 3300013296 Bacteria 6094
158 Ga0157374_10235258 3300013296 Bacteria 1800
159 Ga0157378_10056515 3300013297 Bacteria 3497
160 Ga0157378_10075864 3300013297 Bacteria 3028
161 Ga0163162_10027007 3300013306 Bacteria 5677
162 Ga0163162_10807438 3300013306 Unclassified 1055
163 Ga0157372_10000041 3300013307 Bacteria 158494
164 Ga0157372_10000051 3300013307 Bacteria 136437
165 Ga0157372_10021227 3300013307 Bacteria 7015
166 Ga0157372_10169784 3300013307 Bacteria 2523
167 Ga0157375_10003605 3300013308 Bacteria 13436
168 Ga0157380_10000021 3300014326 Bacteria 114368
169 Ga0157380_10041094 3300014326 Bacteria 3607
170 Ga0157380_10114093 3300014326 Bacteria 2276
171 Ga0209233_1001543 3300025261 Bacteria 9031
172 Ga0207653_10006015 3300025885 Bacteria 3783
173 Ga0207647_10001231 3300025904 Bacteria 19711
174 Ga0207647_10040446 3300025904 Bacteria 2936
175 Ga0207643_10003644 3300025908 Bacteria 8301
176 Ga0207643_10140121 3300025908 Bacteria 1444
177 Ga0207684_10086712 3300025910 Bacteria 2666
178 Ga0207707_10009797 3300025912 Bacteria 8310
179 Ga0207695_10010273 3300025913 Bacteria 11471
180 Ga0207695_10126922 3300025913 Bacteria 2512
181 Ga0207671_10002151 3300025914 Bacteria 21494
182 Ga0207671_10098696 3300025914 Bacteria 2209
183 Ga0207660_10006688 3300025917 Bacteria 7471
184 Ga0207660_10123729 3300025917 Bacteria 1962
185 Ga0207657_10043954 3300025919 Bacteria 3931
186 Ga0207652_10007397 3300025921 Bacteria 8855
187 Ga0207652_10014623 3300025921 Bacteria 6361
188 Ga0207646_10000029 3300025922 Bacteria 223317
189 Ga0207681_10003887 3300025923 Bacteria 9275
190 Ga0207681_10035233 3300025923 Unclassified 3296
191 Ga0207694_10033838 3300025924 Bacteria 3916
192 Ga0207650_10054806 3300025925 Bacteria 2959
193 Ga0207650_10168411 3300025925 Bacteria 1740
194 Ga0207659_10002146 3300025926 Bacteria 11709
195 Ga0207700_10011988 3300025928 Bacteria 5562
196 Ga0207644_10091493 3300025931 Bacteria 2268
197 Ga0207690_10019136 3300025932 Bacteria 4209
198 Ga0207706_10019561 3300025933 Bacteria 6091
199 Ga0207709_10010840 3300025935 Bacteria 5021
200 Ga0207709_10012162 3300025935 Bacteria 4743
201 Ga0207670_10002278 3300025936 Bacteria 10051
202 Ga0207704_10041163 3300025938 Bacteria 2707
203 Ga0207691_10014863 3300025940 Bacteria 7419
204 Ga0207691_10020593 3300025940 Bacteria 6236
205 Ga0207711_10030183 3300025941 Unclassified 4572
206 Ga0207711_10045383 3300025941 Bacteria 3756
207 Ga0207689_10000497 3300025942 Bacteria 37074
208 Ga0207689_10026348 3300025942 Bacteria 4867
209 Ga0207689_10114689 3300025942 Bacteria 2215
210 Ga0207661_10002989 3300025944 Bacteria 11694
211 Ga0207667_10021658 3300025949 Bacteria 7121
212 Ga0207667_10370286 3300025949 Bacteria 1460
213 Ga0207651_10042479 3300025960 Bacteria 3026
214 Ga0207651_10338033 3300025960 Unclassified 1264
215 Ga0207712_10027340 3300025961 Bacteria 3808
216 Ga0207668_10011747 3300025972 Bacteria 5335
217 Ga0207640_10118404 3300025981 Bacteria 1892
218 Ga0207677_10005036 3300026023 Bacteria 7139
219 Ga0207703_10010340 3300026035 Bacteria 7305
220 Ga0207703_10188436 3300026035 Unclassified 1825
