F429600

General Info

Members Datasets Scaffolds Average Seq Length
383 219 766 327

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10245178|Ga0163163_102451782
Length 354
Sequence MMFIGTSKETVMKFRSFLKAGLVVFVLLFLVSGTVLADKGGPGTSTGTGQVFFPNPVASLQNQSLTDQKDANYPALQPAYKIVTLTNLDGSGYLQGDWANIRGETGNPAFSNTNTFVYTRDDDRFEQVMAYYWVTEAQLYIQSLGFGSTLRPINMESQDIRINQYGIDNSFSWDKHDLLRFGKGGVDDAEDAEVILHEYGHAIQDSQMVPLGFGTSVEAGSIGEGFGDYFAVTVSNVIAPTPDPACVADWDSISYTPGPVHCLRRVDQNLQYPEDLNGRVHHDGQIWSRALWDIRNALGHVKADTIILEAQFQFAPDTNMPDAAQATVNAAQSLYGIAEANAVLAAFQARGILP

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
161 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2643221679 Angustibacter sp. Root456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 5.48
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10245178 3300014325 Bacteria 1842
2 SwRhRL2b_contig_717764 2162886007 Bacteria 11334
3 JGI24743J22301_10002155 3300001991 Bacteria 2910
4 JGI24738J21930_10004097 3300002075 Bacteria 3599
5 rootL2_10369902 3300003322 Bacteria 1158
6 Ga0065707_10089613 3300005295 Bacteria 4321
7 Ga0065707_10091579 3300005295 Bacteria 3913
8 Ga0065707_10131305 3300005295 Bacteria 1842
9 Ga0070658_10001535 3300005327 Bacteria 19566
10 Ga0070658_10011891 3300005327 Bacteria 6988
11 Ga0070676_10262256 3300005328 Bacteria 1157
12 Ga0070690_100067659 3300005330 Bacteria 2315
13 Ga0070690_100071621 3300005330 Bacteria 2252
14 Ga0070690_100215817 3300005330 Unclassified 1342
15 Ga0070670_100000534 3300005331 Bacteria 30436
16 Ga0070670_100027662 3300005331 Bacteria 4878
17 Ga0070670_100044566 3300005331 Bacteria 3814
18 Ga0070677_10011998 3300005333 Bacteria 2998
19 Ga0068869_100004766 3300005334 Bacteria 8468
20 Ga0068869_100021396 3300005334 Bacteria 4449
21 Ga0070680_100035961 3300005336 Bacteria 4000
22 Ga0070682_100005461 3300005337 Bacteria 7078
23 Ga0068868_100022448 3300005338 Bacteria 4762
24 Ga0068868_100235212 3300005338 Bacteria 1538
25 Ga0070660_100000698 3300005339 Bacteria 22262
26 Ga0070689_100091532 3300005340 Bacteria 2398
27 Ga0070691_10003586 3300005341 Bacteria 7008
28 Ga0070661_100005869 3300005344 Bacteria 8445
29 Ga0070661_100347895 3300005344 Bacteria 1162
30 Ga0070669_100090332 3300005353 Bacteria 2295
31 Ga0070669_100120924 3300005353 Bacteria 1998
32 Ga0070675_100005213 3300005354 Bacteria 9916
33 Ga0070675_100005705 3300005354 Bacteria 9526
34 Ga0070675_100023723 3300005354 Bacteria 4908
35 Ga0070675_100034014 3300005354 Bacteria 4134
36 Ga0070671_100012013 3300005355 Bacteria 6965
37 Ga0070674_100047276 3300005356 Bacteria 2947
38 Ga0070673_100017260 3300005364 Bacteria 5126
39 Ga0070673_100042518 3300005364 Bacteria 3504
40 Ga0070673_100050754 3300005364 Bacteria 3245
41 Ga0070667_100160150 3300005367 Bacteria 1982
