F430082

General Info

Members Datasets Scaffolds Average Seq Length
385 266 770 211

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10063546|rootL2_100635462
Length 214
Sequence MAQLFEVHPDNPQPRFLRQCAQMLQAGGIGAVPTDSSYAFVCHLNDKSAAESLRRVRGVDDKHHLTLLCRDLSELATYAMVDNRQYRLLXLLKLATPGPYTFILPATKEVPRRLSHPSRRTIGLRVPEHKVIQDLLALFGEPLLSTTLIPPGDSEPMNDAADVCDRLDRQLQFVLDAGACPAQPTTVLDLSQGEEPVLVRQGRGDLARLGLQLD

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
166 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
167 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
168 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
169 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
170 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
171 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
172 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
173 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
174 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
175 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
176 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
181 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
222 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
225 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
226 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
227 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
228 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
231 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
232 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
233 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
234 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
235 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
244 2643221570 Acidovorax sp. Root568 Isolate Unclassified
245 2643221585 Pelomonas sp. Root662 Isolate Unclassified
246 2643221596 Acidovorax sp. Root70 Isolate Unclassified
247 2643221609 Acidovorax sp. Root217 Isolate Unclassified
248 2643221611 Acidovorax sp. Root219 Isolate Unclassified
249 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
250 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
251 2643221652 Acidovorax sp. Root402 Isolate Unclassified
252 2643221656 Pelomonas sp. Root405 Isolate Unclassified
253 2643221660 Methylibium sp. Root1272 Isolate Unclassified
254 2721755523 Delftia sp. HK171 Isolate Unclassified
255 2738541337 Pelomonas sp. BT06 Isolate Unclassified
256 2738543012 Acidovorax sp. CF301 Isolate Unclassified
257 2816332133 Acidovorax radicis 2721A Isolate Unclassified
258 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
259 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
260 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
261 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
262 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
263 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
264 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
265 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
266 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.77
Metatranscriptomes 0
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 0.52
Rhizoplane 0.78
Rhizosphere 84.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10063546 3300003322 Bacteria 3613
2 rootH1_10016057 3300003323 Bacteria 8060
3 Ga0055540_1033148 3300003792 Bacteria 1172
4 Ga0055531_10000168 3300003794 Bacteria 73798
5 Ga0065707_10006264 3300005295 Bacteria 2935
6 Ga0070676_10005742 3300005328 Bacteria 6615
7 Ga0070690_100009859 3300005330 Bacteria 5544
8 Ga0070670_100025538 3300005331 Bacteria 5081
9 Ga0068869_100020066 3300005334 Bacteria 4577
10 Ga0070666_10052753 3300005335 Bacteria 2741
11 Ga0068868_100038069 3300005338 Bacteria 3732
12 Ga0070687_100092028 3300005343 Bacteria 1680
13 Ga0070661_100118690 3300005344 Bacteria 1979
14 Ga0070668_100004465 3300005347 Bacteria 10381
15 Ga0070669_100001532 3300005353 Bacteria 16719
