F429957

General Info

Members Datasets Scaffolds Average Seq Length
384 260 768 165

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0205864|Ga0439439_0205864_15_437
Length 140
Sequence LLPISENETLFQLIGTTYGGDGQETFALPDLRGRLPIHQGNGFILAETGGAEEITLTVNQIPAHNHPFLATTNPADQVSAANNVLGSLTQGLLYFAAQGGSSLNASSAGPTGGSQPHTNFQPYLCVNFIISLFGIFPSPT

Samples

Sample ID Description Type Environment
1 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
177 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
181 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
182 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
183 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
191 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
192 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
193 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
194 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
197 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
198 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
201 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
202 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
203 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
204 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
205 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
208 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
209 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
214 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
215 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
216 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
217 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
218 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
219 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
254 2643221641 Nocardioides sp. Root122 Isolate Unclassified
255 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
256 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
257 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
258 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
259 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
260 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.28
Metatranscriptomes 9.64
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 0.78
Rhizoplane 1.04
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439439_0205864 3300041406 Bacteria 573
2 JGI25406J46586_10016056 3300003203 Bacteria 3135
3 Ga0065712_10016338 3300005290 Bacteria 2784
4 Ga0065707_10084299 3300005295 Bacteria 7375
5 Ga0070683_100082585 3300005329 Bacteria 3009
6 Ga0070690_100096855 3300005330 Bacteria 1950
7 Ga0070690_100406106 3300005330 Bacteria 1001
8 Ga0070670_100291956 3300005331 Bacteria 1425
9 Ga0068869_100292865 3300005334 Bacteria 1312
10 Ga0068869_100878861 3300005334 Bacteria 775
11 Ga0070666_10024395 3300005335 Bacteria 3938
12 Ga0070666_10158887 3300005335 Bacteria 1579
13 Ga0068868_100263934 3300005338 Bacteria 1453
14 Ga0070660_100166718 3300005339 Bacteria 1777
15 Ga0070689_100004561 3300005340 Bacteria 9380
16 Ga0070687_100011229 3300005343 Bacteria 3911
17 Ga0070669_100000002 3300005353 Bacteria 506497
18 Ga0070669_100324036 3300005353 Bacteria 1245
19 Ga0070675_100000001 3300005354 Bacteria 448137
20 Ga0070671_100113172 3300005355 Bacteria 2280
21 Ga0070674_100621612 3300005356 Bacteria 915
22 Ga0070659_100201675 3300005366 Bacteria 1638
23 Ga0070659_100370440 3300005366 Bacteria 1205
24 Ga0070667_100057474 3300005367 Bacteria 3288
25 Ga0070705_100402639 3300005440 Bacteria 1014
26 Ga0070700_100001738 3300005441 Bacteria 10951
27 Ga0070694_100006503 3300005444 Bacteria 7098
28 Ga0070694_100380247 3300005444 Bacteria 1101
29 Ga0070708_100996072 3300005445 Bacteria 786