42 Ga0070701_10065938 3300005438 Bacteria 1923
43 Ga0070705_100001324 3300005440 Bacteria 13235
44 Ga0070705_100016322 3300005440 Bacteria 3858
45 Ga0070705_100047109 3300005440 Bacteria 2490
46 Ga0070705_100174311 3300005440 Bacteria 1451
47 Ga0070700_100001111 3300005441 Bacteria 13314
48 Ga0070700_100029039 3300005441 Bacteria 3294
49 Ga0070700_100106539 3300005441 Bacteria 1856
50 Ga0070694_100002945 3300005444 Bacteria 10119
51 Ga0070694_100017768 3300005444 Bacteria 4497
52 Ga0070663_100062300 3300005455 Bacteria 2688
53 Ga0070663_100134748 3300005455 Bacteria 1879
54 Ga0070678_100035619 3300005456 Bacteria 3477
55 Ga0070678_100071066 3300005456 Bacteria 2604
56 Ga0070678_100103641 3300005456 Bacteria 2211
57 Ga0070681_10097660 3300005458 Bacteria 2884
58 Ga0068867_100005629 3300005459 Bacteria 8877
59 Ga0068867_100015526 3300005459 Bacteria 5401
60 Ga0070706_100141550 3300005467 Bacteria 2245
61 Ga0070707_100226187 3300005468 Bacteria 1822
62 Ga0070698_100005342 3300005471 Bacteria 14056
63 Ga0070698_100091789 3300005471 Unclassified 3018
64 Ga0070698_100115875 3300005471 Bacteria 2643
65 Ga0070698_100136838 3300005471 Bacteria 2403
66 Ga0070699_100015111 3300005518 Bacteria 6632
67 Ga0070679_100128038 3300005530 Bacteria 2520
68 Ga0070684_100010657 3300005535 Bacteria 7291
69 Ga0070684_100331454 3300005535 Bacteria 1399
70 Ga0068853_100003236 3300005539 Bacteria 12445
71 Ga0070672_100006052 3300005543 Bacteria 8084
72 Ga0070672_100195566 3300005543 Bacteria 1690
73 Ga0070686_100097625 3300005544 Bacteria 1978
74 Ga0070695_100023409 3300005545 Bacteria 3796
75 Ga0070695_100026271 3300005545 Bacteria 3601
76 Ga0070695_100124538 3300005545 Unclassified 1768
77 Ga0070696_100002809 3300005546 Bacteria 11563
78 Ga0070696_100024032 3300005546 Bacteria 4142
79 Ga0070696_100152400 3300005546 Bacteria 1698
80 Ga0070665_100015712 3300005548 Bacteria 7606
81 Ga0070704_100010075 3300005549 Bacteria 5744
82 Ga0070704_100079862 3300005549 Bacteria 2404
83 Ga0068855_100158585 3300005563 Bacteria 2569
84 Ga0070664_100078528 3300005564 Bacteria 2839
85 Ga0068857_100001285 3300005577 Bacteria 19722
86 Ga0068857_100080769 3300005577 Bacteria 2903
87 Ga0068857_100081072 3300005577 Bacteria 2898
88 Ga0068854_100003497 3300005578 Bacteria 9811
89 Ga0068854_100038765 3300005578 Bacteria 3353
90 Ga0068854_100056984 3300005578 Bacteria 2818
91 Ga0068854_100124165 3300005578 Bacteria 1964
92 Ga0070702_100011588 3300005615 Bacteria 4390
93 Ga0070702_100012458 3300005615 Bacteria 4262
94 Ga0070702_100015643 3300005615 Bacteria 3878
95 Ga0068852_100048734 3300005616 Bacteria 3621
96 Ga0068859_100126424 3300005617 Bacteria 2626
97 Ga0068859_100526381 3300005617 Unclassified 1277
98 Ga0068864_100354360 3300005618 Bacteria 1385