221 Ga0207703_10387500 3300026035 Bacteria 1294
222 Ga0207639_10075231 3300026041 Bacteria 2655
223 Ga0207678_10048526 3300026067 Bacteria 3669
224 Ga0207708_10046189 3300026075 Bacteria 3317
225 Ga0207702_10002039 3300026078 Bacteria 19561
226 Ga0207648_10001533 3300026089 Bacteria 25441
227 Ga0207648_10011836 3300026089 Bacteria 8199
228 Ga0207676_10069694 3300026095 Bacteria 2817
229 Ga0207674_10000582 3300026116 Bacteria 48019
230 Ga0207674_10012993 3300026116 Bacteria 9280
231 Ga0207674_10031733 3300026116 Bacteria 5547
232 Ga0207674_10072515 3300026116 Bacteria 3460
233 Ga0207674_10085099 3300026116 Bacteria 3159
234 Ga0207674_10199069 3300026116 Bacteria 1953
235 Ga0207675_100000642 3300026118 Bacteria 34349
236 Ga0207683_10101439 3300026121 Bacteria 2569
237 Ga0207698_10055367 3300026142 Bacteria 3057
238 Ga0209998_10007976 3300027717 Bacteria 2198
239 Ga0207428_10000631 3300027907 Bacteria 41443
240 Ga0207428_10002604 3300027907 Bacteria 18021
241 Ga0207428_10016082 3300027907 Bacteria 6447
242 Ga0207428_10072606 3300027907 Bacteria 2701
243 Ga0268265_10000511 3300028380 Bacteria 39803
244 Ga0268264_10008165 3300028381 Bacteria 8697
245 Ga0268264_10009207 3300028381 Bacteria 8179
246 Ga0268264_10043904 3300028381 Bacteria 3706
247 Ga0268264_10105924 3300028381 Bacteria 2454
248 Ga0268264_10265200 3300028381 Bacteria 1602
249 Ga0268264_10303903 3300028381 Bacteria 1503
250 Ga0265337_1020077 3300028556 Bacteria 2097
251 Ga0265319_1000361 3300028563 Bacteria 32836
252 Ga0265319_1004919 3300028563 Bacteria 6526
253 Ga0265319_1015453 3300028563 Bacteria 2960
254 Ga0265319_1022585 3300028563 Bacteria 2290
255 Ga0265334_10032748 3300028573 Bacteria 2071
256 Ga0265318_10002462 3300028577 Bacteria 9893
257 Ga0265318_10003378 3300028577 Bacteria 8042
258 Ga0265322_10005680 3300028654 Bacteria 3685
259 Ga0265338_10000793 3300028800 Bacteria 53516
260 Ga0265324_10011113 3300029957 Bacteria 3442
261 Ga0265330_10056883 3300031235 Bacteria 1707
262 Ga0265328_10071483 3300031239 Bacteria 1275
263 Ga0265320_10000113 3300031240 Bacteria 70098
264 Ga0265320_10000205 3300031240 Bacteria 47959
265 Ga0265320_10002122 3300031240 Bacteria 13938
266 Ga0265320_10035689 3300031240 Bacteria 2519
267 Ga0265320_10050428 3300031240 Unclassified 2022
268 Ga0265325_10006667 3300031241 Bacteria 6986
269 Ga0265339_10079978 3300031249 Bacteria 1729
270 Ga0265327_10000066 3300031251 Bacteria 221705
271 Ga0265316_10008003 3300031344 Bacteria 9871
272 Ga0265316_10023410 3300031344 Bacteria 5189
273 Ga0307408_100000007 3300031548 Bacteria 463086
274 Ga0265313_10003682 3300031595 Bacteria 12243
275 Ga0265313_10003743 3300031595 Bacteria 12098
276 Ga0265313_10025644 3300031595 Bacteria 3117
277 Ga0265313_10039486 3300031595 Unclassified 2341
278 Ga0265314_10002380 3300031711 Bacteria 19347
279 Ga0265314_10028191 3300031711 Bacteria 4190
280 Ga0265342_10034831 3300031712 Bacteria 3086
281 Ga0265342_10083858 3300031712 Bacteria 1836
282 Ga0307410_10000001 3300031852 Bacteria 162839
283 Ga0307407_10056910 3300031903 Bacteria 2266
