F429879

General Info

Members Datasets Scaffolds Average Seq Length
384 301 313 214

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10004936|Ga0114129_100049363
Length 251
Sequence MARASPPPWASRSTRLPNDWFPSSRSSGMSTITARKHDPASAIQGIGIPDSKLCRQITELVRDTESDLLFNHSSRVYCFAALTGLRRNLRFDSELLYAGAMFHDMGLTPRHSSRTERFEVDGANVARDFLKAHNIAQGDIDLVWTAIALHTTPGIPMHMHPIIALVTAGVEMDVLGIAYEEFSDAQRKAVVAAYPRTPHFKEDIIQTFYDGIKHKPDTTFGNVKADVLADKDPSFQRGNFCTVIRGSRWTG

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
5 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
6 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
7 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
8 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
9 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
10 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
11 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
12 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
13 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
14 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
15 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
16 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
17 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
18 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
19 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
20 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
21 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
22 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
23 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
24 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
25 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
26 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
27 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
28 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
29 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
30 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
31 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
32 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
33 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
34 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
35 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
36 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
37 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
38 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
39 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
40 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
41 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
42 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
43 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
44 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
45 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
46 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
47 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
48 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
49 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
50 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
51 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
52 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
53 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
54 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
73 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
121 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
282 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
283 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
284 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
285 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
286 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
287 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
288 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
289 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
290 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
291 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
292 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
293 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
294 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
295 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
296 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
297 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
298 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
299 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
300 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
301 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.25
Metatranscriptomes 0.26
Isolates 18.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 17.19
Rhizoplane 6.51
Rhizosphere 53.65
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000181 3300000546 Bacteria 10504
2 JGI24738J21930_10000725 3300002075 Bacteria 9503
3 JGI25152J39213_1000328 3300002773 Bacteria 30406
4 JGI25159J45721_1002982 3300002987 Bacteria 6149
5 JGI25153J46596_10033683 3300003215 Bacteria 1687
6 rootH2_10254180 3300003320 Bacteria 2178
7 rootL2_10310121 3300003322 Bacteria 2574
8 JGI25160J50197_1000955 3300003354 Bacteria 15154
9 JGI25160J50197_1013284 3300003354 Bacteria 2816
10 Ga0055526_1006589 3300003771 Bacteria 6258
11 Ga0055534_1001187 3300003784 Bacteria 10953
12 Ga0065165_1052073 3300005262 Bacteria 1158
13 Ga0065712_10283361 3300005290 Bacteria 891