16 Ga0070675_100119512 3300005354 Bacteria 2238
17 Ga0070675_100299899 3300005354 Bacteria 1415
18 Ga0070671_100187072 3300005355 Bacteria 1755
19 Ga0070671_100564873 3300005355 Bacteria 982
20 Ga0070674_100011962 3300005356 Bacteria 5310
21 Ga0070673_100042474 3300005364 Bacteria 3506
22 Ga0070673_100095924 3300005364 Bacteria 2433
23 Ga0070688_100112381 3300005365 Bacteria 1814
24 Ga0070667_100021469 3300005367 Bacteria 5360
25 Ga0070701_10176736 3300005438 Bacteria 1247
26 Ga0070678_100823502 3300005456 Bacteria 844
27 Ga0070662_100002655 3300005457 Bacteria 11032
28 Ga0070662_100039770 3300005457 Bacteria 3345
29 Ga0068867_100000018 3300005459 Bacteria 102056
30 Ga0068867_100031536 3300005459 Bacteria 3827
31 Ga0070707_100045504 3300005468 Bacteria 4201
32 Ga0070679_100029946 3300005530 Bacteria 5370
33 Ga0068853_100091695 3300005539 Bacteria 2673
34 Ga0070672_100002627 3300005543 Bacteria 11487
35 Ga0070672_100012779 3300005543 Bacteria 5910
36 Ga0070672_100020069 3300005543 Bacteria 4868
37 Ga0070672_100023730 3300005543 Bacteria 4525
38 Ga0070686_100338423 3300005544 Bacteria 1127
39 Ga0070693_100275001 3300005547 Bacteria 1126
40 Ga0068855_100177446 3300005563 Bacteria 2409
41 Ga0070664_100360520 3300005564 Bacteria 1324
42 Ga0070664_100625440 3300005564 Bacteria 999
43 Ga0068857_101046330 3300005577 Bacteria 787
44 Ga0068854_100536949 3300005578 Bacteria 990
45 Ga0068856_100062849 3300005614 Bacteria 3668
46 Ga0068859_100012344 3300005617 Bacteria 8594
47 Ga0068859_100825830 3300005617 Bacteria 1013
48 Ga0068864_100031163 3300005618 Bacteria 4524
49 Ga0068864_100048795 3300005618 Bacteria 3640
50 Ga0068864_100183278 3300005618 Bacteria 1915
51 Ga0068866_10002956 3300005718 Bacteria 7012
52 Ga0068861_100007169 3300005719 Bacteria 7633
53 Ga0068861_100444296 3300005719 Bacteria 1161
54 Ga0068851_10098832 3300005834 Bacteria 1546
55 Ga0068851_10121897 3300005834 Bacteria 1402
56 Ga0068870_10229525 3300005840 Bacteria 1140
57 Ga0068863_100002824 3300005841 Bacteria 17200
58 Ga0068863_100125505 3300005841 Bacteria 2448
59 Ga0068858_100006859 3300005842 Bacteria 11068
60 Ga0068858_100012166 3300005842 Bacteria 8113
61 Ga0068860_100014457 3300005843 Bacteria 7728
62 Ga0068860_100017973 3300005843 Bacteria 6887
63 Ga0068862_100020991 3300005844 Bacteria 5457
64 Ga0075362_10165575 3300006177 Bacteria 1066
65 Ga0075367_10098256 3300006178 Bacteria 1787
66 Ga0075366_10153986 3300006195 Bacteria 1392
67 Ga0097621_100047437 3300006237 Bacteria 3481
68 Ga0075370_10006142 3300006353 Bacteria 6025
69 Ga0075370_10008533 3300006353 Bacteria 5277
70 Ga0075370_10012702 3300006353 Bacteria 4459
71 Ga0068871_100049891 3300006358 Bacteria 3384
72 Ga0068871_100636306 3300006358 Bacteria 973
73 Ga0097620_100012344 3300006931 Bacteria 8594
74 Ga0097620_100825776 3300006931 Bacteria 1013
75 Ga0079104_1000055 3300006946 Bacteria 166522
76 Ga0105250_10001549 3300009092 Bacteria 12351
77 Ga0105240_10012990 3300009093 Bacteria 11470
78 Ga0111539_10026670 3300009094 Bacteria 7062
79 Ga0111539_10067008 3300009094 Bacteria 4241
80 Ga0105247_10361056 3300009101 Bacteria 1024
81 Ga0114129_10464548 3300009147 Bacteria 1658
82 Ga0105243_10000396 3300009148 Bacteria 46054
83 Ga0105243_10004995 3300009148 Bacteria 10394
84 Ga0105243_10024011 3300009148 Bacteria 4647
85 Ga0105243_10103171 3300009148 Bacteria 2371
86 Ga0105243_10545394 3300009148 Bacteria 1107
87 Ga0105242_10000304 3300009176 Bacteria 39272
88 Ga0105242_10007281 3300009176 Bacteria 8532
89 Ga0105248_10004571 3300009177 Bacteria 15327
90 Ga0105248_10186676 3300009177 Bacteria 2336
91 Ga0105238_10671580 3300009551 Bacteria 1047
92 Ga0105238_10740046 3300009551 Bacteria 997
93 Ga0105249_10004139 3300009553 Bacteria 12526
94 Ga0157369_10986159 3300013105 Bacteria 863
95 Ga0157374_10767566 3300013296 Bacteria 979
96 Ga0157378_10951824 3300013297 Bacteria 891
97 Ga0163162_10039880 3300013306 Bacteria 4693