284 Ga0307409_100000033 3300031995 Bacteria 48825
285 Ga0307416_100000111 3300032002 Bacteria 50097
286 Ga0307414_10000103 3300032004 Bacteria 60951
287 Ga0395899_0000024 3300037312 Bacteria 357402
288 Ga0395900_0023779 3300037418 Bacteria 6269
289 Ga0395898_0137646 3300037466 Unclassified 2338
290 Ga0395905_0000119 3300037471 Bacteria 131498
291 Ga0395905_0001264 3300037471 Bacteria 31261
292 Ga0395905_0193630 3300037471 Unclassified 1907
293 Ga0436361_0265633 3300039447 Bacteria 11560
294 Ga0436363_0569829 3300039450 Bacteria 5046
295 Ga0436363_0775270 3300039450 Bacteria 16759
296 Ga0439441_008285 3300042001 Bacteria 1694
297 Ga0451577_0003313 3300042876 Bacteria 18095
298 Ga0451577_0005629 3300042876 Bacteria 12731
299 Ga0451577_0161640 3300042876 Bacteria 2017
300 Ga0466972_0003634 3300044658 Bacteria 7662
301 Ga0453683_0078361 3300044673 Bacteria 2069
302 Ga0466966_0020397 3300044684 Bacteria 4358
303 Ga0453684_0002340 3300044712 Bacteria 46360
304 Ga0453684_0018421 3300044712 Bacteria 10717
305 Ga0453684_0028651 3300044712 Bacteria 7937
306 Ga0453684_0130172 3300044712 Bacteria 3020
307 Ga0466959_0089389 3300045049 Bacteria 2213
308 Ga0451576_0001322 3300045051 Bacteria 42888
309 Ga0451576_0002351 3300045051 Bacteria 28518
310 Ga0451576_0004793 3300045051 Bacteria 17341
311 Ga0451576_0006637 3300045051 Bacteria 14133
312 Ga0451576_0015231 3300045051 Bacteria 8526
313 Ga0451576_0017567 3300045051 Bacteria 7862
314 Ga0451576_0080796 3300045051 Bacteria 3382
315 Ga0451576_0153231 3300045051 Bacteria 2404
316 Ga0451576_0182102 3300045051 Bacteria 2193
317 Ga0451576_0186783 3300045051 Bacteria 2164
318 Ga0495629_0013158 3300046459 Bacteria 5974
319 Ga0495638_0048950 3300046460 Unclassified 2644
320 Ga0495594_0088874 3300046499 Bacteria 1730
321 Ga0495606_0007729 3300046507 Bacteria 9521
322 Ga0495616_0002133 3300046513 Bacteria 13256
323 Ga0495648_0028323 3300046524 Bacteria 3734
324 Ga0495642_0028338 3300046528 Bacteria 2231
325 Ga0495642_0122913 3300046528 Unclassified 1114
326 Ga0495621_0064888 3300046539 Bacteria 1333
327 Ga0495625_0053274 3300046660 Bacteria 2895
328 Ga0495625_0088661 3300046660 Bacteria 2142
329 Ga0495670_0022621 3300046691 Bacteria 3105
330 Ga0496109_0000137 3300048912 Bacteria 73456
331 Ga0496126_0149635 3300048929 Bacteria 2002
332 Ga0495678_015968 3300049459 Bacteria 3446
333 Ga0501032_0074181 3300049569 Bacteria 2267
334 Ga0501033_0002648 3300049570 Bacteria 15057
335 Ga0501034_0024542 3300049571 Bacteria 6133
336 Ga0501037_0047696 3300049573 Bacteria 3138
337 Ga0501040_0082395 3300049576 Bacteria 2230
338 Ga0501046_0005000 3300049580 Bacteria 11908
339 Ga0501047_0053160 3300049581 Bacteria 3916
340 Ga0501048_0263676 3300049582 Bacteria 1224
341 Ga0501075_0008627 3300049591 Bacteria 7106
342 Ga0501077_0003458 3300049593 Bacteria 9477
343 Ga0501079_0008260 3300049741 Bacteria 7892
344 Ga0501080_0054564 3300049742 Bacteria 3721
345 Ga0501083_0006172 3300049744 Bacteria 8500
346 Ga0501083_0015044 3300049744 Bacteria 5415
347 Ga0501083_0070577 3300049744 Bacteria 2323