14 Ga0070683_100113824 3300005329 Bacteria 2553
15 Ga0070682_100143973 3300005337 Bacteria 1628
16 Ga0070660_100361371 3300005339 Bacteria 1197
17 Ga0070661_100313516 3300005344 Bacteria 1224
18 Ga0070692_10017767 3300005345 Bacteria 3408
19 Ga0070671_100231311 3300005355 Bacteria 1569
20 Ga0070688_100121217 3300005365 Bacteria 1752
21 Ga0070703_10037738 3300005406 Bacteria 1490
22 Ga0070709_10006744 3300005434 Bacteria 6269
23 Ga0070709_10088566 3300005434 Bacteria 2036
24 Ga0070709_10670819 3300005434 Bacteria 804
25 Ga0070714_100189115 3300005435 Bacteria 1877
26 Ga0070713_100014711 3300005436 Bacteria 5821
27 Ga0070713_100053798 3300005436 Bacteria 3337
28 Ga0070711_100038866 3300005439 Bacteria 3202
29 Ga0070708_100317971 3300005445 Bacteria 1466
30 Ga0070663_100011307 3300005455 Bacteria 5597
31 Ga0070663_100022582 3300005455 Bacteria 4208
32 Ga0070662_100170255 3300005457 Bacteria 1710
33 Ga0068867_100442785 3300005459 Bacteria 1105
34 Ga0070706_100072590 3300005467 Bacteria 3185
35 Ga0070706_100093059 3300005467 Bacteria 2797
36 Ga0070698_100006801 3300005471 Bacteria 12397
37 Ga0070699_100028340 3300005518 Bacteria 4829
38 Ga0070699_100055137 3300005518 Bacteria 3442
39 Ga0070684_100182119 3300005535 Bacteria 1910
40 Ga0070686_100232910 3300005544 Bacteria 1337
41 Ga0070696_100130859 3300005546 Bacteria 1826
42 Ga0070696_100516132 3300005546 Bacteria 953
43 Ga0070665_100001788 3300005548 Bacteria 24480
44 Ga0070665_100053938 3300005548 Bacteria 4032
45 Ga0070665_100130385 3300005548 Bacteria 2516
46 Ga0070665_100340100 3300005548 Bacteria 1505
47 Ga0070664_100068341 3300005564 Bacteria 3037
48 Ga0068857_100042904 3300005577 Bacteria 4012
49 Ga0068856_100046867 3300005614 Bacteria 4258
50 Ga0068852_100351816 3300005616 Bacteria 1439
51 Ga0068863_100082673 3300005841 Bacteria 3044
52 Ga0068858_101017741 3300005842 Bacteria 812
53 Ga0081455_10000164 3300005937 Bacteria 81995
54 Ga0081540_1042109 3300005983 Bacteria 2359
55 Ga0070717_10077860 3300006028 Bacteria 2777
56 Ga0070717_10092873 3300006028 Bacteria 2550
57 Ga0070717_10417763 3300006028 Bacteria 1206
58 Ga0075365_10008243 3300006038 Bacteria 5897
59 Ga0075365_10025832 3300006038 Bacteria 3721
60 Ga0075365_10028018 3300006038 Bacteria 3590
61 Ga0075365_10157562 3300006038 Bacteria 1581
62 Ga0075363_100000631 3300006048 Bacteria 11657
63 Ga0075432_10110947 3300006058 Bacteria 1022
64 Ga0070715_10000605 3300006163 Bacteria 9488
65 Ga0070715_10026933 3300006163 Bacteria 2291
66 Ga0070716_100041791 3300006173 Bacteria 2556
67 Ga0070712_100002846 3300006175 Bacteria 10709
68 Ga0070712_100453657 3300006175 Bacteria 1068
69 Ga0075367_10017141 3300006178 Bacteria 3971
70 Ga0075367_10071026 3300006178 Bacteria 2094
71 Ga0075370_10016535 3300006353 Bacteria 3970
72 Ga0068871_100075602 3300006358 Bacteria 2781
73 Ga0075428_100126452 3300006844 Bacteria 2782
74 Ga0075430_100102884 3300006846 Bacteria 2385
75 Ga0075433_10529166 3300006852 Bacteria 1037
76 Ga0075434_100145579 3300006871 Bacteria 2389
77 Ga0075434_100556478 3300006871 Bacteria 1167
78 Ga0075436_100431522 3300006914 Bacteria 958
79 Ga0075435_100083576 3300007076 Bacteria 2625
80 Ga0075435_100236804 3300007076 Bacteria 1552
81 Ga0105240_10054534 3300009093 Bacteria 5010
82 Ga0105240_10190332 3300009093 Bacteria 2413
83 Ga0111539_10000050 3300009094 Bacteria 118845
84 Ga0111539_10865800 3300009094 Bacteria 1051
85 Ga0111539_11222462 3300009094 Bacteria 872
86 Ga0114129_10004936 3300009147 Bacteria 18812
87 Ga0114129_10784021 3300009147 Bacteria 1217
88 Ga0105243_10129597 3300009148 Bacteria 2138
89 Ga0105243_10197998 3300009148 Bacteria 1760
90 Ga0105241_10281799 3300009174 Bacteria 1420
91 Ga0105242_10035847 3300009176 Bacteria 3978
92 Ga0105242_10484854 3300009176 Bacteria 1172
93 Ga0105237_10123409 3300009545 Bacteria 2584
94 Ga0105238_10277025 3300009551 Bacteria 1658
95 Ga0105147_101504 3300009982 Bacteria 1908
96 Ga0105035_103140 3300009988 Bacteria 1256
97 Ga0099796_10238244 3300010159 Bacteria 751
98 Ga0105239_10176011 3300010375 Bacteria 2393
99 Ga0105239_10286362 3300010375 Bacteria 1855
100 Ga0105239_10911851 3300010375 Bacteria 1009
101 Ga0105239_10929127 3300010375 Bacteria 999
102 Ga0157370_10219683 3300013104 Bacteria 1760
103 Ga0157369_10714775 3300013105 Bacteria 1031
104 Ga0157369_10784832 3300013105 Bacteria 979
105 Ga0163162_10001365 3300013306 Bacteria 22713
106 Ga0163162_10071813 3300013306 Bacteria 3515
107 Ga0163162_10809376 3300013306 Bacteria 1054
108 Ga0157372_10003702 3300013307 Bacteria 16428
109 Ga0157375_10041323 3300013308 Bacteria 4451
110 Ga0163163_10047997 3300014325 Bacteria 4197
111 Ga0163163_10321812 3300014325 Bacteria 1600
112 Ga0182008_10003184 3300014497 Bacteria 10033
113 Ga0182006_1000200 3300015261 Bacteria 61593
114 Ga0182007_10027463 3300015262 Bacteria 1962
115 Ga0182005_1002762 3300015265 Bacteria 6123
116 Ga0213872_10008275 3300021361 Bacteria 5037
117 Ga0207425_1000112 3300025245 Bacteria 77259
118 Ga0209129_1000139 3300025258 Bacteria 122704
119 Ga0209565_1000134 3300025263 Bacteria 104013
120 Ga0209673_1004104 3300025273 Bacteria 8005
121 Ga0209130_1000380 3300025284 Bacteria 49467
122 Ga0209675_1000050 3300025291 Bacteria 212222
123 Ga0209025_1031006 3300025294 Bacteria 2541
124 Ga0209564_1001020 3300025295 Bacteria 34568
125 Ga0209564_1001394 3300025295 Bacteria 25173
126 Ga0209564_1011598 3300025295 Bacteria 3932
127 Ga0209564_1020176 3300025295 Bacteria 2454