98 Ga0157372_11094134 3300013307 Bacteria 922
99 Ga0157375_10049036 3300013308 Bacteria 4135
100 Ga0157375_10099657 3300013308 Bacteria 2985
101 Ga0163163_10671578 3300014325 Bacteria 1100
102 Ga0157380_10012619 3300014326 Bacteria 6131
103 Ga0157380_10027460 3300014326 Bacteria 4329
104 Ga0157377_10000051 3300014745 Bacteria 90204
105 Ga0157379_10006477 3300014968 Bacteria 10093
106 Ga0157379_10019020 3300014968 Bacteria 6064
107 Ga0157376_10040201 3300014969 Bacteria 3821
108 Ga0163161_10385185 3300017792 Bacteria 1121
109 Ga0163161_10532461 3300017792 Bacteria 961
110 Ga0209050_1007301 3300025298 Bacteria 6238
111 Ga0209051_1003849 3300025303 Bacteria 9603
112 Ga0209051_1034313 3300025303 Bacteria 1904
113 Ga0209257_1000021 3300025304 Bacteria 771986
114 Ga0207656_10037609 3300025321 Bacteria 2037
115 Ga0207656_10048620 3300025321 Bacteria 1827
116 Ga0207656_10170199 3300025321 Bacteria 1041
117 Ga0207696_1008438 3300025711 Bacteria 3937
118 Ga0207682_10047628 3300025893 Bacteria 1765
119 Ga0207682_10094114 3300025893 Bacteria 1303
120 Ga0207642_10004076 3300025899 Bacteria 4681
121 Ga0207645_10018374 3300025907 Bacteria 4600
122 Ga0207645_10218402 3300025907 Bacteria 1256
123 Ga0207643_10048864 3300025908 Bacteria 2397
124 Ga0207707_10253871 3300025912 Bacteria 1527
125 Ga0207695_10159876 3300025913 Bacteria 2185
126 Ga0207652_10121822 3300025921 Bacteria 2321
127 Ga0207652_10313350 3300025921 Bacteria 1416
128 Ga0207646_10076222 3300025922 Bacteria 2996
129 Ga0207646_10968103 3300025922 Bacteria 753
130 Ga0207681_10012011 3300025923 Bacteria 5334
131 Ga0207650_10018918 3300025925 Bacteria 4839
132 Ga0207650_10146223 3300025925 Bacteria 1862
133 Ga0207659_10006867 3300025926 Bacteria 7000
134 Ga0207659_10015663 3300025926 Bacteria 4919
135 Ga0207659_10192680 3300025926 Bacteria 1623
136 Ga0207659_10255108 3300025926 Bacteria 1424
137 Ga0207644_10056129 3300025931 Bacteria 2841
138 Ga0207644_10154301 3300025931 Bacteria 1779
139 Ga0207644_10184728 3300025931 Bacteria 1636
140 Ga0207644_10478427 3300025931 Bacteria 1025
141 Ga0207706_10022153 3300025933 Bacteria 5703
142 Ga0207686_10001824 3300025934 Bacteria 11851
143 Ga0207686_10007348 3300025934 Bacteria 5928
144 Ga0207709_10000273 3300025935 Bacteria 60743
145 Ga0207709_10004013 3300025935 Bacteria 8575
146 Ga0207709_10046813 3300025935 Bacteria 2626
147 Ga0207669_10010082 3300025937 Bacteria 4534
148 Ga0207691_10023080 3300025940 Bacteria 5859
149 Ga0207691_10023147 3300025940 Bacteria 5849
150 Ga0207691_10111377 3300025940 Bacteria 2434
151 Ga0207711_10021272 3300025941 Bacteria 5418
152 Ga0207711_10103330 3300025941 Bacteria 2523
153 Ga0207689_10002311 3300025942 Bacteria 17851
154 Ga0207661_10148819 3300025944 Bacteria 2022
155 Ga0207679_10141003 3300025945 Bacteria 1948
156 Ga0207679_10147582 3300025945 Bacteria 1910
157 Ga0207679_10527166 3300025945 Bacteria 1057
158 Ga0207651_10027591 3300025960 Bacteria 3568
159 Ga0207651_10158453 3300025960 Bacteria 1771
160 Ga0207712_10006123 3300025961 Bacteria 7586
161 Ga0207640_10031051 3300025981 Bacteria 3297
162 Ga0207658_10002962 3300025986 Bacteria 12152
163 Ga0207658_10390304 3300025986 Bacteria 1221
164 Ga0207677_10004558 3300026023 Bacteria 7451
165 Ga0207703_10005338 3300026035 Bacteria 10351
166 Ga0207703_10035524 3300026035 Bacteria 3960
167 Ga0207639_10373026 3300026041 Bacteria 1279
168 Ga0207702_10132683 3300026078 Bacteria 2243
169 Ga0207641_10005111 3300026088 Bacteria 11237
170 Ga0207648_10049294 3300026089 Bacteria 3685
171 Ga0207676_10007217 3300026095 Bacteria 7868
172 Ga0207676_10027600 3300026095 Bacteria 4230
173 Ga0207676_10162122 3300026095 Bacteria 1938
174 Ga0207674_10073380 3300026116 Bacteria 3435
175 Ga0207675_100008733 3300026118 Bacteria 9517
176 Ga0207675_100550099 3300026118 Bacteria 1153
177 Ga0207683_10029085 3300026121 Bacteria 4782
178 Ga0207683_10243131 3300026121 Bacteria 1642