30 Ga0070662_100418346 3300005457 Bacteria 1108
31 Ga0070681_10383241 3300005458 Bacteria 1317
32 Ga0068867_100552372 3300005459 Bacteria 998
33 Ga0070706_100013312 3300005467 Bacteria 7607
34 Ga0070698_100002248 3300005471 Bacteria 21358
35 Ga0070698_100308233 3300005471 Bacteria 1514
36 Ga0070698_100799757 3300005471 Bacteria 887
37 Ga0070679_100122652 3300005530 Bacteria 2582
38 Ga0070684_100007385 3300005535 Bacteria 8544
39 Ga0070697_100147766 3300005536 Bacteria 1980
40 Ga0070686_100801391 3300005544 Unclassified 759
41 Ga0070686_100872015 3300005544 Bacteria 730
42 Ga0070695_100335470 3300005545 Bacteria 1128
43 Ga0070695_100399256 3300005545 Bacteria 1042
44 Ga0070695_100778129 3300005545 Bacteria 765
45 Ga0070696_100035712 3300005546 Unclassified 3423
46 Ga0070696_100263467 3300005546 Bacteria 1308
47 Ga0070693_100304796 3300005547 Bacteria 1075
48 Ga0070693_100346418 3300005547 Bacteria 1016
49 Ga0070704_100056839 3300005549 Bacteria 2780
50 Ga0070704_100155123 3300005549 Bacteria 1805
51 Ga0070664_100039012 3300005564 Bacteria 4000
52 Ga0070664_100140599 3300005564 Bacteria 2126
53 Ga0070664_100869155 3300005564 Bacteria 845
54 Ga0070664_101087340 3300005564 Bacteria 753
55 Ga0068857_100021714 3300005577 Bacteria 5648
56 Ga0068857_100092164 3300005577 Bacteria 2713
57 Ga0068856_100478873 3300005614 Bacteria 1266
58 Ga0070702_100349856 3300005615 Bacteria 1040
59 Ga0068852_100093549 3300005616 Bacteria 2695
60 Ga0068852_101509804 3300005616 Bacteria 694
61 Ga0068859_100045744 3300005617 Bacteria 4397
62 Ga0068859_100103525 3300005617 Bacteria 2905
63 Ga0068859_100409144 3300005617 Bacteria 1452
64 Ga0068859_100650909 3300005617 Bacteria 1146
65 Ga0068859_102540085 3300005617 Bacteria 564
66 Ga0068864_100060116 3300005618 Bacteria 3290
67 Ga0068864_101218541 3300005618 Bacteria 751
68 Ga0068851_10024362 3300005834 Bacteria 2962
69 Ga0068863_100871613 3300005841 Bacteria 900
70 Ga0068863_100896516 3300005841 Bacteria 887
71 Ga0068858_100059763 3300005842 Bacteria 3523
72 Ga0068858_100106582 3300005842 Bacteria 2616
73 Ga0068858_100125763 3300005842 Bacteria 2401
74 Ga0068860_100069039 3300005843 Bacteria 3358
75 Ga0068860_101271520 3300005843 Bacteria 756
76 Ga0068862_100780087 3300005844 Bacteria 932
77 Ga0081539_10000156 3300005985 Bacteria 158871
78 Ga0081539_10132534 3300005985 Bacteria 1222
79 Ga0070717_10737069 3300006028 Unclassified 896
80 Ga0075365_10034113 3300006038 Bacteria 3285
81 Ga0075365_10233920 3300006038 Bacteria 1290
82 Ga0075364_10015888 3300006051 Bacteria 4673
83 Ga0075364_10088908 3300006051 Bacteria 2048
84 Ga0075364_10108859 3300006051 Bacteria 1848
85 Ga0075364_10218343 3300006051 Bacteria 1293
86 Ga0070716_100190192 3300006173 Bacteria 1355
87 Ga0070716_101003143 3300006173 Viruses 660
88 Ga0075362_10307006 3300006177 Bacteria 788
89 Ga0075366_10080979 3300006195 Bacteria 1939
90 Ga0097621_100297333 3300006237 Bacteria 1425
91 Ga0097621_100331011 3300006237 Bacteria 1351
92 Ga0068871_100487081 3300006358 Bacteria 1110
93 Ga0075428_100055948 3300006844 Bacteria 4322
94 Ga0075428_100174044 3300006844 Bacteria 2332
95 Ga0075430_100089586 3300006846 Bacteria 2574
96 Ga0075430_100095047 3300006846 Bacteria 2491
97 Ga0075431_100003588 3300006847 Bacteria 15039
98 Ga0075431_100333914 3300006847 Bacteria 1526
99 Ga0075431_101052980 3300006847 Bacteria 779
100 Ga0075433_10006999 3300006852 Bacteria 8941
101 Ga0075433_10030467 3300006852 Bacteria 4604
102 Ga0075433_10249529 3300006852 Bacteria 1575
103 Ga0075434_100287520 3300006871 Bacteria 1664
104 Ga0075429_100024991 3300006880 Bacteria 5186
105 Ga0075429_100415375 3300006880 Bacteria 1178
106 Ga0068865_100130514 3300006881 Bacteria 1882