348 Ga0501044_0010210 3300049823 Bacteria 10202
349 Ga0501044_0012413 3300049823 Bacteria 9225
350 nmdc:mga0k408_2155_c1 3300050493 Bacteria 7660
351 nmdc:mga05p37_14153_c1 3300050507 Bacteria 9575
352 nmdc:mga05p37_207560_c1 3300050507 Bacteria 2369
353 nmdc:mga05p37_2736_c1 3300050507 Bacteria 20503
354 nmdc:mga09592_216189_c1 3300050508 Unclassified 1661
355 nmdc:mga06r32_2111_c1 3300050510 Bacteria 17801
356 nmdc:mga06r32_76514_c1 3300050510 Bacteria 3250
357 nmdc:mga08y16_12593_c1 3300050511 Bacteria 8897
358 nmdc:mga08y16_198610_c1 3300050511 Bacteria 2079
359 nmdc:mga08y16_35679_c1 3300050511 Bacteria 5223
360 nmdc:mga08y16_5019_c1 3300050511 Bacteria 13835
361 nmdc:mga0n895_119032_c1 3300050512 Bacteria 2662
362 nmdc:mga0n895_14480_c1 3300050512 Bacteria 7165
363 nmdc:mga0n895_246331_c1 3300050512 Bacteria 1814
364 nmdc:mga0n895_43124_c1 3300050512 Bacteria 4394
365 nmdc:mga0rr50_14735_c1 3300050513 Bacteria 5140
366 nmdc:mga0rr50_9188_c1 3300050513 Bacteria 6199
367 nmdc:mga0a205_3064_c1 3300050515 Bacteria 14832
368 nmdc:mga0a205_33538_c1 3300050515 Bacteria 4922
369 nmdc:mga0a205_53419_c1 3300050515 Bacteria 3900
370 nmdc:mga0a205_8013_c1 3300050515 Bacteria 9601
371 Ga0500635_0004492 3300053080 Bacteria 3601
372 Ga0500650_0000017 3300053098 Bacteria 70720
373 Ga0500555_001274 3300053103 Bacteria 8057
374 Ga0500562_000005 3300053108 Bacteria 266746
375 Ga0500608_008141 3300053122 Bacteria 4387
376 Ga0500622_0002428 3300053156 Bacteria 13459
377 Ga0500622_0003820 3300053156 Bacteria 9809
378 Ga0501084_0034482 3300054114 Bacteria 4232
379 Ga0501084_0288226 3300054114 Bacteria 1386
380 Ga0501082_0281158 3300060353 Bacteria 1448
381 Ga0466962_0032305 3300061719 Bacteria 2506
382 2740031055 2739367866 Bacteria 4215900
383 2788434941 2786546940 Bacteria 6396474
384 2839991958 2839989709 Bacteria 3773432
385 2929159866 2929154850 Bacteria 6753285
386 Ga0068856_100177608
387 SwRhRL2b_contig_2880178
388 JGI24737J22298_10011426
389 JGI24743J22301_10007909
390 rootH2_10018539
391 rootH2_10081434
392 rootH2_10199364
393 rootL2_10175888
394 rootL2_10218372
395 rootH1_10112302
396 rootH1_10130318
397 Ga0058863_10156147
398 Ga0058862_10010797
399 Ga0065704_10003795
400 Ga0065715_10101048
401 Ga0065707_10001818
402 Ga0065707_10092896
403 Ga0070683_100016597
404 Ga0070670_100013733
405 Ga0070670_100171703
406 Ga0070670_100172413
407 Ga0068869_100000177
408 Ga0068869_100001892
409 Ga0070680_100011953
410 Ga0070680_100304516
411 Ga0068868_100004199
412 Ga0068868_100364628
413 Ga0070660_100024566
414 Ga0070689_100002744
415 Ga0070689_100025763
416 Ga0070687_100010167
417 Ga0070668_100041928
418 Ga0070669_100024744
419 Ga0070669_100038572
420 Ga0070675_100000142
421 Ga0070671_100018611
422 Ga0070659_100006520
423 Ga0070713_100002548
424 Ga0070701_10011500
425 Ga0070701_10107737
426 Ga0070705_100148008
427 Ga0070708_100028684
428 Ga0070663_100030640
429 Ga0070678_100096676
430 Ga0070662_100172734
431 Ga0070681_10004335
432 Ga0068867_100009825
433 Ga0068867_100019273
434 Ga0070706_100047834
435 Ga0070707_100000001
436 Ga0070698_100008348