179 Ga0207698_10019789 3300026142 Bacteria 4617
180 Ga0209281_1000007 3300027111 Bacteria 938265
181 Ga0209969_1010973 3300027360 Bacteria 1299
182 Ga0209970_1000278 3300027614 Bacteria 8497
183 Ga0209966_1000039 3300027695 Bacteria 54525
184 Ga0209974_10020847 3300027876 Bacteria 2172
185 Ga0268265_10019914 3300028380 Bacteria 4673
186 Ga0268264_10001473 3300028381 Bacteria 21971
187 Ga0268264_10013755 3300028381 Bacteria 6657
188 Ga0307515_10001755 3300028794 Bacteria 48316
189 Ga0307515_10003446 3300028794 Bacteria 33294
190 Ga0307515_10027450 3300028794 Bacteria 9731
191 Ga0307515_10142340 3300028794 Bacteria 2564
192 Ga0265324_10032438 3300029957 Bacteria 1825
193 Ga0307512_10047678 3300030522 Bacteria 3479
194 Ga0265327_10019319 3300031251 Bacteria 4194
195 Ga0307513_10068624 3300031456 Bacteria 3713
196 Ga0307509_10442048 3300031507 Bacteria 996
197 Ga0307408_100000008 3300031548 Bacteria 456355
198 Ga0307408_100611215 3300031548 Bacteria 970
199 Ga0307408_100879363 3300031548 Bacteria 819
200 Ga0307408_101202873 3300031548 Bacteria 707
201 Ga0307514_10001936 3300031649 Bacteria 22633
202 Ga0307514_10003659 3300031649 Bacteria 14582
203 Ga0307516_10000017 3300031730 Bacteria 202506
204 Ga0307516_10093572 3300031730 Bacteria 2831
205 Ga0307405_10194342 3300031731 Bacteria 1468
206 Ga0307406_10247922 3300031901 Bacteria 1340
207 Ga0307406_10605503 3300031901 Bacteria 904
208 Ga0307412_10257307 3300031911 Bacteria 1359
209 Ga0307412_10336768 3300031911 Bacteria 1206
210 Ga0307412_10388003 3300031911 Bacteria 1133
211 Ga0307416_100264809 3300032002 Bacteria 1683
212 Ga0307414_10004474 3300032004 Bacteria 7593
213 Ga0307411_10000169 3300032005 Bacteria 20966
214 Ga0307411_10217296 3300032005 Bacteria 1480
215 Ga0307510_10427154 3300033180 Bacteria 767
216 Ga0373923_0183623 3300035111 Bacteria 962
217 Ga0373936_0097698 3300035113 Bacteria 1237
218 Ga0373939_0000033 3300035114 Bacteria 49449
219 Ga0373943_0259292 3300035170 Bacteria 978
220 Ga0373943_0295274 3300035170 Bacteria 919
221 Ga0373955_0052931 3300035172 Bacteria 2215
222 Ga0373961_0026728 3300035241 Bacteria 1579
223 Ga0373931_0002101 3300035691 Bacteria 8768
224 Ga0373935_0137543 3300035692 Bacteria 1647
225 Ga0373927_0071550 3300035695 Bacteria 2245
226 Ga0373947_0131892 3300035725 Bacteria 1596
227 Ga0373937_0049067 3300036401 Bacteria 3866
228 Ga0373937_0263597 3300036401 Bacteria 1625
229 Ga0373925_0027369 3300037068 Bacteria 4173
230 Ga0373925_0027606 3300037068 Bacteria 4155
231 Ga0395899_0138524 3300037312 Bacteria 1733
232 Ga0395899_0258580 3300037312 Bacteria 1192
233 Ga0395900_0000058 3300037418 Bacteria 206785
234 Ga0395900_0015329 3300037418 Bacteria 7813
235 Ga0395900_0088773 3300037418 Bacteria 3178
236 Ga0395900_0089391 3300037418 Bacteria 3166
237 Ga0395898_0002397 3300037466 Bacteria 22266
238 Ga0395898_0142752 3300037466 Bacteria 2292
239 Ga0395898_0246581 3300037466 Bacteria 1703
240 Ga0395905_0009525 3300037471 Bacteria 9489
241 Ga0395905_0015672 3300037471 Bacteria 7202
242 Ga0395905_0016475 3300037471 Bacteria 7026
243 Ga0395905_0029320 3300037471 Bacteria 5184
244 Ga0395905_0041430 3300037471 Bacteria 4321
245 Ga0395905_0047046 3300037471 Bacteria 4044
246 Ga0395905_0052682 3300037471 Bacteria 3809
247 Ga0395905_0301302 3300037471 Bacteria 1490
248 Ga0395901_0024345 3300038443 Bacteria 6213
249 Ga0395901_0029467 3300038443 Bacteria 5652
250 Ga0395901_0042575 3300038443 Bacteria 4708
251 Ga0395901_0069549 3300038443 Bacteria 3666
252 Ga0395901_0097690 3300038443 Bacteria 3079
253 Ga0395901_0464349 3300038443 Bacteria 1293
254 Ga0436365_1250245 3300039437 Bacteria 6909
255 Ga0439436_0038940 3300041404 Bacteria 1366
256 Ga0439461_0011603 3300041410 Bacteria 1637
257 Ga0439465_0153652 3300041413 Bacteria 823
258 Ga0451853_2151987 3300041512 Bacteria 1270
259 Ga0439432_113242 3300042006 Bacteria 806
260 Ga0439449_0000464 3300042007 Bacteria 15110