107 Ga0075436_100000009 3300006914 Bacteria 256132
108 Ga0097620_100045743 3300006931 Bacteria 4397
109 Ga0097620_100103523 3300006931 Bacteria 2905
110 Ga0097620_100409133 3300006931 Bacteria 1452
111 Ga0097620_100650875 3300006931 Bacteria 1146
112 Ga0097620_102540129 3300006931 Bacteria 564
113 Ga0099794_10307040 3300007265 Bacteria 822
114 Ga0105244_10023284 3300009036 Bacteria 3396
115 Ga0105240_10014904 3300009093 Bacteria 10589
116 Ga0111539_10033293 3300009094 Bacteria 6257
117 Ga0111539_10371927 3300009094 Bacteria 1664
118 Ga0111539_10401881 3300009094 Bacteria 1596
119 Ga0105245_10115983 3300009098 Bacteria 2497
120 Ga0105245_10930780 3300009098 Unclassified 911
121 Ga0105247_10538192 3300009101 Unclassified 857
122 Ga0114129_10037559 3300009147 Bacteria 6837
123 Ga0114129_10147944 3300009147 Bacteria 3216
124 Ga0114129_10200216 3300009147 Bacteria 2705
125 Ga0114129_10827450 3300009147 Bacteria 1179
126 Ga0105243_10434482 3300009148 Bacteria 1228
127 Ga0105243_10490607 3300009148 Bacteria 1161
128 Ga0105241_10012655 3300009174 Bacteria 6191
129 Ga0105242_10018749 3300009176 Bacteria 5413
130 Ga0105248_10008640 3300009177 Bacteria 11188
131 Ga0105248_10030940 3300009177 Bacteria 5979
132 Ga0105248_11096050 3300009177 Bacteria 900
133 Ga0105237_10185966 3300009545 Bacteria 2077
134 Ga0105238_10005435 3300009551 Bacteria 12587
135 Ga0105238_10032774 3300009551 Bacteria 5287
136 Ga0105238_10077418 3300009551 Bacteria 3317
137 Ga0105238_10102491 3300009551 Bacteria 2844
138 Ga0105239_11496155 3300010375 Bacteria 780
139 Ga0105246_10051789 3300011119 Bacteria 2820
140 Ga0105246_10367023 3300011119 Bacteria 1185
141 Ga0157369_10023529 3300013105 Bacteria 6861
142 Ga0157374_10672346 3300013296 Bacteria 1048
143 Ga0157374_11333833 3300013296 Unclassified 740
144 Ga0157372_10072927 3300013307 Bacteria 3869
145 Ga0157375_10000200 3300013308 Bacteria 55945
146 Ga0157375_11459473 3300013308 Bacteria 807
147 Ga0157377_10048343 3300014745 Bacteria 2386
148 Ga0157377_10349939 3300014745 Bacteria 991
149 Ga0157379_10256369 3300014968 Bacteria 1589
150 Ga0182007_10122487 3300015262 Bacteria 871
151 Ga0207710_10266942 3300025900 Unclassified 859
152 Ga0207680_10155882 3300025903 Viruses 1527
153 Ga0207680_10156441 3300025903 Bacteria 1524
154 Ga0207705_10127716 3300025909 Bacteria 1890
155 Ga0207654_10011244 3300025911 Bacteria 4562
156 Ga0207707_10147173 3300025912 Bacteria 2059
157 Ga0207695_10045760 3300025913 Bacteria 4643
158 Ga0207671_10040072 3300025914 Bacteria 3468
159 Ga0207660_10647432 3300025917 Bacteria 861
160 Ga0207662_10005898 3300025918 Bacteria 6572
161 Ga0207662_10467858 3300025918 Bacteria 864
162 Ga0207657_10010088 3300025919 Bacteria 9444
163 Ga0207652_10260222 3300025921 Bacteria 1565
164 Ga0207681_10000009 3300025923 Bacteria 410736
165 Ga0207694_10005564 3300025924 Bacteria 9658
166 Ga0207694_10285769 3300025924 Bacteria 1356
167 Ga0207694_10425022 3300025924 Bacteria 1107
168 Ga0207659_10000004 3300025926 Bacteria 476977
169 Ga0207659_10350441 3300025926 Bacteria 1225
170 Ga0207687_10076778 3300025927 Bacteria 2400
171 Ga0207644_10085305 3300025931 Bacteria 2342
172 Ga0207690_10699606 3300025932 Bacteria 833
173 Ga0207706_10081254 3300025933 Bacteria 2848
174 Ga0207709_10735807 3300025935 Bacteria 792
175 Ga0207709_11328975 3300025935 Bacteria 594
176 Ga0207670_10336524 3300025936 Bacteria 1192
177 Ga0207669_10620028 3300025937 Bacteria 881
178 Ga0207704_10172092 3300025938 Bacteria 1555
179 Ga0207665_10797290 3300025939 Unclassified 746
180 Ga0207711_10007485 3300025941 Bacteria 9132
181 Ga0207711_10055203 3300025941 Bacteria 3411
182 Ga0207689_10212268 3300025942 Bacteria 1599