437 Ga0070699_100000678
438 Ga0070699_100001984
439 Ga0070699_100040666
440 Ga0070699_100082468
441 Ga0070679_100007384
442 Ga0070679_100072137
443 Ga0070696_100009167
444 Ga0070696_100009547
445 Ga0070693_100126099
446 Ga0070704_100001350
447 Ga0070704_100015011
448 Ga0068855_100062094
449 Ga0068855_100112511
450 Ga0068855_100464976
451 Ga0068857_100018872
452 Ga0068857_100019850
453 Ga0068857_100091424
454 Ga0068856_100006147
455 Ga0068856_100055379
456 Ga0068859_100000875
457 Ga0068859_100013050
458 Ga0068859_100179843
459 Ga0068864_100307378
460 Ga0068866_10010773
461 Ga0068861_100004101
462 Ga0068861_100161086
463 Ga0068870_10001393
464 Ga0068863_100049110
465 Ga0068858_100250175
466 Ga0068860_100000039
467 Ga0068860_100003543
468 Ga0068860_100050911
469 Ga0068860_100057823
470 Ga0068860_100059373
471 Ga0068860_100119958
472 Ga0068860_100132400
473 Ga0068862_100000478
474 Ga0068862_100018543
475 Ga0068862_100018815
476 Ga0081455_10030506
477 Ga0081538_10001285
478 Ga0070717_10000037
479 Ga0075366_10019194
480 Ga0097621_100001832
481 Ga0097621_100063377
482 Ga0068871_100018887
483 Ga0068871_100073161
484 Ga0075428_100002788
485 Ga0075428_100491248
486 Ga0075428_100533788
487 Ga0075430_100097198
488 Ga0075431_100112060
489 Ga0075431_100176753
490 Ga0075433_10025152
491 Ga0075433_10025695
492 Ga0075433_10071500
493 Ga0075433_10117512
494 Ga0075434_100002983
495 Ga0075434_100006610
496 Ga0075434_100039389
497 Ga0075434_100092518
498 Ga0075434_100172712
499 Ga0075429_100050569
500 Ga0068865_100003098
501 Ga0068865_100058813
502 Ga0097620_100000875
503 Ga0097620_100013050
504 Ga0097620_100179850
505 Ga0075435_100044273
506 Ga0075435_100159363
507 Ga0105240_10007861
508 Ga0105240_10069394
509 Ga0105240_10073488
510 Ga0111539_10000715
511 Ga0111539_10013822
512 Ga0111539_10069603
513 Ga0111539_10228551
514 Ga0111539_10289143
515 Ga0111539_10436729
516 Ga0114129_10013599
517 Ga0114129_10093045
518 Ga0114129_10109116
519 Ga0114129_10246916
520 Ga0105243_10049802
521 Ga0105243_10070482
522 Ga0105243_10177571
523 Ga0105248_10031974
524 Ga0105248_10075418
525 Ga0105237_10010157
526 Ga0105237_10042524
527 Ga0105237_10130290
528 Ga0105238_10065845
529 Ga0105249_10017000
530 Ga0105249_10140860
531 Ga0105239_10000015
532 Ga0105239_10060393
533 Ga0105239_10201055
534 Ga0157373_10002882
535 Ga0157371_10000229
536 Ga0157371_10005552
537 Ga0157370_10004701
538 Ga0157370_10096649
539 Ga0157370_10152332
540 Ga0157369_10000101
541 Ga0157369_10031926
542 Ga0157374_10018889
543 Ga0157374_10235258
544 Ga0157378_10056515
545 Ga0157378_10075864
546 Ga0163162_10027007
547 Ga0163162_10807438
548 Ga0157372_10000041
549 Ga0157372_10000051
550 Ga0157372_10021227
551 Ga0157372_10169784
552 Ga0157375_10003605
553 Ga0157380_10000021
554 Ga0157380_10041094
555 Ga0157380_10114093
556 Ga0209233_1001543
557 Ga0207653_10006015
558 Ga0207647_10001231
559 Ga0207647_10040446
560 Ga0207643_10003644
561 Ga0207643_10140121
562 Ga0207684_10086712
563 Ga0207707_10009797
564 Ga0207695_10010273
565 Ga0207695_10126922
566 Ga0207671_10002151
567 Ga0207671_10098696