99 Ga0068866_10019130 3300005718 Bacteria 3111
100 Ga0068861_100010174 3300005719 Bacteria 6526
101 Ga0068861_100047647 3300005719 Bacteria 3236
102 Ga0068861_100089079 3300005719 Bacteria 2432
103 Ga0068861_100098798 3300005719 Bacteria 2317
104 Ga0068851_10010740 3300005834 Bacteria 4279
105 Ga0068851_10018576 3300005834 Bacteria 3350
106 Ga0068870_10000590 3300005840 Bacteria 13802
107 Ga0068870_10201112 3300005840 Unclassified 1208
108 Ga0068863_100003970 3300005841 Bacteria 14609
109 Ga0068863_100096177 3300005841 Bacteria 2811
110 Ga0068858_100013453 3300005842 Bacteria 7720
111 Ga0068860_100082232 3300005843 Bacteria 3063
112 Ga0081455_10016318 3300005937 Bacteria 7176
113 Ga0081455_10018744 3300005937 Bacteria 6569
114 Ga0081455_10022642 3300005937 Bacteria 5866
115 Ga0081455_10023817 3300005937 Bacteria 5688
116 Ga0075365_10110965 3300006038 Bacteria 1885
117 Ga0097621_100131582 3300006237 Bacteria 2130
118 Ga0068871_100026316 3300006358 Bacteria 4537
119 Ga0068871_100083796 3300006358 Bacteria 2645
120 Ga0068871_100208155 3300006358 Bacteria 1691
121 Ga0075428_100031678 3300006844 Bacteria 5842
122 Ga0075428_100067465 3300006844 Bacteria 3915
123 Ga0075428_100173669 3300006844 Bacteria 2335
124 Ga0075430_100004656 3300006846 Bacteria 11534
125 Ga0075430_100067509 3300006846 Bacteria 3002
126 Ga0075430_100227612 3300006846 Bacteria 1546
127 Ga0075431_100032156 3300006847 Bacteria 5407
128 Ga0075431_100179370 3300006847 Unclassified 2174
129 Ga0075431_100280584 3300006847 Bacteria 1687
130 Ga0075433_10002639 3300006852 Bacteria 13688
131 Ga0075433_10016683 3300006852 Bacteria 6061
132 Ga0075433_10122751 3300006852 Bacteria 2307
133 Ga0075434_100221173 3300006871 Bacteria 1913
134 Ga0075429_100001970 3300006880 Bacteria 17071
135 Ga0075429_100007893 3300006880 Bacteria 9246
136 Ga0075429_100071934 3300006880 Bacteria 3012
137 Ga0075429_100132951 3300006880 Unclassified 2177
138 Ga0068865_100018592 3300006881 Bacteria 4487
139 Ga0068865_100031041 3300006881 Bacteria 3559
140 Ga0068865_100297468 3300006881 Bacteria 1290
141 Ga0097620_100126425 3300006931 Bacteria 2626
142 Ga0097620_100526318 3300006931 Unclassified 1277
143 Ga0075435_100000516 3300007076 Bacteria 23622
144 Ga0075435_100194953 3300007076 Bacteria 1715
145 Ga0075435_100211479 3300007076 Bacteria 1646
146 Ga0105240_10174434 3300009093 Bacteria 2543
147 Ga0111539_10002085 3300009094 Bacteria 26719
148 Ga0111539_10013208 3300009094 Bacteria 10324
149 Ga0111539_10287587 3300009094 Bacteria 1913
150 Ga0105245_10005665 3300009098 Bacteria 10974
151 Ga0105247_10100500 3300009101 Unclassified 1849
152 Ga0114129_10001171 3300009147 Bacteria 34782
153 Ga0114129_10001275 3300009147 Bacteria 33647
154 Ga0114129_10017114 3300009147 Bacteria 10324