183 Ga0207661_10120760 3300025944 Bacteria 2230
184 Ga0207679_10042462 3300025945 Bacteria 3268
185 Ga0207679_10118117 3300025945 Bacteria 2106
186 Ga0207679_10783510 3300025945 Bacteria 869
187 Ga0207667_10037455 3300025949 Bacteria 5183
188 Ga0207658_10058611 3300025986 Bacteria 2866
189 Ga0207677_10244473 3300026023 Bacteria 1454
190 Ga0207703_10084586 3300026035 Bacteria 2653
191 Ga0207703_10215123 3300026035 Bacteria 1715
192 Ga0207703_10450643 3300026035 Bacteria 1202
193 Ga0207639_10540131 3300026041 Bacteria 1069
194 Ga0207708_10005244 3300026075 Bacteria 9545
195 Ga0207702_10591176 3300026078 Bacteria 1088
196 Ga0207641_10268618 3300026088 Bacteria 1600
197 Ga0207641_10476991 3300026088 Bacteria 1209
198 Ga0207648_10203252 3300026089 Bacteria 1757
199 Ga0207676_10533525 3300026095 Bacteria 1119
200 Ga0207676_12075886 3300026095 Unclassified 567
201 Ga0207674_10010522 3300026116 Bacteria 10471
202 Ga0207674_10039647 3300026116 Bacteria 4882
203 Ga0207683_10260558 3300026121 Bacteria 1583
204 Ga0207698_11204863 3300026142 Bacteria 771
205 Ga0207428_10046485 3300027907 Bacteria 3491
206 Ga0268266_10889600 3300028379 Bacteria 861
207 Ga0268265_10565923 3300028380 Bacteria 1081
208 Ga0268265_11130246 3300028380 Bacteria 779
209 Ga0268264_10044462 3300028381 Bacteria 3684
210 Ga0268264_11630443 3300028381 Unclassified 656
211 Ga0316176_1020679 3300030732 Bacteria 1079
212 Ga0265328_10177526 3300031239 Bacteria 805
213 Ga0265327_10026920 3300031251 Bacteria 3321
214 Ga0307513_10014167 3300031456 Bacteria 9755
215 Ga0307513_10304501 3300031456 Bacteria 1359
216 Ga0307408_100002168 3300031548 Bacteria 14045
217 Ga0307408_100280635 3300031548 Bacteria 1387
218 Ga0307408_100525495 3300031548 Bacteria 1040
219 Ga0307405_10263480 3300031731 Bacteria 1289
220 Ga0307413_10222196 3300031824 Bacteria 1381
221 Ga0307406_10000010 3300031901 Bacteria 114357
222 Ga0307406_10565202 3300031901 Bacteria 933
223 Ga0307412_10074997 3300031911 Bacteria 2319
224 Ga0307412_11331047 3300031911 Bacteria 648
225 Ga0307409_100000918 3300031995 Bacteria 13668
226 Ga0307409_101798510 3300031995 Bacteria 642
227 Ga0307409_101873361 3300031995 Bacteria 629
228 Ga0307416_100011501 3300032002 Bacteria 5908
229 Ga0307416_100291356 3300032002 Bacteria 1616
230 Ga0307416_101130974 3300032002 Bacteria 888
231 Ga0307416_102130431 3300032002 Bacteria 662
232 Ga0307414_10290112 3300032004 Bacteria 1379
233 Ga0307415_100439822 3300032126 Bacteria 1124
234 Ga0307415_100887191 3300032126 Bacteria 821
235 Ga0373951_0015391 3300035091 Bacteria 1722
236 Ga0373951_0017452 3300035091 Viruses 1624
237 Ga0373941_0453948 3300035115 Bacteria 538
238 Ga0373942_0009185 3300035207 Bacteria 2310
239 Ga0373931_0155633 3300035691 Bacteria 1336
240 Ga0395899_0093547 3300037312 Bacteria 2176
241 Ga0395900_0007630 3300037418 Bacteria 11172
242 Ga0395898_0037373 3300037466 Bacteria 4817
243 Ga0395905_0084419 3300037471 Bacteria 2975
244 Ga0395901_0218119 3300038443 Bacteria 1994
245 Ga0395901_0963424 3300038443 Bacteria 831
246 Ga0439461_0051002 3300041410 Bacteria 918
247 Ga0439465_0231124 3300041413 Bacteria 680
248 Ga0451791_0794486 3300041451 Bacteria 1074
249 Ga0439442_002473 3300042002 Bacteria 3627
250 Ga0439445_0034607 3300042004 Bacteria 1324
251 Ga0439434_0021102 3300042435 Bacteria 1957
252 Ga0439464_0027073 3300042439 Bacteria 1593
253 Ga0451577_0938631 3300042876 Unclassified 778
254 Ga0453683_0065051 3300044673 Bacteria 2280
255 Ga0453684_0081068 3300044712 Bacteria 4049
256 Ga0453684_1965436 3300044712 Bacteria 590
257 Ga0451576_0941574 3300045051 Bacteria 906
258 Ga0466967_2344924 3300045976 Bacteria 529
259 Ga0495654_0048029 3300046530 Bacteria 2096
260 Ga0495621_0105822 3300046539 Bacteria 1075