128 Ga0209758_1001668 3300025297 Bacteria 25107
129 Ga0209758_1007772 3300025297 Bacteria 7177
130 Ga0209050_1017556 3300025298 Bacteria 2842
131 Ga0209256_1035117 3300025299 Bacteria 1327
132 Ga0207426_1000347 3300025302 Bacteria 85420
133 Ga0207426_1000475 3300025302 Bacteria 61522
134 Ga0209257_1023169 3300025304 Bacteria 2191
135 Ga0207653_10015092 3300025885 Bacteria 2424
136 Ga0207692_10002238 3300025898 Bacteria 7402
137 Ga0207647_10019740 3300025904 Bacteria 4528
138 Ga0207699_10010821 3300025906 Bacteria 4592
139 Ga0207705_10000016 3300025909 Bacteria 377359
140 Ga0207684_10065433 3300025910 Bacteria 3087
141 Ga0207684_10244196 3300025910 Bacteria 1549
142 Ga0207695_10069121 3300025913 Bacteria 3615
143 Ga0207671_10101327 3300025914 Bacteria 2181
144 Ga0207693_10005722 3300025915 Bacteria 10323
145 Ga0207693_10035866 3300025915 Bacteria 3909
146 Ga0207663_10053460 3300025916 Bacteria 2523
147 Ga0207657_10177192 3300025919 Bacteria 1725
148 Ga0207649_10019089 3300025920 Bacteria 3915
149 Ga0207649_10194482 3300025920 Bacteria 1429
150 Ga0207646_10226958 3300025922 Bacteria 1687
151 Ga0207694_10643435 3300025924 Bacteria 893
152 Ga0207700_10051029 3300025928 Bacteria 3085
153 Ga0207700_10586672 3300025928 Bacteria 991
154 Ga0207664_10063632 3300025929 Bacteria 2948
155 Ga0207686_10101552 3300025934 Bacteria 1922
156 Ga0207665_10001976 3300025939 Bacteria 13813
157 Ga0207665_10013610 3300025939 Bacteria 5352
158 Ga0207711_10291156 3300025941 Bacteria 1505
159 Ga0207661_10672955 3300025944 Bacteria 951
160 Ga0207679_10037126 3300025945 Bacteria 3461
161 Ga0207679_10139778 3300025945 Bacteria 1956
162 Ga0207667_10192440 3300025949 Bacteria 2093
163 Ga0207678_10021059 3300026067 Bacteria 5716
164 Ga0207678_10024772 3300026067 Bacteria 5239
165 Ga0207702_10094956 3300026078 Bacteria 2619
166 Ga0207641_10034722 3300026088 Bacteria 4197
167 Ga0207674_10030085 3300026116 Bacteria 5712
168 Ga0207698_10430664 3300026142 Bacteria 1268
169 Ga0209588_1057081 3300027671 Bacteria 1262
170 Ga0209813_10039400 3300027866 Bacteria 1432
171 Ga0207428_10000937 3300027907 Bacteria 32446
172 Ga0268266_10005265 3300028379 Bacteria 12146
173 Ga0268266_10008168 3300028379 Bacteria 9340
174 Ga0268266_10010877 3300028379 Bacteria 7926
175 Ga0268266_10908581 3300028379 Bacteria 851
176 Ga0265760_10163082 3300031090 Bacteria 737
177 Ga0307412_10000387 3300031911 Bacteria 27320
178 Ga0307510_10003591 3300033180 Bacteria 18108
179 Ga0307510_10063486 3300033180 Bacteria 3761
180 Ga0395899_0169730 3300037312 Bacteria 1537
181 Ga0395900_0187244 3300037418 Bacteria 2101
182 Ga0395898_0017696 3300037466 Bacteria 7273
183 Ga0395905_0082790 3300037471 Bacteria 3007
184 Ga0395905_0123442 3300037471 Bacteria 2435
185 Ga0395901_0069188 3300038443 Bacteria 3676
186 Ga0436361_0445115 3300039447 Bacteria 4762
187 Ga0436361_0689294 3300039447 Bacteria 1392
188 Ga0439436_0000002 3300041404 Bacteria 248787
189 Ga0439465_0030575 3300041413 Bacteria 1714
190 Ga0466961_0010846 3300044693 Bacteria 5820
191 Ga0466968_0194309 3300044735 Bacteria 948
192 Ga0466970_0061999 3300044765 Bacteria 2004
193 Ga0466959_0140642 3300045049 Bacteria 1706
194 Ga0495590_0171548 3300046457 Bacteria 791
195 Ga0495580_0224099 3300046472 Bacteria 1291
196 Ga0495605_0144261 3300046474 Bacteria 1066
197 Ga0495594_0001920 3300046499 Bacteria 10842
198 Ga0495607_0212889 3300046501 Bacteria 950
199 Ga0495610_0000414 3300046512 Bacteria 43804
200 Ga0495631_0146715 3300046518 Bacteria 1012
201 Ga0495644_0000348 3300046523 Bacteria 21035
202 Ga0495648_0004793 3300046524 Bacteria 11436
203 Ga0495642_0045960 3300046528 Bacteria 1785
204 Ga0495668_0103545 3300046616 Bacteria 1557
205 Ga0495611_0000007 3300046648 Bacteria 224144
206 Ga0495611_0004337 3300046648 Bacteria 6151
207 Ga0495625_0000648 3300046660 Bacteria 50041
208 Ga0495669_0036809 3300046684 Bacteria 2164
209 Ga0495613_0030201 3300046689 Bacteria 4026
210 Ga0495670_0001622 3300046691 Bacteria 11019
211 Ga0495670_0002466 3300046691 Bacteria 9130
212 Ga0495649_0030228 3300046694 Bacteria 2992
213 Ga0495683_0134569 3300047323 Bacteria 1163
214 Ga0495687_000136 3300047443 Bacteria 113298
215 Ga0495686_0032681 3300047472 Bacteria 3365
216 Ga0496100_0104856 3300048903 Bacteria 1954
217 Ga0496100_0316344 3300048903 Bacteria 1172
218 Ga0496100_0466284 3300048903 Bacteria 970
219 Ga0496100_0955150 3300048903 Bacteria 674
220 Ga0496101_0589274 3300048904 Bacteria 879
221 Ga0496101_0594227 3300048904 Bacteria 875
222 Ga0496102_0037540 3300048905 Bacteria 4371
223 Ga0496102_0724548 3300048905 Bacteria 917
224 Ga0496105_0091952 3300048908 Bacteria 2505
225 Ga0496105_0250261 3300048908 Bacteria 1436
226 Ga0496106_0022918 3300048909 Bacteria 4638
227 Ga0496106_0095931 3300048909 Bacteria 2294
228 Ga0496106_0523564 3300048909 Bacteria 952
229 Ga0496107_0113585 3300048910 Bacteria 1992
230 Ga0496108_0244459 3300048911 Bacteria 1561
231 Ga0496108_0245038 3300048911 Bacteria 1559
232 Ga0496109_0005041 3300048912 Bacteria 11035
233 Ga0496109_0137500 3300048912 Bacteria 2284
234 Ga0496110_0081600 3300048913 Bacteria 2883
235 Ga0496111_0330284 3300048914 Bacteria 1129
236 Ga0496112_0098593 3300048915 Bacteria 2892
237 Ga0496113_0054779 3300048916 Bacteria 2987
238 Ga0496113_0634792 3300048916 Bacteria 854
239 Ga0496114_0063610 3300048917 Bacteria 3089
240 Ga0496115_0033700 3300048918 Bacteria 4044
241 Ga0496116_0206659 3300048919 Bacteria 1021