568 Ga0207660_10006688
569 Ga0207660_10123729
570 Ga0207657_10043954
571 Ga0207652_10007397
572 Ga0207652_10014623
573 Ga0207646_10000029
574 Ga0207681_10003887
575 Ga0207681_10035233
576 Ga0207694_10033838
577 Ga0207650_10054806
578 Ga0207650_10168411
579 Ga0207659_10002146
580 Ga0207700_10011988
581 Ga0207644_10091493
582 Ga0207690_10019136
583 Ga0207706_10019561
584 Ga0207709_10010840
585 Ga0207709_10012162
586 Ga0207670_10002278
587 Ga0207704_10041163
588 Ga0207691_10014863
589 Ga0207691_10020593
590 Ga0207711_10030183
591 Ga0207711_10045383
592 Ga0207689_10000497
593 Ga0207689_10026348
594 Ga0207689_10114689
595 Ga0207661_10002989
596 Ga0207667_10021658
597 Ga0207667_10370286
598 Ga0207651_10042479
599 Ga0207651_10338033
600 Ga0207712_10027340
601 Ga0207668_10011747
602 Ga0207640_10118404
603 Ga0207677_10005036
604 Ga0207703_10010340
605 Ga0207703_10188436
606 Ga0207703_10387500
607 Ga0207639_10075231
608 Ga0207678_10048526
609 Ga0207708_10046189
610 Ga0207702_10002039
611 Ga0207648_10001533
612 Ga0207648_10011836
613 Ga0207676_10069694
614 Ga0207674_10000582
615 Ga0207674_10012993
616 Ga0207674_10031733
617 Ga0207674_10072515
618 Ga0207674_10085099
619 Ga0207674_10199069
620 Ga0207675_100000642
621 Ga0207683_10101439
622 Ga0207698_10055367
623 Ga0209998_10007976
624 Ga0207428_10000631
625 Ga0207428_10002604
626 Ga0207428_10016082
627 Ga0207428_10072606
628 Ga0268265_10000511
629 Ga0268264_10008165
630 Ga0268264_10009207
631 Ga0268264_10043904
632 Ga0268264_10105924
633 Ga0268264_10265200
634 Ga0268264_10303903
635 Ga0265337_1020077
636 Ga0265319_1000361
637 Ga0265319_1004919
638 Ga0265319_1015453
639 Ga0265319_1022585
640 Ga0265334_10032748
641 Ga0265318_10002462
642 Ga0265318_10003378
643 Ga0265322_10005680
644 Ga0265338_10000793
645 Ga0265324_10011113
646 Ga0265330_10056883
647 Ga0265328_10071483
648 Ga0265320_10000113
649 Ga0265320_10000205
650 Ga0265320_10002122
651 Ga0265320_10035689
652 Ga0265320_10050428
653 Ga0265325_10006667
654 Ga0265339_10079978
655 Ga0265327_10000066
656 Ga0265316_10008003
657 Ga0265316_10023410
658 Ga0307408_100000007
659 Ga0265313_10003682
660 Ga0265313_10003743
661 Ga0265313_10025644
662 Ga0265313_10039486
663 Ga0265314_10002380
664 Ga0265314_10028191
665 Ga0265342_10034831
666 Ga0265342_10083858
667 Ga0307410_10000001
668 Ga0307407_10056910
669 Ga0307409_100000033
670 Ga0307416_100000111
671 Ga0307414_10000103
672 Ga0395899_0000024
673 Ga0395900_0023779
674 Ga0395898_0137646
675 Ga0395905_0000119
676 Ga0395905_0001264
677 Ga0395905_0193630
678 Ga0436361_0265633
679 Ga0436363_0569829
680 Ga0436363_0775270
681 Ga0439441_008285
682 Ga0451577_0003313
683 Ga0451577_0005629
684 Ga0451577_0161640
685 Ga0466972_0003634
686 Ga0453683_0078361
687 Ga0466966_0020397
688 Ga0453684_0002340
689 Ga0453684_0018421
690 Ga0453684_0028651
691 Ga0453684_0130172
692 Ga0466959_0089389
693 Ga0451576_0001322
694 Ga0451576_0002351
695 Ga0451576_0004793
696 Ga0451576_0006637
697 Ga0451576_0015231
698 Ga0451576_0017567
699 Ga0451576_0080796
700 Ga0451576_0153231
701 Ga0451576_0182102