261 Ga0496109_0775446 3300048912 Bacteria 897
262 Ga0496112_0334762 3300048915 Bacteria 1457
263 Ga0496113_1052939 3300048916 Unclassified 639
264 Ga0501306_009145 3300049127 Bacteria 1223
265 Ga0501310_004317 3300049130 Bacteria 1423
266 Ga0501304_000795 3300049160 Bacteria 1810
267 Ga0501305_006983 3300049161 Bacteria 1418
268 Ga0501291_000365 3300049514 Bacteria 5551
269 Ga0501293_017013 3300049516 Unclassified 682
270 Ga0501298_001374 3300049521 Bacteria 3573
271 Ga0501299_008350 3300049522 Bacteria 1682
272 Ga0501300_003609 3300049523 Bacteria 2304
273 Ga0501301_014920 3300049524 Unclassified 688
274 Ga0501303_003624 3300049526 Bacteria 1247
275 Ga0501321_001740 3300049537 Bacteria 1790
276 Ga0501323_005052 3300049539 Bacteria 1425
277 Ga0501040_0526706 3300049576 Bacteria 852
278 Ga0501072_0597690 3300049588 Bacteria 870
279 Ga0501074_0106130 3300049590 Bacteria 2011
280 Ga0501076_1104386 3300049592 Bacteria 653
281 Ga0501077_0293247 3300049593 Bacteria 1036
282 Ga0501201_001940 3300049651 Viruses 1911
283 Ga0501202_239626 3300049652 Bacteria 507
284 Ga0501207_035455 3300049654 Bacteria 853
285 Ga0501208_054169 3300049655 Unclassified 772
286 Ga0501216_001073 3300049660 Unclassified 3559
287 Ga0501223_022972 3300049663 Bacteria 1218
288 Ga0501224_012824 3300049664 Bacteria 1236
289 Ga0501228_020622 3300049666 Bacteria 743
290 Ga0501233_004273 3300049668 Bacteria 2610
291 Ga0501235_002450 3300049669 Bacteria 4001
292 Ga0501242_010350 3300049674 Bacteria 1112
293 Ga0501246_002459 3300049676 Bacteria 1460
294 Ga0501249_003401 3300049679 Bacteria 3194
295 Ga0501250_024751 3300049680 Unclassified 801
296 Ga0501251_007156 3300049681 Bacteria 1234
297 Ga0501253_088797 3300049683 Bacteria 708
298 Ga0501257_017957 3300049686 Bacteria 1647
299 Ga0501260_000609 3300049689 Unclassified 2768
300 Ga0501261_005441 3300049690 Bacteria 1601
301 Ga0501221_017703 3300049704 Bacteria 1363
302 Ga0501225_0005013 3300049705 Bacteria 3911
303 Ga0501080_0042902 3300049742 Bacteria 4211
304 Ga0501080_0053271 3300049742 Bacteria 3766
305 Ga0501081_0459517 3300049743 Bacteria 946
306 Ga0501232_021169 3300049757 Bacteria 838
307 Ga0501266_005682 3300049763 Bacteria 1550
308 Ga0501270_069175 3300049767 Unclassified 679
309 Ga0501271_011558 3300049768 Bacteria 945
310 Ga0501280_005003 3300049776 Bacteria 1916
311 Ga0501281_01641 3300049777 Bacteria 1726
312 Ga0501283_001376 3300049779 Bacteria 3170
313 nmdc:mga03n38_365487_c1 3300050490 Bacteria 788
314 nmdc:mga03n38_400819_c1 3300050490 Bacteria 755
315 nmdc:mga00v17_35061_c1 3300050491 Bacteria 2984
316 nmdc:mga00v17_58827_c1 3300050491 Bacteria 2356
317 nmdc:mga00v17_68129_c1 3300050491 Bacteria 2200
318 nmdc:mga00v17_8931_c1 3300050491 Bacteria 5407
319 nmdc:mga0yw44_136192_c1 3300050492 Bacteria 1593
320 nmdc:mga0yw44_232738_c1 3300050492 Bacteria 1223
321 nmdc:mga0yw44_3298_c1 3300050492 Bacteria 7135
322 nmdc:mga0k408_113231_c1 3300050493 Bacteria 1604
323 nmdc:mga06z11_319750_c1 3300050494 Bacteria 925
324 nmdc:mga07m45_6620_c1 3300050496 Bacteria 5872
325 nmdc:mga05p37_234374_c1 3300050507 Bacteria 2210
326 nmdc:mga05p37_235304_c1 3300050507 Bacteria 2205
327 nmdc:mga05p37_80026_c1 3300050507 Bacteria 4024
328 nmdc:mga09592_265297_c1 3300050508 Bacteria 1489
329 nmdc:mga09592_70405_c1 3300050508 Bacteria 2968
330 nmdc:mga0qj67_23850_c1 3300050509 Bacteria 4711
331 nmdc:mga0qj67_534967_c1 3300050509 Bacteria 941
332 nmdc:mga06r32_134314_c1 3300050510 Bacteria 2449
333 nmdc:mga06r32_19323_c1 3300050510 Bacteria 6252
334 nmdc:mga08y16_18309_c1 3300050511 Bacteria 7380
335 nmdc:mga08y16_699845_c1 3300050511 Bacteria 1013
336 nmdc:mga0n895_112608_c1 3300050512 Bacteria 2738