155 Ga0114129_10085923 3300009147 Bacteria 4364
156 Ga0114129_10148175 3300009147 Bacteria 3213
157 Ga0114129_10565040 3300009147 Unclassified 1478
158 Ga0105243_10005349 3300009148 Bacteria 10019
159 Ga0105243_10016404 3300009148 Bacteria 5603
160 Ga0105242_10011433 3300009176 Bacteria 6824
161 Ga0105242_10015753 3300009176 Bacteria 5873
162 Ga0105242_10048076 3300009176 Bacteria 3466
163 Ga0105242_10120468 3300009176 Bacteria 2251
164 Ga0105248_10357731 3300009177 Bacteria 1644
165 Ga0105238_10009482 3300009551 Bacteria 9741
166 Ga0105238_10154116 3300009551 Bacteria 2272
167 Ga0105249_10100744 3300009553 Bacteria 2716
168 Ga0105249_10260296 3300009553 Bacteria 1724
169 Ga0105239_10023443 3300010375 Bacteria 6797
170 Ga0105239_10550168 3300010375 Bacteria 1314
171 Ga0105246_10102401 3300011119 Bacteria 2088
172 Ga0105246_10122257 3300011119 Unclassified 1931
173 Ga0105246_10160026 3300011119 Bacteria 1714
174 Ga0105246_10216475 3300011119 Bacteria 1498
175 Ga0157371_10107137 3300013102 Bacteria 1983
176 Ga0157371_10357908 3300013102 Bacteria 1063
177 Ga0157374_10053628 3300013296 Bacteria 3759
178 Ga0157378_10004807 3300013297 Bacteria 11837
179 Ga0163162_10073244 3300013306 Bacteria 3481
180 Ga0157372_10299016 3300013307 Bacteria 1872
181 Ga0157375_10006384 3300013308 Bacteria 10276
182 Ga0157375_10015835 3300013308 Bacteria 6757
183 Ga0157375_10164831 3300013308 Bacteria 2360
184 Ga0157375_10308815 3300013308 Bacteria 1746
185 Ga0163163_10004894 3300014325 Bacteria 11518
186 Ga0163163_10110788 3300014325 Bacteria 2773
187 Ga0157377_10000714 3300014745 Bacteria 13734
188 Ga0207697_10041302 3300025315 Bacteria 1894
189 Ga0207642_10014940 3300025899 Bacteria 2880
190 Ga0207688_10035480 3300025901 Bacteria 2763
191 Ga0207645_10001597 3300025907 Bacteria 18466
192 Ga0207643_10192088 3300025908 Bacteria 1240
193 Ga0207705_10003499 3300025909 Bacteria 11954
194 Ga0207684_10196127 3300025910 Bacteria 1742
195 Ga0207684_10373542 3300025910 Bacteria 1227
196 Ga0207707_10076949 3300025912 Bacteria 2912
197 Ga0207695_10108024 3300025913 Bacteria 2767
198 Ga0207660_10151618 3300025917 Bacteria 1781
199 Ga0207662_10017743 3300025918 Bacteria 4029
200 Ga0207662_10083089 3300025918 Bacteria 1957
201 Ga0207652_10132668 3300025921 Bacteria 2222
202 Ga0207646_10094400 3300025922 Bacteria 2679
203 Ga0207681_10037776 3300025923 Bacteria 3194
204 Ga0207681_10107195 3300025923 Bacteria 2026
205 Ga0207681_10183525 3300025923 Bacteria 1595
206 Ga0207694_10017974 3300025924 Bacteria 5344
207 Ga0207650_10005271 3300025925 Bacteria 8819
208 Ga0207650_10162130 3300025925 Bacteria 1772
209 Ga0207650_10197380 3300025925 Bacteria 1610
210 Ga0207650_10326765 3300025925 Bacteria 1257
211 Ga0207659_10003761 3300025926 Bacteria 9150