242 Ga0496117_0087029 3300048920 Bacteria 2027
243 Ga0496117_0104265 3300048920 Bacteria 1785
244 Ga0496118_0059990 3300048921 Bacteria 2828
245 Ga0496119_0016777 3300048922 Bacteria 5548
246 Ga0496119_0089374 3300048922 Bacteria 1754
247 Ga0496120_0042574 3300048923 Bacteria 2650
248 Ga0496120_0230106 3300048923 Bacteria 881
249 Ga0496121_0037371 3300048924 Bacteria 4313
250 Ga0496121_0228314 3300048924 Bacteria 1306
251 Ga0496124_0117831 3300048927 Bacteria 2127
252 Ga0496125_0108174 3300048928 Bacteria 2023
253 Ga0496126_0000018 3300048929 Bacteria 581170
254 Ga0496126_0095092 3300048929 Bacteria 2614
255 Ga0496126_0111131 3300048929 Bacteria 2387
256 Ga0496126_0134076 3300048929 Bacteria 2138
257 Ga0495678_000216 3300049459 Bacteria 66661
258 Ga0501031_0155573 3300049568 Bacteria 1494
259 Ga0501031_0316780 3300049568 Bacteria 1011
260 Ga0501032_0010184 3300049569 Bacteria 6785
261 Ga0501032_0199568 3300049569 Bacteria 1306
262 Ga0501034_0005618 3300049571 Bacteria 13661
263 Ga0501036_0002399 3300049572 Bacteria 14662
264 Ga0501037_0002644 3300049573 Bacteria 12916
265 Ga0501038_0127462 3300049574 Bacteria 2093
266 Ga0501039_0713171 3300049575 Bacteria 784
267 Ga0501043_0082398 3300049579 Bacteria 2528
268 Ga0501046_0000209 3300049580 Bacteria 60874
269 Ga0501047_0028783 3300049581 Bacteria 5358
270 Ga0501073_0003907 3300049589 Bacteria 11192
271 Ga0501080_0025794 3300049742 Bacteria 5460
272 Ga0501083_0110394 3300049744 Bacteria 1809
273 Ga0501035_0014583 3300049822 Bacteria 7253
274 Ga0501035_0073287 3300049822 Bacteria 3030
275 Ga0501044_0200768 3300049823 Bacteria 1952
276 Ga0501044_0274232 3300049823 Bacteria 1621
277 nmdc:mga03n38_32325_c1 3300050490 Bacteria 2216
278 nmdc:mga03n38_62384_c1 3300050490 Bacteria 1700
279 nmdc:mga0yw44_109682_c1 3300050492 Bacteria 1767
280 nmdc:mga0yw44_173467_c1 3300050492 Bacteria 1417
281 nmdc:mga0yw44_246332_c1 3300050492 Bacteria 1189
282 nmdc:mga0yw44_61255_c1 3300050492 Bacteria 1029
283 nmdc:mga0yw44_99546_c1 3300050492 Bacteria 1850
284 nmdc:mga0k408_341747_c1 3300050493 Bacteria 892
285 nmdc:mga06z11_46568_c1 3300050494 Bacteria 2198
286 nmdc:mga04h51_22942_c1 3300050495 Bacteria 1894
287 nmdc:mga07m45_6222_c1 3300050496 Bacteria 6026
288 nmdc:mga05p37_215078_c1 3300050507 Bacteria 2322
289 nmdc:mga05p37_27657_c1 3300050507 Bacteria 6908
290 nmdc:mga09592_89551_c1 3300050508 Bacteria 2628
291 nmdc:mga06r32_22133_c1 3300050510 Bacteria 5873
292 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
293 nmdc:mga0rr50_754106_c1 3300050513 Bacteria 831
294 nmdc:mga08x19_212969_c1 3300050514 Bacteria 1326
295 nmdc:mga0a205_293108_c1 3300050515 Bacteria 1501
296 nmdc:mga0sz30_11372_c1 3300050516 Bacteria 3435
297 Ga0500643_000079 3300053087 Bacteria 104107
298 Ga0500583_0000079 3300053092 Bacteria 57526
299 Ga0500651_0055279 3300053093 Bacteria 2487
300 Ga0500641_0126554 3300053096 Bacteria 1102
301 Ga0500555_008428 3300053103 Bacteria 2938
302 Ga0500562_008978 3300053108 Bacteria 2525
303 Ga0500562_043788 3300053108 Bacteria 1192
304 Ga0500569_008477 3300053109 Bacteria 2352
305 Ga0500595_123393 3300053119 Bacteria 731
306 Ga0500607_151430 3300053121 Bacteria 1074
307 Ga0500559_0237193 3300053136 Bacteria 860
308 Ga0500577_0013479 3300053142 Bacteria 2498
309 Ga0500622_0060418 3300053156 Bacteria 1933
310 Ga0500638_058777 3300053162 Bacteria 1851
311 Ga0500636_0000397 3300053177 Bacteria 23984
312 Ga0500570_154394 3300053724 Bacteria 808
313 Ga0500599_002961 3300053736 Bacteria 2059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10176011 Ga0105239_101760112 204
2 3300005337 Ga0070682_100143973 Ga0070682_1001439732 207
3 3300005344 Ga0070661_100313516 Ga0070661_1003135162 207
4 3300005455 Ga0070663_100011307 Ga0070663_1000113076 207
5 3300006038 Ga0075365_10008243 Ga0075365_100082433 207
6 3300006048 Ga0075363_100000631 Ga0075363_1000006315 207
7 3300006178 Ga0075367_10017141 Ga0075367_100171415 207
8 3300006353 Ga0075370_10016535 Ga0075370_100165353 207
9 3300009094 Ga0111539_10865800 Ga0111539_108658002 207
10 3300025920 Ga0207649_10194482 Ga0207649_101944822 207
11 3300025924 Ga0207694_10643435 Ga0207694_106434352 207
12 3300026067 Ga0207678_10021059 Ga0207678_100210592 207
13 3300028379 Ga0268266_10008168 Ga0268266_1000816810 207
14 iso_pu_bacteria 2513237141 2513894205 208
15 iso_pu_bacteria 2842918807 2842921316 208
16 iso_pu_bacteria 2874645413 2874649520 208
17 iso_pu_bacteria 2876761206 2876764559 208
18 iso_pu_bacteria 2879127579 2879133374 208
19 iso_pu_bacteria 2879142872 2879146256 208
20 iso_pu_bacteria 2915986958 2915988536 208
21 iso_pu_bacteria 2957491536 2957497798 208
22 iso_pu_bacteria 2960674078 2960680182 208
23 iso_pu_bacteria 2964698721 2964704923 208
24 iso_pu_bacteria 2964712639 2964717563 208
25 iso_pu_bacteria 2970076120 2970077824 208
26 iso_pu_bacteria 2970082768 2970085834 208
27 iso_pu_bacteria 643348564 643600020 208
28 3300003322 rootL2_10310121 rootL2_103101212 209
29 iso_pu_bacteria 2501025502 2501082899 209
30 iso_pu_bacteria 2510917013 2511091111 209
31 iso_pu_bacteria 2824661429 2824671002 209
32 iso_pu_bacteria 2874628541 2874629240 209
33 iso_pu_bacteria 2879099564 2879100201 209
34 iso_pu_bacteria 2929615660 2929623659 209
35 iso_pu_bacteria 2929624759 2929632867 209
36 iso_pu_bacteria 2932784394 2932786156 209
37 iso_pu_bacteria 2932809354 2932816883 209
38 iso_pu_bacteria 2932818245 2932826023 209
39 iso_pu_bacteria 2932828146 2932829419 209