337 nmdc:mga0n895_249023_c1 3300050512 Bacteria 1803
338 nmdc:mga0n895_90216_c1 3300050512 Bacteria 3066
339 nmdc:mga0rr50_14481_c1 3300050513 Bacteria 5177
340 nmdc:mga08x19_31_c1 3300050514 Bacteria 209591
341 nmdc:mga0a205_101602_c1 3300050515 Bacteria 2774
342 nmdc:mga0a205_43257_c1 3300050515 Bacteria 4344
343 Ga0587084_011051 3300059477 Bacteria 1195
344 Ga0587084_022495 3300059477 Bacteria 954
345 Ga0587084_041510 3300059477 Bacteria 783
346 Ga0587077_015304 3300059493 Bacteria 1275
347 Ga0587077_099701 3300059493 Bacteria 696
348 Ga0587085_003313 3300059506 Bacteria 1738
349 Ga0587085_016394 3300059506 Viruses 1072
350 Ga0587092_051730 3300059512 Bacteria 746
351 Ga0587094_009098 3300059513 Bacteria 1260
352 Ga0587125_007685 3300059607 Bacteria 1052
353 Ga0587101_006906 3300059623 Bacteria 1321
354 Ga0587101_012688 3300059623 Bacteria 1099
355 Ga0587101_033844 3300059623 Bacteria 811
356 Ga0587109_012662 3300059624 Bacteria 1387
357 Ga0587109_013494 3300059624 Bacteria 1357
358 Ga0587117_005965 3300059627 Bacteria 1340
359 Ga0587117_006879 3300059627 Viruses 1285
360 Ga0587062_012925 3300059639 Bacteria 1078
361 Ga0587062_013142 3300059639 Bacteria 1072
362 Ga0587062_037682 3300059639 Bacteria 771
363 Ga0587068_026265 3300059641 Bacteria 984
364 Ga0587068_047157 3300059641 Bacteria 796
365 Ga0587068_048123 3300059641 Bacteria 791
366 Ga0587072_065497 3300059643 Bacteria 757
367 Ga0587076_019555 3300059645 Bacteria 1102
368 Ga0587078_019015 3300059646 Bacteria 855
369 Ga0587061_06298 3300060244 Bacteria 577
370 Ga0587111_0014750 3300060346 Bacteria 1418
371 Ga0587111_0026520 3300060346 Bacteria 1155
372 Ga0587111_0076701 3300060346 Bacteria 791
373 Ga0587111_0151079 3300060346 Bacteria 624
374 Ga0501082_0290779 3300060353 Bacteria 1423
375 Ga0530510_0095465 3300061734 Bacteria 2172
376 Ga0530510_0121587 3300061734 Bacteria 1917
377 2510318436 2510065059 Bacteria 6847884
378 2644230969 2643221641 Bacteria 4490190
379 2740000401 2739367857 Bacteria 5433684
380 2740005217 2739367858 Bacteria 5432813
381 2792747420 2791355123 Bacteria 8049106
382 2855389574 2855386786 Bacteria 4752232
383 2904692532 2904690495 Bacteria 9412302
384 2908756800 2908756301 Bacteria 8864324
385 Ga0439439_0205864
386 JGI25406J46586_10016056
387 Ga0065712_10016338
388 Ga0065707_10084299
389 Ga0070683_100082585
390 Ga0070690_100096855
391 Ga0070690_100406106
392 Ga0070670_100291956
393 Ga0068869_100292865
394 Ga0068869_100878861
395 Ga0070666_10024395
396 Ga0070666_10158887
397 Ga0068868_100263934
398 Ga0070660_100166718
399 Ga0070689_100004561
400 Ga0070687_100011229
401 Ga0070669_100000002
402 Ga0070669_100324036
403 Ga0070675_100000001
404 Ga0070671_100113172
405 Ga0070674_100621612
406 Ga0070659_100201675
407 Ga0070659_100370440
408 Ga0070667_100057474
409 Ga0070705_100402639
410 Ga0070700_100001738
411 Ga0070694_100006503
412 Ga0070694_100380247
413 Ga0070708_100996072
414 Ga0070662_100418346
415 Ga0070681_10383241
416 Ga0068867_100552372
417 Ga0070706_100013312
418 Ga0070698_100002248
419 Ga0070698_100308233
420 Ga0070698_100799757
421 Ga0070679_100122652
422 Ga0070684_100007385
423 Ga0070697_100147766
424 Ga0070686_100801391
425 Ga0070686_100872015
426 Ga0070695_100335470
427 Ga0070695_100399256
428 Ga0070695_100778129
429 Ga0070696_100035712
430 Ga0070696_100263467
431 Ga0070693_100304796
432 Ga0070693_100346418
433 Ga0070704_100056839
434 Ga0070704_100155123
435 Ga0070664_100039012
436 Ga0070664_100140599
437 Ga0070664_100869155
438 Ga0070664_101087340
439 Ga0068857_100021714
440 Ga0068857_100092164
441 Ga0068856_100478873
442 Ga0070702_100349856
443 Ga0068852_100093549
444 Ga0068852_101509804
445 Ga0068859_100045744
446 Ga0068859_100103525
447 Ga0068859_100409144