212 Ga0207659_10006745 3300025926 Bacteria 7054
213 Ga0207659_10065258 3300025926 Bacteria 2637
214 Ga0207687_10012549 3300025927 Bacteria 5535
215 Ga0207690_10014212 3300025932 Bacteria 4804
216 Ga0207706_10021785 3300025933 Bacteria 5752
217 Ga0207706_10024682 3300025933 Bacteria 5388
218 Ga0207686_10002151 3300025934 Bacteria 10843
219 Ga0207686_10099656 3300025934 Bacteria 1937
220 Ga0207709_10018317 3300025935 Bacteria 3920
221 Ga0207709_10089620 3300025935 Bacteria 2006
222 Ga0207670_10057482 3300025936 Bacteria 2638
223 Ga0207669_10010759 3300025937 Bacteria 4418
224 Ga0207669_10087707 3300025937 Bacteria 2016
225 Ga0207669_10111667 3300025937 Bacteria 1833
226 Ga0207704_10031081 3300025938 Bacteria 3002
227 Ga0207704_10105343 3300025938 Bacteria 1891
228 Ga0207711_10294129 3300025941 Bacteria 1497
229 Ga0207689_10002769 3300025942 Bacteria 16206
230 Ga0207689_10013881 3300025942 Bacteria 6861
231 Ga0207689_10085593 3300025942 Bacteria 2591
232 Ga0207679_10356541 3300025945 Bacteria 1276
233 Ga0207667_10143549 3300025949 Bacteria 2457
234 Ga0207651_10039413 3300025960 Bacteria 3115
235 Ga0207651_10099621 3300025960 Bacteria 2153
236 Ga0207651_10162456 3300025960 Bacteria 1752
237 Ga0207640_10067420 3300025981 Bacteria 2395
238 Ga0207640_10070715 3300025981 Bacteria 2348
239 Ga0207640_10270587 3300025981 Bacteria 1329
240 Ga0207658_10246212 3300025986 Bacteria 1517
241 Ga0207703_10008060 3300026035 Bacteria 8326
242 Ga0207639_10016679 3300026041 Bacteria 5202
243 Ga0207678_10015209 3300026067 Bacteria 6769
244 Ga0207678_10172145 3300026067 Bacteria 1849
245 Ga0207708_10004481 3300026075 Bacteria 10292
246 Ga0207708_10007479 3300026075 Bacteria 8073
247 Ga0207702_10029255 3300026078 Bacteria 4584
248 Ga0207641_10183391 3300026088 Bacteria 1918
249 Ga0207648_10009414 3300026089 Bacteria 9359
250 Ga0207674_10033917 3300026116 Bacteria 5340
251 Ga0207674_10053968 3300026116 Bacteria 4094
252 Ga0207674_10322684 3300026116 Bacteria 1494
253 Ga0207675_100005349 3300026118 Bacteria 12329
254 Ga0207675_100012350 3300026118 Bacteria 7978
255 Ga0207683_10002189 3300026121 Bacteria 17181
256 Ga0207683_10024257 3300026121 Bacteria 5222
257 Ga0207683_10024838 3300026121 Bacteria 5163
258 Ga0207683_10061964 3300026121 Bacteria 3293
259 Ga0207683_10086589 3300026121 Bacteria 2785
260 Ga0207698_10024972 3300026142 Bacteria 4201
261 Ga0209983_1014258 3300027665 Bacteria 1637
262 Ga0209971_1000176 3300027682 Bacteria 19073
263 Ga0209998_10000057 3300027717 Bacteria 46425
264 Ga0209974_10004407 3300027876 Bacteria 5007
265 Ga0209974_10050821 3300027876 Bacteria 1393
266 Ga0207428_10044967 3300027907 Bacteria 3560
267 Ga0268266_10131733 3300028379 Bacteria 2237
268 Ga0268265_10083387 3300028380 Bacteria 2531