40 iso_pu_bacteria 2933577622 2933585562 209
41 iso_pu_bacteria 2935616580 2935617852 209
42 iso_pu_bacteria 2935638405 2935647825 209
43 iso_pu_bacteria 2935665750 2935674762 209
44 iso_pu_bacteria 2935684952 2935692412 209
45 iso_pu_bacteria 2935694250 2935699370 209
46 iso_pu_bacteria 2935703347 2935707101 209
47 iso_pu_bacteria 2935713505 2935721030 209
48 iso_pu_bacteria 2935722832 2935722855 209
49 iso_pu_bacteria 2935732158 2935739719 209
50 iso_pu_bacteria 2935741537 2935748757 209
51 iso_pu_bacteria 2935750917 2935758627 209
52 iso_pu_bacteria 2935760218 2935764607 209
53 iso_pu_bacteria 2935769743 2935775504 209
54 iso_pu_bacteria 2935777560 2935779752 209
55 iso_pu_bacteria 2935785616 2935790000 209
56 iso_pu_bacteria 2935793552 2935798429 209
57 iso_pu_bacteria 2935801545 2935806657 209
58 iso_pu_bacteria 2935827899 2935837309 209
59 iso_pu_bacteria 2935837841 2935842004 209
60 iso_pu_bacteria 2935855204 2935856649 209
61 iso_pu_bacteria 2935864058 2935872937 209
62 iso_pu_bacteria 2935873716 2935874386 209
63 iso_pu_bacteria 2935992306 2936001100 209
64 iso_pu_bacteria 2936002035 2936010754 209
65 iso_pu_bacteria 2940556831 2940564783 209
66 iso_pu_bacteria 2941538514 2941547055 209
67 iso_pu_bacteria 8016511872 8016518816 209
68 iso_pu_bacteria 8016522445 8016525629 209
69 iso_pu_bacteria 8016530956 8016539223 209
70 iso_pu_bacteria 8016539877 8016543510 209
71 iso_pu_bacteria 8016548790 8016549784 209
72 iso_pu_bacteria 8016557553 8016558198 209
73 iso_pu_bacteria 8016575299 8016581560 209
74 iso_pu_bacteria 8016595262 8016596198 209
75 iso_pu_bacteria 8016603502 8016607101 209
76 iso_pu_bacteria 8016613128 8016618999 209
77 iso_pu_bacteria 8016622563 8016630586 209
78 iso_pu_bacteria 8017057580 8017057862 209
79 iso_pu_bacteria 8019530166 8019538891 209
80 iso_pu_bacteria 8019547302 8019549539 209
81 iso_pu_bacteria 8019576017 8019577863 209
82 iso_pu_bacteria 8019586578 8019595966 209
83 iso_pu_bacteria 8019608314 8019612742 209
84 iso_pu_bacteria 8055742211 8055750834 209
85 3300039447 Ga0436361_0445115 Ga0436361_0445115_3145_3777 210
86 3300048904 Ga0496101_0594227 Ga0496101_0594227_10_642 210
87 3300048909 Ga0496106_0523564 Ga0496106_0523564_34_666 210
88 3300002987 JGI25159J45721_1002982 JGI25159J45721_10029821 211
89 3300003354 JGI25160J50197_1013284 JGI25160J50197_10132842 211
90 3300005406 Ga0070703_10037738 Ga0070703_100377382 211
91 3300005434 Ga0070709_10006744 Ga0070709_100067444 211
92 3300005434 Ga0070709_10088566 Ga0070709_100885662 211
93 3300005435 Ga0070714_100189115 Ga0070714_1001891152 211
94 3300005436 Ga0070713_100014711 Ga0070713_1000147113 211
95 3300005436 Ga0070713_100053798 Ga0070713_1000537982 211
96 3300005439 Ga0070711_100038866 Ga0070711_1000388662 211
97 3300005518 Ga0070699_100028340 Ga0070699_1000283402 211
98 3300005518 Ga0070699_100055137 Ga0070699_1000551372 211
99 3300005546 Ga0070696_100130859 Ga0070696_1001308593 211
100 3300005546 Ga0070696_100516132 Ga0070696_1005161322 211
101 3300005614 Ga0068856_100046867 Ga0068856_1000468673 211
102 3300005841 Ga0068863_100082673 Ga0068863_1000826732 211
103 3300006028 Ga0070717_10077860 Ga0070717_100778604 211
104 3300006028 Ga0070717_10092873 Ga0070717_100928732 211
105 3300006028 Ga0070717_10417763 Ga0070717_104177632 211
106 3300006038 Ga0075365_10028018 Ga0075365_100280184 211
107 3300006058 Ga0075432_10110947 Ga0075432_101109471 211
108 3300006163 Ga0070715_10000605 Ga0070715_100006055 211
109 3300006163 Ga0070715_10026933 Ga0070715_100269332 211
110 3300006173 Ga0070716_100041791 Ga0070716_1000417912 211
111 3300006175 Ga0070712_100002846 Ga0070712_1000028462 211
112 3300006846 Ga0075430_100102884 Ga0075430_1001028842 211
113 3300006871 Ga0075434_100145579 Ga0075434_1001455793 211
114 3300006871 Ga0075434_100556478 Ga0075434_1005564782 211
115 3300006914 Ga0075436_100431522 Ga0075436_1004315221 211
116 3300007076 Ga0075435_100083576 Ga0075435_1000835762 211
117 3300007076 Ga0075435_100236804 Ga0075435_1002368042 211
118 3300009093 Ga0105240_10054534 Ga0105240_100545344 211
119 3300009094 Ga0111539_11222462 Ga0111539_112224621 211
120 3300009147 Ga0114129_10784021 Ga0114129_107840212 211
121 3300009176 Ga0105242_10484854 Ga0105242_104848542 211
122 3300009982 Ga0105147_101504 Ga0105147_1015043 211
123 3300010159 Ga0099796_10238244 Ga0099796_102382441 211
124 3300013306 Ga0163162_10809376 Ga0163162_108093762 211
125 3300025284 Ga0209130_1000380 Ga0209130_100038036 211
126 3300025302 Ga0207426_1000475 Ga0207426_100047546 211
127 3300025885 Ga0207653_10015092 Ga0207653_100150921 211
128 3300025898 Ga0207692_10002238 Ga0207692_100022385 211
129 3300025906 Ga0207699_10010821 Ga0207699_100108212 211
130 3300025913 Ga0207695_10069121 Ga0207695_100691213 211
131 3300025915 Ga0207693_10005722 Ga0207693_1000572210 211
132 3300025915 Ga0207693_10035866 Ga0207693_100358663 211
133 3300025916 Ga0207663_10053460 Ga0207663_100534602 211
134 3300025928 Ga0207700_10051029 Ga0207700_100510292 211
135 3300025928 Ga0207700_10586672 Ga0207700_105866721 211
136 3300025929 Ga0207664_10063632 Ga0207664_100636324 211
137 3300025939 Ga0207665_10001976 Ga0207665_100019769 211
138 3300025939 Ga0207665_10013610 Ga0207665_100136102 211
139 3300026078 Ga0207702_10094956 Ga0207702_100949562 211
140 3300026088 Ga0207641_10034722 Ga0207641_100347223 211
141 3300038443 Ga0395901_0069188 Ga0395901_0069188_2886_3521 211