448 Ga0068859_100650909
449 Ga0068859_102540085
450 Ga0068864_100060116
451 Ga0068864_101218541
452 Ga0068851_10024362
453 Ga0068863_100871613
454 Ga0068863_100896516
455 Ga0068858_100059763
456 Ga0068858_100106582
457 Ga0068858_100125763
458 Ga0068860_100069039
459 Ga0068860_101271520
460 Ga0068862_100780087
461 Ga0081539_10000156
462 Ga0081539_10132534
463 Ga0070717_10737069
464 Ga0075365_10034113
465 Ga0075365_10233920
466 Ga0075364_10015888
467 Ga0075364_10088908
468 Ga0075364_10108859
469 Ga0075364_10218343
470 Ga0070716_100190192
471 Ga0070716_101003143
472 Ga0075362_10307006
473 Ga0075366_10080979
474 Ga0097621_100297333
475 Ga0097621_100331011
476 Ga0068871_100487081
477 Ga0075428_100055948
478 Ga0075428_100174044
479 Ga0075430_100089586
480 Ga0075430_100095047
481 Ga0075431_100003588
482 Ga0075431_100333914
483 Ga0075431_101052980
484 Ga0075433_10006999
485 Ga0075433_10030467
486 Ga0075433_10249529
487 Ga0075434_100287520
488 Ga0075429_100024991
489 Ga0075429_100415375
490 Ga0068865_100130514
491 Ga0075436_100000009
492 Ga0097620_100045743
493 Ga0097620_100103523
494 Ga0097620_100409133
495 Ga0097620_100650875
496 Ga0097620_102540129
497 Ga0099794_10307040
498 Ga0105244_10023284
499 Ga0105240_10014904
500 Ga0111539_10033293
501 Ga0111539_10371927
502 Ga0111539_10401881
503 Ga0105245_10115983
504 Ga0105245_10930780
505 Ga0105247_10538192
506 Ga0114129_10037559
507 Ga0114129_10147944
508 Ga0114129_10200216
509 Ga0114129_10827450
510 Ga0105243_10434482
511 Ga0105243_10490607
512 Ga0105241_10012655
513 Ga0105242_10018749
514 Ga0105248_10008640
515 Ga0105248_10030940
516 Ga0105248_11096050
517 Ga0105237_10185966
518 Ga0105238_10005435
519 Ga0105238_10032774
520 Ga0105238_10077418
521 Ga0105238_10102491
522 Ga0105239_11496155
523 Ga0105246_10051789
524 Ga0105246_10367023
525 Ga0157369_10023529
526 Ga0157374_10672346
527 Ga0157374_11333833
528 Ga0157372_10072927
529 Ga0157375_10000200
530 Ga0157375_11459473
531 Ga0157377_10048343
532 Ga0157377_10349939
533 Ga0157379_10256369
534 Ga0182007_10122487
535 Ga0207710_10266942
536 Ga0207680_10155882
537 Ga0207680_10156441
538 Ga0207705_10127716
539 Ga0207654_10011244
540 Ga0207707_10147173
541 Ga0207695_10045760
542 Ga0207671_10040072
543 Ga0207660_10647432
544 Ga0207662_10005898
545 Ga0207662_10467858
546 Ga0207657_10010088
547 Ga0207652_10260222
548 Ga0207681_10000009
549 Ga0207694_10005564
550 Ga0207694_10285769
551 Ga0207694_10425022
552 Ga0207659_10000004
553 Ga0207659_10350441
554 Ga0207687_10076778
555 Ga0207644_10085305
556 Ga0207690_10699606
557 Ga0207706_10081254
558 Ga0207709_10735807
559 Ga0207709_11328975
560 Ga0207670_10336524
561 Ga0207669_10620028
562 Ga0207704_10172092
563 Ga0207665_10797290
564 Ga0207711_10007485
565 Ga0207711_10055203
566 Ga0207689_10212268
567 Ga0207661_10120760
568 Ga0207679_10042462
569 Ga0207679_10118117
570 Ga0207679_10783510
571 Ga0207667_10037455
572 Ga0207658_10058611
573 Ga0207677_10244473
574 Ga0207703_10084586
575 Ga0207703_10215123
576 Ga0207703_10450643
577 Ga0207639_10540131
578 Ga0207708_10005244
579 Ga0207702_10591176
580 Ga0207641_10268618
581 Ga0207641_10476991
582 Ga0207648_10203252
583 Ga0207676_10533525
584 Ga0207676_12075886
585 Ga0207674_10010522
586 Ga0207674_10039647
587 Ga0207683_10260558
588 Ga0207698_11204863
589 Ga0207428_10046485
590 Ga0268266_10889600
591 Ga0268265_10565923
592 Ga0268265_11130246
593 Ga0268264_10044462
594 Ga0268264_11630443
595 Ga0316176_1020679
596 Ga0265328_10177526
597 Ga0265327_10026920
598 Ga0307513_10014167
599 Ga0307513_10304501
600 Ga0307408_100002168
601 Ga0307408_100280635
602 Ga0307408_100525495
603 Ga0307405_10263480
604 Ga0307413_10222196
605 Ga0307406_10000010
606 Ga0307406_10565202