269 Ga0268264_10226515 3300028381 Bacteria 1724
270 Ga0307405_10128398 3300031731 Bacteria 1747
271 Ga0307413_10019017 3300031824 Bacteria 3618
272 Ga0307410_10040352 3300031852 Bacteria 3071
273 Ga0307406_10123333 3300031901 Bacteria 1805
274 Ga0307407_10018499 3300031903 Bacteria 3525
275 Ga0307407_10248011 3300031903 Bacteria 1218
276 Ga0307412_10087532 3300031911 Bacteria 2170
277 Ga0307412_10168390 3300031911 Bacteria 1636
278 Ga0307409_100247550 3300031995 Bacteria 1627
279 Ga0307416_100016099 3300032002 Bacteria 5184
280 Ga0307416_100503058 3300032002 Bacteria 1276
281 Ga0307414_10129834 3300032004 Bacteria 1954
282 Ga0307411_10013969 3300032005 Bacteria 4453
283 Ga0307411_10076148 3300032005 Bacteria 2293
284 Ga0373947_0012323 3300035725 Bacteria 4900
285 Ga0395899_0029818 3300037312 Bacteria 4104
286 Ga0395900_0039283 3300037418 Bacteria 4875
287 Ga0395898_0032746 3300037466 Bacteria 5189
288 Ga0395898_0254092 3300037466 Bacteria 1676
289 Ga0395901_0059943 3300038443 Bacteria 3959
290 Ga0395901_0127534 3300038443 Bacteria 2674
291 Ga0439439_0000348 3300041406 Bacteria 7515
292 Ga0439451_019340 3300042009 Bacteria 1373
293 Ga0439446_0001915 3300042156 Bacteria 4900
294 Ga0439434_0010710 3300042435 Bacteria 2705
295 Ga0439460_0063054 3300042461 Unclassified 1135
296 Ga0451577_0134441 3300042876 Bacteria 2220
297 Ga0453683_0028939 3300044673 Bacteria 3506
298 Ga0466965_0143688 3300044683 Bacteria 1244
299 Ga0453684_0030713 3300044712 Bacteria 7580
300 Ga0453684_0129335 3300044712 Bacteria 3032
301 Ga0453684_0173866 3300044712 Bacteria 2535
302 Ga0453684_0285488 3300044712 Unclassified 1881
303 Ga0451576_0075331 3300045051 Bacteria 3511
304 Ga0451576_0267281 3300045051 Bacteria 1788
305 Ga0451576_0348619 3300045051 Bacteria 1550
306 Ga0495603_0015308 3300046455 Bacteria 4641
307 Ga0495603_0040159 3300046455 Bacteria 2801
308 Ga0495629_0005503 3300046459 Bacteria 9458
309 Ga0495641_0106748 3300046461 Bacteria 1249
310 Ga0495582_0047887 3300046473 Bacteria 2354
311 Ga0495662_0165118 3300046476 Bacteria 1091
312 Ga0495594_0043360 3300046499 Bacteria 2466
313 Ga0495642_0102926 3300046528 Bacteria 1217
314 Ga0495587_0083142 3300046536 Bacteria 1855
315 Ga0495598_0031556 3300046537 Bacteria 1492
316 Ga0495621_0021858 3300046539 Bacteria 2114
317 Ga0495659_0030294 3300046664 Bacteria 1883
318 Ga0495658_0112181 3300046683 Bacteria 1640
319 Ga0495613_0170485 3300046689 Bacteria 1545
320 Ga0495604_0122480 3300047317 Bacteria 1881
321 Ga0496102_0059693 3300048905 Bacteria 3488
322 Ga0496103_0126935 3300048906 Bacteria 1627
323 Ga0496104_0240822 3300048907 Bacteria 1721
324 Ga0496104_0282072 3300048907 Bacteria 1574
325 Ga0496106_0031954 3300048909 Bacteria 3923
326 Ga0496108_0011480 3300048911 Bacteria 7200