261 Ga0439462_0040827 3300042015 Bacteria 1238
262 Ga0450912_006038 3300042116 Bacteria 950
263 Ga0450917_002835 3300042120 Bacteria 1245
264 Ga0450888_001688 3300042126 Bacteria 2132
265 Ga0450890_003610 3300042127 Bacteria 2048
266 Ga0450891_000618 3300042129 Bacteria 3697
267 Ga0450892_001733 3300042130 Bacteria 2013
268 Ga0450896_022411 3300042133 Bacteria 931
269 Ga0450898_005440 3300042134 Bacteria 1925
270 Ga0450899_002710 3300042135 Bacteria 1916
271 Ga0450903_010808 3300042138 Bacteria 1475
272 Ga0450904_025368 3300042139 Bacteria 610
273 Ga0450889_001379 3300042144 Bacteria 2506
274 Ga0439446_0016146 3300042156 Bacteria 2078
275 Ga0439434_0075897 3300042435 Bacteria 1062
276 Ga0450916_017980 3300042530 Bacteria 949
277 Ga0450893_0000790 3300042532 Bacteria 4643
278 Ga0451577_0000190 3300042876 Bacteria 130692
279 Ga0451577_0002431 3300042876 Bacteria 22208
280 Ga0451577_0013731 3300042876 Bacteria 7569
281 Ga0451577_0251531 3300042876 Bacteria 1600
282 Ga0451577_0644162 3300042876 Bacteria 961
283 Ga0466969_0000142 3300044656 Bacteria 38991
284 Ga0466969_0001537 3300044656 Bacteria 12389
285 Ga0466969_0227536 3300044656 Bacteria 847
286 Ga0453683_0003001 3300044673 Bacteria 12644
287 Ga0466965_0024791 3300044683 Bacteria 2902
288 Ga0466965_0283668 3300044683 Bacteria 895
289 Ga0466966_0000766 3300044684 Bacteria 20373
290 Ga0466966_0026204 3300044684 Bacteria 3807
291 Ga0466966_0033135 3300044684 Bacteria 3345
292 Ga0466961_0019550 3300044693 Bacteria 4357
293 Ga0466961_0294215 3300044693 Bacteria 992
294 Ga0466963_0009355 3300044694 Bacteria 5899
295 Ga0466964_0030879 3300044706 Bacteria 2122
296 Ga0453684_0000618 3300044712 Bacteria 129995
297 Ga0453684_0115434 3300044712 Bacteria 3253
298 Ga0466971_0030908 3300044719 Bacteria 2397
299 Ga0466970_0024320 3300044765 Bacteria 3166
300 Ga0466970_0101357 3300044765 Bacteria 1568
301 Ga0466957_0035141 3300044842 Bacteria 3007
302 Ga0466959_0009923 3300045049 Bacteria 6788
303 Ga0466959_0040522 3300045049 Bacteria 3440
304 Ga0451576_0031290 3300045051 Bacteria 5676
305 Ga0451576_0074051 3300045051 Bacteria 3543
306 Ga0451576_0077041 3300045051 Bacteria 3470
307 Ga0451576_0436439 3300045051 Bacteria 1374
308 Ga0466967_0037586 3300045976 Bacteria 4144
309 Ga0495629_0036189 3300046459 Bacteria 3486
310 Ga0495618_0324012 3300046514 Bacteria 954
311 Ga0495642_0006747 3300046528 Bacteria 4401
312 Ga0495654_0003871 3300046530 Bacteria 9040
313 Ga0495621_0205589 3300046539 Bacteria 793
314 Ga0495633_0011542 3300046558 Bacteria 4756
315 Ga0495656_0053171 3300046615 Bacteria 1739
316 Ga0495635_0141555 3300046663 Bacteria 1638
317 Ga0495635_0227367 3300046663 Bacteria 1261
318 Ga0495588_0172814 3300046674 Bacteria 1142
319 Ga0495657_0160566 3300046675 Bacteria 1391
320 Ga0495647_0035717 3300046681 Bacteria 1867
321 Ga0495658_0075209 3300046683 Bacteria 1970
322 Ga0495600_0292335 3300046809 Bacteria 1029
323 Ga0495660_0224714 3300046810 Bacteria 883
324 Ga0495674_0181655 3300047319 Bacteria 1752
325 Ga0495680_0076670 3300047322 Bacteria 2534
326 Ga0495680_0226094 3300047322 Bacteria 1334
327 Ga0495684_0035208 3300047471 Bacteria 3840
328 Ga0495684_0266013 3300047471 Bacteria 1242
329 Ga0496109_0100684 3300048912 Bacteria 2681
330 Ga0496111_0412343 3300048914 Bacteria 998
331 Ga0496112_0012196 3300048915 Bacteria 7888
332 Ga0496122_0018075 3300048925 Bacteria 6535
333 Ga0496124_0000024 3300048927 Bacteria 414291
334 Ga0496125_0001023 3300048928 Bacteria 43458
335 Ga0496125_0326740 3300048928 Bacteria 927
336 Ga0496126_0010442 3300048929 Bacteria 9730
337 Ga0501294_003796 3300049517 Bacteria 1424
338 Ga0501300_003721 3300049523 Bacteria 2272
339 Ga0501034_0083892 3300049571 Bacteria 3188
340 Ga0501202_023691 3300049652 Bacteria 1240
341 Ga0501207_014709 3300049654 Bacteria 1197
342 Ga0501211_000518 3300049658 Bacteria 3754
343 Ga0501222_007961 3300049662 Bacteria 1410