607 Ga0307412_10074997
608 Ga0307412_11331047
609 Ga0307409_100000918
610 Ga0307409_101798510
611 Ga0307409_101873361
612 Ga0307416_100011501
613 Ga0307416_100291356
614 Ga0307416_101130974
615 Ga0307416_102130431
616 Ga0307414_10290112
617 Ga0307415_100439822
618 Ga0307415_100887191
619 Ga0373951_0015391
620 Ga0373951_0017452
621 Ga0373941_0453948
622 Ga0373942_0009185
623 Ga0373931_0155633
624 Ga0395899_0093547
625 Ga0395900_0007630
626 Ga0395898_0037373
627 Ga0395905_0084419
628 Ga0395901_0218119
629 Ga0395901_0963424
630 Ga0439461_0051002
631 Ga0439465_0231124
632 Ga0451791_0794486
633 Ga0439442_002473
634 Ga0439445_0034607
635 Ga0439434_0021102
636 Ga0439464_0027073
637 Ga0451577_0938631
638 Ga0453683_0065051
639 Ga0453684_0081068
640 Ga0453684_1965436
641 Ga0451576_0941574
642 Ga0466967_2344924
643 Ga0495654_0048029
644 Ga0495621_0105822
645 Ga0496109_0775446
646 Ga0496112_0334762
647 Ga0496113_1052939
648 Ga0501306_009145
649 Ga0501310_004317
650 Ga0501304_000795
651 Ga0501305_006983
652 Ga0501291_000365
653 Ga0501293_017013
654 Ga0501298_001374
655 Ga0501299_008350
656 Ga0501300_003609
657 Ga0501301_014920
658 Ga0501303_003624
659 Ga0501321_001740
660 Ga0501323_005052
661 Ga0501040_0526706
662 Ga0501072_0597690
663 Ga0501074_0106130
664 Ga0501076_1104386
665 Ga0501077_0293247
666 Ga0501201_001940
667 Ga0501202_239626
668 Ga0501207_035455
669 Ga0501208_054169
670 Ga0501216_001073
671 Ga0501223_022972
672 Ga0501224_012824
673 Ga0501228_020622
674 Ga0501233_004273
675 Ga0501235_002450
676 Ga0501242_010350
677 Ga0501246_002459
678 Ga0501249_003401
679 Ga0501250_024751
680 Ga0501251_007156
681 Ga0501253_088797
682 Ga0501257_017957
683 Ga0501260_000609
684 Ga0501261_005441
685 Ga0501221_017703
686 Ga0501225_0005013
687 Ga0501080_0042902
688 Ga0501080_0053271
689 Ga0501081_0459517
690 Ga0501232_021169
691 Ga0501266_005682
692 Ga0501270_069175
693 Ga0501271_011558
694 Ga0501280_005003
695 Ga0501281_01641
696 Ga0501283_001376
697 nmdc:mga03n38_365487_c1
698 nmdc:mga03n38_400819_c1
699 nmdc:mga00v17_35061_c1
700 nmdc:mga00v17_58827_c1
701 nmdc:mga00v17_68129_c1
702 nmdc:mga00v17_8931_c1
703 nmdc:mga0yw44_136192_c1
704 nmdc:mga0yw44_232738_c1
705 nmdc:mga0yw44_3298_c1
706 nmdc:mga0k408_113231_c1
707 nmdc:mga06z11_319750_c1
708 nmdc:mga07m45_6620_c1
709 nmdc:mga05p37_234374_c1
710 nmdc:mga05p37_235304_c1
711 nmdc:mga05p37_80026_c1
712 nmdc:mga09592_265297_c1
713 nmdc:mga09592_70405_c1
714 nmdc:mga0qj67_23850_c1
715 nmdc:mga0qj67_534967_c1
716 nmdc:mga06r32_134314_c1
717 nmdc:mga06r32_19323_c1
718 nmdc:mga08y16_18309_c1
719 nmdc:mga08y16_699845_c1
720 nmdc:mga0n895_112608_c1
721 nmdc:mga0n895_249023_c1
722 nmdc:mga0n895_90216_c1
723 nmdc:mga0rr50_14481_c1
724 nmdc:mga08x19_31_c1
725 nmdc:mga0a205_101602_c1
726 nmdc:mga0a205_43257_c1
727 Ga0587084_011051
728 Ga0587084_022495
729 Ga0587084_041510
730 Ga0587077_015304
731 Ga0587077_099701
732 Ga0587085_003313
733 Ga0587085_016394
734 Ga0587092_051730
735 Ga0587094_009098
736 Ga0587125_007685
737 Ga0587101_006906
738 Ga0587101_012688
739 Ga0587101_033844
740 Ga0587109_012662
741 Ga0587109_013494
742 Ga0587117_005965
743 Ga0587117_006879
744 Ga0587062_012925
745 Ga0587062_013142
746 Ga0587062_037682
747 Ga0587068_026265
748 Ga0587068_047157
749 Ga0587068_048123
750 Ga0587072_065497
751 Ga0587076_019555
752 Ga0587078_019015
753 Ga0587061_06298
754 Ga0587111_0014750
755 Ga0587111_0026520
756 Ga0587111_0076701
757 Ga0587111_0151079
758 Ga0501082_0290779
759 Ga0530510_0095465
760 Ga0530510_0121587
761 2510318436
762 2644230969
763 2740000401
764 2740005217
765 2792747420
766 2855389574
767 2904692532
768 2908756800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

1

36

0.96

Map