142 3300048903 Ga0496100_0316344 Ga0496100_0316344_67_705 211
143 3300048903 Ga0496100_0955150 Ga0496100_0955150_11_661 211
144 3300048909 Ga0496106_0022918 Ga0496106_0022918_2138_2776 211
145 3300048914 Ga0496111_0330284 Ga0496111_0330284_11_649 211
146 3300050492 nmdc:mga0yw44_109682_c1 nmdc:mga0yw44_109682_c1_648_1286 211
147 3300050507 nmdc:mga05p37_215078_c1 nmdc:mga05p37_215078_c1_130_768 211
148 3300050508 nmdc:mga09592_89551_c1 nmdc:mga09592_89551_c1_391_1029 211
149 3300050513 nmdc:mga0rr50_754106_c1 nmdc:mga0rr50_754106_c1_139_777 211
150 3300050514 nmdc:mga08x19_212969_c1 nmdc:mga08x19_212969_c1_658_1296 211
151 3300050515 nmdc:mga0a205_293108_c1 nmdc:mga0a205_293108_c1_661_1299 211
152 3300002075 JGI24738J21930_10000725 JGI24738J21930_100007257 212
153 3300002773 JGI25152J39213_1000328 JGI25152J39213_10003282 212
154 3300003215 JGI25153J46596_10033683 JGI25153J46596_100336831 212
155 3300003354 JGI25160J50197_1000955 JGI25160J50197_100095510 212
156 3300003771 Ga0055526_1006589 Ga0055526_10065895 212
157 3300005262 Ga0065165_1052073 Ga0065165_10520731 212
158 3300005329 Ga0070683_100113824 Ga0070683_1001138243 212
159 3300005339 Ga0070660_100361371 Ga0070660_1003613712 212
160 3300005345 Ga0070692_10017767 Ga0070692_100177673 212
161 3300005355 Ga0070671_100231311 Ga0070671_1002313111 212
162 3300005455 Ga0070663_100022582 Ga0070663_1000225822 212
163 3300005457 Ga0070662_100170255 Ga0070662_1001702552 212
164 3300005459 Ga0068867_100442785 Ga0068867_1004427851 212
165 3300005535 Ga0070684_100182119 Ga0070684_1001821192 212
166 3300005548 Ga0070665_100001788 Ga0070665_1000017886 212
167 3300005548 Ga0070665_100053938 Ga0070665_1000539381 212
168 3300005548 Ga0070665_100130385 Ga0070665_1001303852 212
169 3300005564 Ga0070664_100068341 Ga0070664_1000683413 212
170 3300005577 Ga0068857_100042904 Ga0068857_1000429043 212
171 3300005616 Ga0068852_100351816 Ga0068852_1003518162 212
172 3300005983 Ga0081540_1042109 Ga0081540_10421092 212
173 3300006038 Ga0075365_10025832 Ga0075365_100258323 212
174 3300006038 Ga0075365_10157562 Ga0075365_101575622 212
175 3300006175 Ga0070712_100453657 Ga0070712_1004536572 212
176 3300006852 Ga0075433_10529166 Ga0075433_105291661 212
177 3300009093 Ga0105240_10190332 Ga0105240_101903322 212
178 3300009094 Ga0111539_10000050 Ga0111539_1000005094 212
179 3300009148 Ga0105243_10197998 Ga0105243_101979981 212
180 3300009174 Ga0105241_10281799 Ga0105241_102817992 212
181 3300009545 Ga0105237_10123409 Ga0105237_101234092 212
182 3300009551 Ga0105238_10277025 Ga0105238_102770252 212
183 3300010375 Ga0105239_10286362 Ga0105239_102863622 212
184 3300010375 Ga0105239_10911851 Ga0105239_109118511 212
185 3300010375 Ga0105239_10929127 Ga0105239_109291271 212
186 3300013306 Ga0163162_10071813 Ga0163162_100718132 212
187 3300013307 Ga0157372_10003702 Ga0157372_1000370210 212
188 3300013308 Ga0157375_10041323 Ga0157375_100413232 212
189 3300014325 Ga0163163_10047997 Ga0163163_100479973 212
190 3300014325 Ga0163163_10321812 Ga0163163_103218121 212
191 3300014497 Ga0182008_10003184 Ga0182008_100031843 212
192 3300015261 Ga0182006_1000200 Ga0182006_100020021 212
193 3300015262 Ga0182007_10027463 Ga0182007_100274632 212
194 3300015265 Ga0182005_1002762 Ga0182005_10027623 212
195 3300025245 Ga0207425_1000112 Ga0207425_100011239 212
196 3300025258 Ga0209129_1000139 Ga0209129_100013951 212
197 3300025263 Ga0209565_1000134 Ga0209565_100013480 212
198 3300025273 Ga0209673_1004104 Ga0209673_10041044 212
199 3300025294 Ga0209025_1031006 Ga0209025_10310062 212
200 3300025295 Ga0209564_1001020 Ga0209564_10010207 212
201 3300025295 Ga0209564_1011598 Ga0209564_10115982 212
202 3300025295 Ga0209564_1020176 Ga0209564_10201763 212
203 3300025297 Ga0209758_1001668 Ga0209758_100166819 212
204 3300025297 Ga0209758_1007772 Ga0209758_10077727 212
205 3300025298 Ga0209050_1017556 Ga0209050_10175565 212
206 3300025299 Ga0209256_1035117 Ga0209256_10351171 212
207 3300025302 Ga0207426_1000347 Ga0207426_100034710 212
208 3300025304 Ga0209257_1023169 Ga0209257_10231692 212
209 3300025914 Ga0207671_10101327 Ga0207671_101013271 212
210 3300025919 Ga0207657_10177192 Ga0207657_101771922 212
211 3300025920 Ga0207649_10019089 Ga0207649_100190894 212
212 3300025941 Ga0207711_10291156 Ga0207711_102911562 212
213 3300025944 Ga0207661_10672955 Ga0207661_106729551 212
214 3300025945 Ga0207679_10037126 Ga0207679_100371263 212
215 3300025945 Ga0207679_10139778 Ga0207679_101397782 212
216 3300025949 Ga0207667_10192440 Ga0207667_101924402 212
217 3300026067 Ga0207678_10024772 Ga0207678_100247724 212
218 3300026116 Ga0207674_10030085 Ga0207674_100300852 212
219 3300026142 Ga0207698_10430664 Ga0207698_104306642 212
220 3300027907 Ga0207428_10000937 Ga0207428_1000093719 212
221 3300028379 Ga0268266_10010877 Ga0268266_100108778 212
222 3300028379 Ga0268266_10908581 Ga0268266_109085811 212
223 3300031911 Ga0307412_10000387 Ga0307412_1000038717 212
224 3300033180 Ga0307510_10003591 Ga0307510_1000359111 212
225 3300033180 Ga0307510_10063486 Ga0307510_100634862 212
226 3300037312 Ga0395899_0169730 Ga0395899_0169730_822_1460 212
227 3300037418 Ga0395900_0187244 Ga0395900_0187244_558_1196 212
228 3300037471 Ga0395905_0123442 Ga0395905_0123442_1012_1650 212
229 3300039447 Ga0436361_0689294 Ga0436361_0689294_461_1102 212
230 3300041404 Ga0439436_0000002 Ga0439436_0000002_53819_54457 212
231 3300041413 Ga0439465_0030575 Ga0439465_0030575_1062_1703 212