344 Ga0501227_002681 3300049665 Bacteria 3906
345 Ga0501249_011641 3300049679 Bacteria 1849
346 Ga0501229_016868 3300049706 Bacteria 951
347 Ga0501262_018219 3300049759 Bacteria 942
348 Ga0501262_056842 3300049759 Bacteria 617
349 Ga0501264_005258 3300049761 Bacteria 1178
350 Ga0501267_000493 3300049764 Bacteria 3071
351 Ga0501269_009097 3300049766 Bacteria 1204
352 Ga0501272_020286 3300049769 Bacteria 795
353 nmdc:mga03683_145713_c1 3300050489 Bacteria 1066
354 nmdc:mga06z11_61077_c1 3300050494 Bacteria 1964
355 nmdc:mga07m45_20550_c1 3300050496 Bacteria 3587
356 nmdc:mga07m45_4094_c1 3300050496 Bacteria 7113
357 nmdc:mga09592_298787_c1 3300050508 Bacteria 1396
358 nmdc:mga08y16_260847_c1 3300050511 Bacteria 1790
359 Ga0495601_0383533 3300053077 Bacteria 912
360 Ga0495619_0144563 3300053085 Bacteria 1639
361 Ga0495619_0153975 3300053085 Bacteria 1586
362 2643742853 2643221544 Bacteria 5886209
363 2643867994 2643221570 Bacteria 5103772
364 2643933308 2643221585 Bacteria 5812563
365 2643991858 2643221596 Bacteria 5006805
366 2644059550 2643221609 Bacteria 6756331
367 2644074697 2643221611 Bacteria 6820941
368 2644217512 2643221639 Bacteria 6649903
369 2644258758 2643221646 Bacteria 6433402
370 2644293599 2643221652 Bacteria 5140275
371 2644314557 2643221656 Bacteria 5809961
372 2644338187 2643221660 Bacteria 4208257
373 2722882055 2721755523 Bacteria 6430384
374 2739055516 2738541337 Bacteria 6183410
375 2739241081 2738543012 Bacteria 7115078
376 2816471841 2816332133 Bacteria 7249298
377 2839142567 2839138175 Bacteria 6549354
378 2842721546 2842718218 Bacteria 4560148
379 2857545035 2857542790 Bacteria 5326616
380 2881102876 2881101125 Bacteria 4590519
381 2919707313 2919704043 Bacteria 5560311
382 2928117066 2928115317 Bacteria 6477646
383 2932425348 2932422444 Bacteria 4678430
384 2974322355 2974320154 Bacteria 4571377
385 2990713642 2990710928 Bacteria 5002431
386 rootL2_10063546
387 rootH1_10016057
388 Ga0055540_1033148
389 Ga0055531_10000168
390 Ga0065707_10006264
391 Ga0070676_10005742
392 Ga0070690_100009859
393 Ga0070670_100025538
394 Ga0068869_100020066
395 Ga0070666_10052753
396 Ga0068868_100038069
397 Ga0070687_100092028
398 Ga0070661_100118690
399 Ga0070668_100004465
400 Ga0070669_100001532
401 Ga0070675_100119512
402 Ga0070675_100299899
403 Ga0070671_100187072
404 Ga0070671_100564873
405 Ga0070674_100011962
406 Ga0070673_100042474
407 Ga0070673_100095924
408 Ga0070688_100112381
409 Ga0070667_100021469
410 Ga0070701_10176736
411 Ga0070678_100823502
412 Ga0070662_100002655
413 Ga0070662_100039770
414 Ga0068867_100000018
415 Ga0068867_100031536
416 Ga0070707_100045504
417 Ga0070679_100029946
418 Ga0068853_100091695
419 Ga0070672_100002627
420 Ga0070672_100012779
421 Ga0070672_100020069
422 Ga0070672_100023730
423 Ga0070686_100338423
424 Ga0070693_100275001
425 Ga0068855_100177446
426 Ga0070664_100360520
427 Ga0070664_100625440
428 Ga0068857_101046330
429 Ga0068854_100536949
430 Ga0068856_100062849
431 Ga0068859_100012344
432 Ga0068859_100825830
433 Ga0068864_100031163
434 Ga0068864_100048795
435 Ga0068864_100183278
436 Ga0068866_10002956
437 Ga0068861_100007169
438 Ga0068861_100444296
439 Ga0068851_10098832
440 Ga0068851_10121897
441 Ga0068870_10229525
442 Ga0068863_100002824
443 Ga0068863_100125505
444 Ga0068858_100006859
445 Ga0068858_100012166
446 Ga0068860_100014457
447 Ga0068860_100017973
448 Ga0068862_100020991
449 Ga0075362_10165575
450 Ga0075367_10098256
451 Ga0075366_10153986
452 Ga0097621_100047437
453 Ga0075370_10006142
454 Ga0075370_10008533
455 Ga0075370_10012702
456 Ga0068871_100049891
457 Ga0068871_100636306
458 Ga0097620_100012344
459 Ga0097620_100825776
460 Ga0079104_1000055
461 Ga0105250_10001549
462 Ga0105240_10012990
463 Ga0111539_10026670
464 Ga0111539_10067008
465 Ga0105247_10361056
466 Ga0114129_10464548
467 Ga0105243_10000396
468 Ga0105243_10004995
469 Ga0105243_10024011
470 Ga0105243_10103171
471 Ga0105243_10545394