327 Ga0496109_0019543 3300048912 Bacteria 5976
328 Ga0496109_0078307 3300048912 Bacteria 3044
329 Ga0496110_0003628 3300048913 Bacteria 11875
330 Ga0496110_0032497 3300048913 Bacteria 4507
331 Ga0496110_0365318 3300048913 Bacteria 1315
332 Ga0496110_0561556 3300048913 Bacteria 1037
333 Ga0496111_0000237 3300048914 Bacteria 26447
334 Ga0496111_0284062 3300048914 Bacteria 1227
335 Ga0496112_0041310 3300048915 Bacteria 4512
336 Ga0496112_0087488 3300048915 Bacteria 3083
337 Ga0496113_0029067 3300048916 Bacteria 3986
338 Ga0496114_0053397 3300048917 Bacteria 3369
339 Ga0496114_0112989 3300048917 Bacteria 2328
340 Ga0496114_0128032 3300048917 Bacteria 2190
341 Ga0496114_0310115 3300048917 Bacteria 1394
342 Ga0501031_0019241 3300049568 Bacteria 4446
343 Ga0501036_0183839 3300049572 Bacteria 1759
344 Ga0501036_0304042 3300049572 Bacteria 1334
345 Ga0501039_0107542 3300049575 Bacteria 2179
346 Ga0501042_0059727 3300049578 Bacteria 2723
347 Ga0501048_0048769 3300049582 Bacteria 3020
348 Ga0501067_0005255 3300049583 Bacteria 7196
349 Ga0501067_0085232 3300049583 Bacteria 1753
350 Ga0501069_0005842 3300049585 Bacteria 6409
351 Ga0501069_0042115 3300049585 Bacteria 2525
352 Ga0501072_0166380 3300049588 Bacteria 1759
353 Ga0501075_0123307 3300049591 Bacteria 1972
354 Ga0501076_0017328 3300049592 Bacteria 5473
355 Ga0501079_0119270 3300049741 Bacteria 2051
356 Ga0501081_0304088 3300049743 Bacteria 1170
357 nmdc:mga05p37_12435_c1 3300050507 Bacteria 7129
358 nmdc:mga05p37_561124_c1 3300050507 Unclassified 1297
359 nmdc:mga05p37_858_c1 3300050507 Bacteria 34211
360 nmdc:mga09592_109215_c1 3300050508 Bacteria 2373
361 nmdc:mga09592_273647_c1 3300050508 Unclassified 1465
362 nmdc:mga09592_61443_c1 3300050508 Bacteria 3178
363 nmdc:mga0qj67_130857_c1 3300050509 Bacteria 2032
364 nmdc:mga0qj67_33217_c1 3300050509 Bacteria 4026
365 nmdc:mga06r32_267544_c1 3300050510 Unclassified 1697
366 nmdc:mga06r32_6458_c1 3300050510 Bacteria 10535
367 nmdc:mga08y16_2936_c1 3300050511 Bacteria 17557
368 nmdc:mga08y16_30444_c1 3300050511 Bacteria 5681
369 nmdc:mga0n895_156370_c1 3300050512 Bacteria 2311
370 nmdc:mga0n895_22214_c1 3300050512 Bacteria 5948
371 nmdc:mga0n895_342133_c1 3300050512 Bacteria 1515
372 nmdc:mga0rr50_14089_c1 3300050513 Bacteria 5232
373 nmdc:mga0rr50_25868_c1 3300050513 Bacteria 4087
374 nmdc:mga0rr50_8428_c1 3300050513 Bacteria 5013
375 nmdc:mga0a205_115627_c1 3300050515 Bacteria 2581
376 nmdc:mga0a205_12761_c1 3300050515 Bacteria 7790
377 nmdc:mga0a205_127974_c1 3300050515 Unclassified 2440
378 nmdc:mga0a205_27911_c1 3300050515 Bacteria 5393
379 Ga0495612_0103885 3300053078 Bacteria 1212
380 Ga0501084_0236040 3300054114 Bacteria 1544
381 Ga0501082_0130795 3300060353 Bacteria 2178
382 Ga0530510_0355120 3300061734 Bacteria 1101