232 3300044693 Ga0466961_0010846 Ga0466961_0010846_4373_5014 212
233 3300044735 Ga0466968_0194309 Ga0466968_0194309_176_814 212
234 3300044765 Ga0466970_0061999 Ga0466970_0061999_1221_1862 212
235 3300045049 Ga0466959_0140642 Ga0466959_0140642_417_1055 212
236 3300046457 Ga0495590_0171548 Ga0495590_0171548_83_724 212
237 3300046512 Ga0495610_0000414 Ga0495610_0000414_26389_27027 212
238 3300046524 Ga0495648_0004793 Ga0495648_0004793_8968_9609 212
239 3300046616 Ga0495668_0103545 Ga0495668_0103545_849_1490 212
240 3300046648 Ga0495611_0004337 Ga0495611_0004337_1657_2298 212
241 3300046660 Ga0495625_0000648 Ga0495625_0000648_1295_1936 212
242 3300046689 Ga0495613_0030201 Ga0495613_0030201_1001_1642 212
243 3300046691 Ga0495670_0001622 Ga0495670_0001622_3571_4209 212
244 3300046691 Ga0495670_0002466 Ga0495670_0002466_6866_7507 212
245 3300046694 Ga0495649_0030228 Ga0495649_0030228_706_1344 212
246 3300047323 Ga0495683_0134569 Ga0495683_0134569_458_1099 212
247 3300047443 Ga0495687_000136 Ga0495687_000136_31113_31754 212
248 3300048903 Ga0496100_0104856 Ga0496100_0104856_20_661 212
249 3300048905 Ga0496102_0037540 Ga0496102_0037540_1291_1932 212
250 3300048908 Ga0496105_0091952 Ga0496105_0091952_608_1249 212
251 3300048909 Ga0496106_0095931 Ga0496106_0095931_1169_1810 212
252 3300048910 Ga0496107_0113585 Ga0496107_0113585_854_1495 212
253 3300048911 Ga0496108_0245038 Ga0496108_0245038_846_1484 212
254 3300048912 Ga0496109_0005041 Ga0496109_0005041_3157_3798 212
255 3300048912 Ga0496109_0137500 Ga0496109_0137500_358_996 212
256 3300048913 Ga0496110_0081600 Ga0496110_0081600_1739_2380 212
257 3300048915 Ga0496112_0098593 Ga0496112_0098593_1676_2314 212
258 3300048916 Ga0496113_0054779 Ga0496113_0054779_180_818 212
259 3300048916 Ga0496113_0634792 Ga0496113_0634792_22_663 212
260 3300048917 Ga0496114_0063610 Ga0496114_0063610_1939_2580 212
261 3300048920 Ga0496117_0087029 Ga0496117_0087029_1317_1958 212
262 3300048920 Ga0496117_0104265 Ga0496117_0104265_364_1005 212
263 3300048921 Ga0496118_0059990 Ga0496118_0059990_903_1544 212
264 3300048922 Ga0496119_0016777 Ga0496119_0016777_4791_5429 212
265 3300048922 Ga0496119_0089374 Ga0496119_0089374_1013_1654 212
266 3300048923 Ga0496120_0042574 Ga0496120_0042574_343_984 212
267 3300048923 Ga0496120_0230106 Ga0496120_0230106_30_671 212
268 3300048924 Ga0496121_0037371 Ga0496121_0037371_3616_4257 212
269 3300048927 Ga0496124_0117831 Ga0496124_0117831_905_1546 212
270 3300048928 Ga0496125_0108174 Ga0496125_0108174_74_715 212
271 3300048929 Ga0496126_0095092 Ga0496126_0095092_775_1416 212
272 3300049459 Ga0495678_000216 Ga0495678_000216_31703_32344 212
273 3300050492 nmdc:mga0yw44_173467_c1 nmdc:mga0yw44_173467_c1_61_702 212
274 3300050492 nmdc:mga0yw44_246332_c1 nmdc:mga0yw44_246332_c1_175_816 212
275 3300050511 nmdc:mga08y16_33_c1 nmdc:mga08y16_33_c1_11938_12579 212
276 3300050516 nmdc:mga0sz30_11372_c1 nmdc:mga0sz30_11372_c1_92_733 212
277 3300053087 Ga0500643_000079 Ga0500643_000079_22094_22735 212
278 3300053092 Ga0500583_0000079 Ga0500583_0000079_55459_56100 212
279 3300053093 Ga0500651_0055279 Ga0500651_0055279_1693_2334 212
280 3300053096 Ga0500641_0126554 Ga0500641_0126554_250_891 212
281 3300053103 Ga0500555_008428 Ga0500555_008428_1881_2522 212
282 3300053108 Ga0500562_008978 Ga0500562_008978_565_1206 212
283 3300053108 Ga0500562_043788 Ga0500562_043788_332_973 212
284 3300053109 Ga0500569_008477 Ga0500569_008477_154_795 212
285 3300053119 Ga0500595_123393 Ga0500595_123393_37_690 212
286 3300053121 Ga0500607_151430 Ga0500607_151430_382_1023 212
287 3300053142 Ga0500577_0013479 Ga0500577_0013479_611_1252 212
288 3300053156 Ga0500622_0060418 Ga0500622_0060418_1026_1667 212
289 3300053162 Ga0500638_058777 Ga0500638_058777_756_1397 212
290 3300053177 Ga0500636_0000397 Ga0500636_0000397_13338_13979 212
291 3300053724 Ga0500570_154394 Ga0500570_154394_88_729 212
292 3300053736 Ga0500599_002961 Ga0500599_002961_59_700 212
293 3300005842 Ga0068858_101017741 Ga0068858_1010177411 213
294 3300053136 Ga0500559_0237193 Ga0500559_0237193_151_792 213
295 3300048903 Ga0496100_0466284 Ga0496100_0466284_185_895 215
296 3300048908 Ga0496105_0250261 Ga0496105_0250261_149_859 215
297 3300048918 Ga0496115_0033700 Ga0496115_0033700_789_1499 215
298 3300050490 nmdc:mga03n38_32325_c1 nmdc:mga03n38_32325_c1_412_1122 215
299 3300050492 nmdc:mga0yw44_61255_c1 nmdc:mga0yw44_61255_c1_34_744 215
300 3300050496 nmdc:mga07m45_6222_c1 nmdc:mga07m45_6222_c1_1937_2647 215
301 3300046648 Ga0495611_0000007 Ga0495611_0000007_152196_152852 216
302 3300047472 Ga0495686_0032681 Ga0495686_0032681_1160_1810 216
303 3300048924 Ga0496121_0228314 Ga0496121_0228314_98_754 216
304 3300003320 rootH2_10254180 rootH2_102541802 217
305 3300003784 Ga0055534_1001187 Ga0055534_100118710 217
306 3300005548 Ga0070665_100340100 Ga0070665_1003401002 217
307 3300013105 Ga0157369_10714775 Ga0157369_107147751 217
308 3300025291 Ga0209675_1000050 Ga0209675_10000502 217
309 3300025295 Ga0209564_1001394 Ga0209564_10013942 217
310 3300025904 Ga0207647_10019740 Ga0207647_100197402 217
311 3300028379 Ga0268266_10005265 Ga0268266_100052652 217
312 3300048919 Ga0496116_0206659 Ga0496116_0206659_26_685 217
313 3300005365 Ga0070688_100121217 Ga0070688_1001212172 218
314 3300005544 Ga0070686_100232910 Ga0070686_1002329101 218
315 3300037471 Ga0395905_0082790 Ga0395905_0082790_1266_1958 218
316 3300049568 Ga0501031_0155573 Ga0501031_0155573_350_1012 219