472 Ga0105242_10000304
473 Ga0105242_10007281
474 Ga0105248_10004571
475 Ga0105248_10186676
476 Ga0105238_10671580
477 Ga0105238_10740046
478 Ga0105249_10004139
479 Ga0157369_10986159
480 Ga0157374_10767566
481 Ga0157378_10951824
482 Ga0163162_10039880
483 Ga0157372_11094134
484 Ga0157375_10049036
485 Ga0157375_10099657
486 Ga0163163_10671578
487 Ga0157380_10012619
488 Ga0157380_10027460
489 Ga0157377_10000051
490 Ga0157379_10006477
491 Ga0157379_10019020
492 Ga0157376_10040201
493 Ga0163161_10385185
494 Ga0163161_10532461
495 Ga0209050_1007301
496 Ga0209051_1003849
497 Ga0209051_1034313
498 Ga0209257_1000021
499 Ga0207656_10037609
500 Ga0207656_10048620
501 Ga0207656_10170199
502 Ga0207696_1008438
503 Ga0207682_10047628
504 Ga0207682_10094114
505 Ga0207642_10004076
506 Ga0207645_10018374
507 Ga0207645_10218402
508 Ga0207643_10048864
509 Ga0207707_10253871
510 Ga0207695_10159876
511 Ga0207652_10121822
512 Ga0207652_10313350
513 Ga0207646_10076222
514 Ga0207646_10968103
515 Ga0207681_10012011
516 Ga0207650_10018918
517 Ga0207650_10146223
518 Ga0207659_10006867
519 Ga0207659_10015663
520 Ga0207659_10192680
521 Ga0207659_10255108
522 Ga0207644_10056129
523 Ga0207644_10154301
524 Ga0207644_10184728
525 Ga0207644_10478427
526 Ga0207706_10022153
527 Ga0207686_10001824
528 Ga0207686_10007348
529 Ga0207709_10000273
530 Ga0207709_10004013
531 Ga0207709_10046813
532 Ga0207669_10010082
533 Ga0207691_10023080
534 Ga0207691_10023147
535 Ga0207691_10111377
536 Ga0207711_10021272
537 Ga0207711_10103330
538 Ga0207689_10002311
539 Ga0207661_10148819
540 Ga0207679_10141003
541 Ga0207679_10147582
542 Ga0207679_10527166
543 Ga0207651_10027591
544 Ga0207651_10158453
545 Ga0207712_10006123
546 Ga0207640_10031051
547 Ga0207658_10002962
548 Ga0207658_10390304
549 Ga0207677_10004558
550 Ga0207703_10005338
551 Ga0207703_10035524
552 Ga0207639_10373026
553 Ga0207702_10132683
554 Ga0207641_10005111
555 Ga0207648_10049294
556 Ga0207676_10007217
557 Ga0207676_10027600
558 Ga0207676_10162122
559 Ga0207674_10073380
560 Ga0207675_100008733
561 Ga0207675_100550099
562 Ga0207683_10029085
563 Ga0207683_10243131
564 Ga0207698_10019789
565 Ga0209281_1000007
566 Ga0209969_1010973
567 Ga0209970_1000278
568 Ga0209966_1000039
569 Ga0209974_10020847
570 Ga0268265_10019914
571 Ga0268264_10001473
572 Ga0268264_10013755
573 Ga0307515_10001755
574 Ga0307515_10003446
575 Ga0307515_10027450
576 Ga0307515_10142340
577 Ga0265324_10032438
578 Ga0307512_10047678
579 Ga0265327_10019319
580 Ga0307513_10068624
581 Ga0307509_10442048
582 Ga0307408_100000008
583 Ga0307408_100611215
584 Ga0307408_100879363
585 Ga0307408_101202873
586 Ga0307514_10001936
587 Ga0307514_10003659
588 Ga0307516_10000017
589 Ga0307516_10093572
590 Ga0307405_10194342
591 Ga0307406_10247922
592 Ga0307406_10605503
593 Ga0307412_10257307
594 Ga0307412_10336768
595 Ga0307412_10388003
596 Ga0307416_100264809
597 Ga0307414_10004474
598 Ga0307411_10000169
599 Ga0307411_10217296
600 Ga0307510_10427154
601 Ga0373923_0183623
602 Ga0373936_0097698
603 Ga0373939_0000033
604 Ga0373943_0259292
605 Ga0373943_0295274
606 Ga0373955_0052931
607 Ga0373961_0026728
608 Ga0373931_0002101
609 Ga0373935_0137543
610 Ga0373927_0071550
611 Ga0373947_0131892
612 Ga0373937_0049067
613 Ga0373937_0263597
614 Ga0373925_0027369
615 Ga0373925_0027606
616 Ga0395899_0138524
617 Ga0395899_0258580
618 Ga0395900_0000058
619 Ga0395900_0015329
620 Ga0395900_0088773
621 Ga0395900_0089391
622 Ga0395898_0002397
623 Ga0395898_0142752
624 Ga0395898_0246581
625 Ga0395905_0009525
626 Ga0395905_0015672
627 Ga0395905_0016475
628 Ga0395905_0029320
629 Ga0395905_0041430
630 Ga0395905_0047046
631 Ga0395905_0052682
632 Ga0395905_0301302
633 Ga0395901_0024345
634 Ga0395901_0029467
635 Ga0395901_0042575
636 Ga0395901_0069549
637 Ga0395901_0097690
638 Ga0395901_0464349
639 Ga0436365_1250245
640 Ga0439436_0038940
641 Ga0439461_0011603
642 Ga0439465_0153652
643 Ga0451853_2151987