702 Ga0451576_0186783
703 Ga0495629_0013158
704 Ga0495638_0048950
705 Ga0495594_0088874
706 Ga0495606_0007729
707 Ga0495616_0002133
708 Ga0495648_0028323
709 Ga0495642_0028338
710 Ga0495642_0122913
711 Ga0495621_0064888
712 Ga0495625_0053274
713 Ga0495625_0088661
714 Ga0495670_0022621
715 Ga0496109_0000137
716 Ga0496126_0149635
717 Ga0495678_015968
718 Ga0501032_0074181
719 Ga0501033_0002648
720 Ga0501034_0024542
721 Ga0501037_0047696
722 Ga0501040_0082395
723 Ga0501046_0005000
724 Ga0501047_0053160
725 Ga0501048_0263676
726 Ga0501075_0008627
727 Ga0501077_0003458
728 Ga0501079_0008260
729 Ga0501080_0054564
730 Ga0501083_0006172
731 Ga0501083_0015044
732 Ga0501083_0070577
733 Ga0501044_0010210
734 Ga0501044_0012413
735 nmdc:mga0k408_2155_c1
736 nmdc:mga05p37_14153_c1
737 nmdc:mga05p37_207560_c1
738 nmdc:mga05p37_2736_c1
739 nmdc:mga09592_216189_c1
740 nmdc:mga06r32_2111_c1
741 nmdc:mga06r32_76514_c1
742 nmdc:mga08y16_12593_c1
743 nmdc:mga08y16_198610_c1
744 nmdc:mga08y16_35679_c1
745 nmdc:mga08y16_5019_c1
746 nmdc:mga0n895_119032_c1
747 nmdc:mga0n895_14480_c1
748 nmdc:mga0n895_246331_c1
749 nmdc:mga0n895_43124_c1
750 nmdc:mga0rr50_14735_c1
751 nmdc:mga0rr50_9188_c1
752 nmdc:mga0a205_3064_c1
753 nmdc:mga0a205_33538_c1
754 nmdc:mga0a205_53419_c1
755 nmdc:mga0a205_8013_c1
756 Ga0500635_0004492
757 Ga0500650_0000017
758 Ga0500555_001274
759 Ga0500562_000005
760 Ga0500608_008141
761 Ga0500622_0002428
762 Ga0500622_0003820
763 Ga0501084_0034482
764 Ga0501084_0288226
765 Ga0501082_0281158
766 Ga0466962_0032305
767 2740031055
768 2788434941
769 2839991958
770 2929159866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

221

347

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

76

180

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

253

381

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9479 1 333
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9452 1 333
4j6f-assembly1.cif.gz_B crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021, nysgrc-target 012230 0.9286 1 332
4j6f-assembly1.cif.gz_B crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021, nysgrc-target 012230 0.9232 1 332
5k1s-assembly2.cif.gz_C crystal structure of aibc 0.9202 1 332
ID Description Score Start End Superfamily
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 152 277 3.40.50.720
4j6fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 144 298 3.40.50.720
af_Q75JT6_127_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9327 146 277 3.40.50.720
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9302 144 300 3.40.50.720
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9302 2 140 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A831Z214-F1-model_v4 Alcohol dehydrogenase 0.9883 63 332 GO:0016491
AF-A0A3D2V8D3-F1-model_v4 Alcohol dehydrogenase 0.9876 86 332 GO:0016020
GO:0016491
AF-A0A3M0YT27-F1-model_v4 Alcohol dehydrogenase 0.9836 20 333 GO:0016491
AF-A0A534PLU6-F1-model_v4 Zinc-binding dehydrogenase 0.9833 2 332 GO:0016491
AF-A0A3M0YT27-F1-model_v4 Alcohol dehydrogenase 0.9804 20 333 GO:0016491

Map