317 3300049568 Ga0501031_0316780 Ga0501031_0316780_83_742 219
318 3300049569 Ga0501032_0010184 Ga0501032_0010184_5998_6660 219
319 3300049569 Ga0501032_0199568 Ga0501032_0199568_15_674 219
320 3300049571 Ga0501034_0005618 Ga0501034_0005618_7833_8495 219
321 3300049572 Ga0501036_0002399 Ga0501036_0002399_566_1228 219
322 3300049573 Ga0501037_0002644 Ga0501037_0002644_5623_6285 219
323 3300049574 Ga0501038_0127462 Ga0501038_0127462_195_857 219
324 3300049575 Ga0501039_0713171 Ga0501039_0713171_16_678 219
325 3300049579 Ga0501043_0082398 Ga0501043_0082398_1616_2278 219
326 3300049580 Ga0501046_0000209 Ga0501046_0000209_29169_29831 219
327 3300049581 Ga0501047_0028783 Ga0501047_0028783_1100_1762 219
328 3300049589 Ga0501073_0003907 Ga0501073_0003907_464_1126 219
329 3300049742 Ga0501080_0025794 Ga0501080_0025794_3681_4343 219
330 3300049744 Ga0501083_0110394 Ga0501083_0110394_118_780 219
331 3300049822 Ga0501035_0014583 Ga0501035_0014583_912_1574 219
332 3300049822 Ga0501035_0073287 Ga0501035_0073287_162_821 219
333 3300049823 Ga0501044_0200768 Ga0501044_0200768_636_1295 219
334 3300049823 Ga0501044_0274232 Ga0501044_0274232_307_969 219
335 3300000546 LJNas_1000181 LJNas_10001817 221
336 3300005290 Ga0065712_10283361 Ga0065712_102833612 221
337 3300005434 Ga0070709_10670819 Ga0070709_106708191 221
338 3300005445 Ga0070708_100317971 Ga0070708_1003179712 221
339 3300005467 Ga0070706_100072590 Ga0070706_1000725902 221
340 3300005467 Ga0070706_100093059 Ga0070706_1000930593 221
341 3300005471 Ga0070698_100006801 Ga0070698_10000680111 221
342 3300005937 Ga0081455_10000164 Ga0081455_1000016449 221
343 3300006178 Ga0075367_10071026 Ga0075367_100710263 221
344 3300006358 Ga0068871_100075602 Ga0068871_1000756022 221
345 3300006844 Ga0075428_100126452 Ga0075428_1001264521 221
346 3300009147 Ga0114129_10004936 Ga0114129_100049363 221
347 3300009148 Ga0105243_10129597 Ga0105243_101295972 221
348 3300009176 Ga0105242_10035847 Ga0105242_100358473 221
349 3300009988 Ga0105035_103140 Ga0105035_1031402 221
350 3300013104 Ga0157370_10219683 Ga0157370_102196832 221
351 3300013105 Ga0157369_10784832 Ga0157369_107848321 221
352 3300013306 Ga0163162_10001365 Ga0163162_1000136514 221
353 3300021361 Ga0213872_10008275 Ga0213872_100082753 221
354 3300025909 Ga0207705_10000016 Ga0207705_1000001665 221
355 3300025910 Ga0207684_10065433 Ga0207684_100654332 221
356 3300025910 Ga0207684_10244196 Ga0207684_102441962 221
357 3300025922 Ga0207646_10226958 Ga0207646_102269581 221
358 3300025934 Ga0207686_10101552 Ga0207686_101015522 221
359 3300027671 Ga0209588_1057081 Ga0209588_10570811 221
360 3300027866 Ga0209813_10039400 Ga0209813_100394002 221
361 3300031090 Ga0265760_10163082 Ga0265760_101630821 221
362 3300037466 Ga0395898_0017696 Ga0395898_0017696_5453_6127 221
363 3300046472 Ga0495580_0224099 Ga0495580_0224099_590_1255 221
364 3300046474 Ga0495605_0144261 Ga0495605_0144261_213_878 221
365 3300046499 Ga0495594_0001920 Ga0495594_0001920_8014_8679 221
366 3300046501 Ga0495607_0212889 Ga0495607_0212889_220_885 221
367 3300046518 Ga0495631_0146715 Ga0495631_0146715_113_778 221
368 3300046523 Ga0495644_0000348 Ga0495644_0000348_19680_20345 221
369 3300046528 Ga0495642_0045960 Ga0495642_0045960_231_896 221
370 3300046684 Ga0495669_0036809 Ga0495669_0036809_841_1506 221
371 3300048904 Ga0496101_0589274 Ga0496101_0589274_34_714 221
372 3300048905 Ga0496102_0724548 Ga0496102_0724548_10_735 221
373 3300048911 Ga0496108_0244459 Ga0496108_0244459_852_1532 221
374 3300048929 Ga0496126_0000018 Ga0496126_0000018_478819_479484 221
375 3300048929 Ga0496126_0111131 Ga0496126_0111131_791_1480 221
376 3300048929 Ga0496126_0134076 Ga0496126_0134076_977_1648 221
377 3300050490 nmdc:mga03n38_62384_c1 nmdc:mga03n38_62384_c1_935_1615 221
378 3300050492 nmdc:mga0yw44_99546_c1 nmdc:mga0yw44_99546_c1_1033_1713 221
379 3300050493 nmdc:mga0k408_341747_c1 nmdc:mga0k408_341747_c1_196_876 221
380 3300050494 nmdc:mga06z11_46568_c1 nmdc:mga06z11_46568_c1_406_1086 221
381 3300050495 nmdc:mga04h51_22942_c1 nmdc:mga04h51_22942_c1_366_1046 221
382 3300050507 nmdc:mga05p37_27657_c1 nmdc:mga05p37_27657_c1_3095_3766 221
383 3300050510 nmdc:mga06r32_22133_c1 nmdc:mga06r32_22133_c1_4339_5010 221
384 iso_pu_bacteria 2849076700 2849078032 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

69

189

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.845 16 219
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8369 16 219
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.808 16 219
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7444 16 219
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7378 16 219
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8904 20 177 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8646 20 177 1.10.3210.10
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.6187 23 184 1.10.3210.50
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6148 25 152 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5975 27 162 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A6P3C0E7-F1-model_v4 deleted 1.001 10 118
AF-A0A8B4XTV5-F1-model_v4 deleted 1 12 161
AF-A0A7V8JKF7-F1-model_v4 HD domain-containing protein 0.9971 10 112
AF-A0A1I5G940-F1-model_v4 HD domain-containing protein 0.9841 10 182
AF-A0A069P2D5-F1-model_v4 Phosphohydrolase 0.9817 42 140 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.1 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map