644 Ga0439432_113242
645 Ga0439449_0000464
646 Ga0439462_0040827
647 Ga0450912_006038
648 Ga0450917_002835
649 Ga0450888_001688
650 Ga0450890_003610
651 Ga0450891_000618
652 Ga0450892_001733
653 Ga0450896_022411
654 Ga0450898_005440
655 Ga0450899_002710
656 Ga0450903_010808
657 Ga0450904_025368
658 Ga0450889_001379
659 Ga0439446_0016146
660 Ga0439434_0075897
661 Ga0450916_017980
662 Ga0450893_0000790
663 Ga0451577_0000190
664 Ga0451577_0002431
665 Ga0451577_0013731
666 Ga0451577_0251531
667 Ga0451577_0644162
668 Ga0466969_0000142
669 Ga0466969_0001537
670 Ga0466969_0227536
671 Ga0453683_0003001
672 Ga0466965_0024791
673 Ga0466965_0283668
674 Ga0466966_0000766
675 Ga0466966_0026204
676 Ga0466966_0033135
677 Ga0466961_0019550
678 Ga0466961_0294215
679 Ga0466963_0009355
680 Ga0466964_0030879
681 Ga0453684_0000618
682 Ga0453684_0115434
683 Ga0466971_0030908
684 Ga0466970_0024320
685 Ga0466970_0101357
686 Ga0466957_0035141
687 Ga0466959_0009923
688 Ga0466959_0040522
689 Ga0451576_0031290
690 Ga0451576_0074051
691 Ga0451576_0077041
692 Ga0451576_0436439
693 Ga0466967_0037586
694 Ga0495629_0036189
695 Ga0495618_0324012
696 Ga0495642_0006747
697 Ga0495654_0003871
698 Ga0495621_0205589
699 Ga0495633_0011542
700 Ga0495656_0053171
701 Ga0495635_0141555
702 Ga0495635_0227367
703 Ga0495588_0172814
704 Ga0495657_0160566
705 Ga0495647_0035717
706 Ga0495658_0075209
707 Ga0495600_0292335
708 Ga0495660_0224714
709 Ga0495674_0181655
710 Ga0495680_0076670
711 Ga0495680_0226094
712 Ga0495684_0035208
713 Ga0495684_0266013
714 Ga0496109_0100684
715 Ga0496111_0412343
716 Ga0496112_0012196
717 Ga0496122_0018075
718 Ga0496124_0000024
719 Ga0496125_0001023
720 Ga0496125_0326740
721 Ga0496126_0010442
722 Ga0501294_003796
723 Ga0501300_003721
724 Ga0501034_0083892
725 Ga0501202_023691
726 Ga0501207_014709
727 Ga0501211_000518
728 Ga0501222_007961
729 Ga0501227_002681
730 Ga0501249_011641
731 Ga0501229_016868
732 Ga0501262_018219
733 Ga0501262_056842
734 Ga0501264_005258
735 Ga0501267_000493
736 Ga0501269_009097
737 Ga0501272_020286
738 nmdc:mga03683_145713_c1
739 nmdc:mga06z11_61077_c1
740 nmdc:mga07m45_20550_c1
741 nmdc:mga07m45_4094_c1
742 nmdc:mga09592_298787_c1
743 nmdc:mga08y16_260847_c1
744 Ga0495601_0383533
745 Ga0495619_0144563
746 Ga0495619_0153975
747 2643742853
748 2643867994
749 2643933308
750 2643991858
751 2644059550
752 2644074697
753 2644217512
754 2644258758
755 2644293599
756 2644314557
757 2644338187
758 2722882055
759 2739055516
760 2739241081
761 2816471841
762 2839142567
763 2842721546
764 2857545035
765 2881102876
766 2919707313
767 2928117066
768 2932425348
769 2974322355
770 2990713642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

22

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9519 1 208
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9429 1 208
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9183 2 199
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.917 2 199
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.9104 1 201
ID Description Score Start End Superfamily
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9473 2 208 3.90.870.10
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9381 2 208 3.90.870.10
af_Q6YZF2_76_294_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9093 4 204 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9087 2 208 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9019 15 210 3.90.870.10
ID Description Score Start End GO Terms
AF-F3KXI9-F1-model_v4 Sua5/ycio/yrdc/ywlc family protein 0.9749 1 210 GO:0003725
AF-A0A254TJJ7-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9733 1 162 GO:0003725
AF-A0A556A7Q3-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9728 1 211 GO:0003725
AF-A0A6S7AQW2-F1-model_v4 YrdC-like domain-containing protein 0.9724 1 211 GO:0003725
AF-A0A847MND8-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9724 1 210 GO:0003725

Map