383 2644446326 2643221679 Bacteria 3839507
384 Ga0163163_10245178
385 SwRhRL2b_contig_717764
386 JGI24743J22301_10002155
387 JGI24738J21930_10004097
388 rootL2_10369902
389 Ga0065707_10089613
390 Ga0065707_10091579
391 Ga0065707_10131305
392 Ga0070658_10001535
393 Ga0070658_10011891
394 Ga0070676_10262256
395 Ga0070690_100067659
396 Ga0070690_100071621
397 Ga0070690_100215817
398 Ga0070670_100000534
399 Ga0070670_100027662
400 Ga0070670_100044566
401 Ga0070677_10011998
402 Ga0068869_100004766
403 Ga0068869_100021396
404 Ga0070680_100035961
405 Ga0070682_100005461
406 Ga0068868_100022448
407 Ga0068868_100235212
408 Ga0070660_100000698
409 Ga0070689_100091532
410 Ga0070691_10003586
411 Ga0070661_100005869
412 Ga0070661_100347895
413 Ga0070669_100090332
414 Ga0070669_100120924
415 Ga0070675_100005213
416 Ga0070675_100005705
417 Ga0070675_100023723
418 Ga0070675_100034014
419 Ga0070671_100012013
420 Ga0070674_100047276
421 Ga0070673_100017260
422 Ga0070673_100042518
423 Ga0070673_100050754
424 Ga0070667_100160150
425 Ga0070701_10065938
426 Ga0070705_100001324
427 Ga0070705_100016322
428 Ga0070705_100047109
429 Ga0070705_100174311
430 Ga0070700_100001111
431 Ga0070700_100029039
432 Ga0070700_100106539
433 Ga0070694_100002945
434 Ga0070694_100017768
435 Ga0070663_100062300
436 Ga0070663_100134748
437 Ga0070678_100035619
438 Ga0070678_100071066
439 Ga0070678_100103641
440 Ga0070681_10097660
441 Ga0068867_100005629
442 Ga0068867_100015526
443 Ga0070706_100141550
444 Ga0070707_100226187
445 Ga0070698_100005342
446 Ga0070698_100091789
447 Ga0070698_100115875
448 Ga0070698_100136838
449 Ga0070699_100015111
450 Ga0070679_100128038
451 Ga0070684_100010657
452 Ga0070684_100331454
453 Ga0068853_100003236
454 Ga0070672_100006052
455 Ga0070672_100195566
456 Ga0070686_100097625
457 Ga0070695_100023409
458 Ga0070695_100026271
459 Ga0070695_100124538
460 Ga0070696_100002809
461 Ga0070696_100024032
462 Ga0070696_100152400
463 Ga0070665_100015712
464 Ga0070704_100010075
465 Ga0070704_100079862
466 Ga0068855_100158585
467 Ga0070664_100078528
468 Ga0068857_100001285
469 Ga0068857_100080769
470 Ga0068857_100081072
471 Ga0068854_100003497
472 Ga0068854_100038765
473 Ga0068854_100056984
474 Ga0068854_100124165
475 Ga0070702_100011588
476 Ga0070702_100012458
477 Ga0070702_100015643
478 Ga0068852_100048734
479 Ga0068859_100126424
480 Ga0068859_100526381
481 Ga0068864_100354360
482 Ga0068866_10019130
483 Ga0068861_100010174
484 Ga0068861_100047647
485 Ga0068861_100089079
486 Ga0068861_100098798
487 Ga0068851_10010740
488 Ga0068851_10018576
489 Ga0068870_10000590
490 Ga0068870_10201112
491 Ga0068863_100003970
492 Ga0068863_100096177
493 Ga0068858_100013453
494 Ga0068860_100082232
495 Ga0081455_10016318
496 Ga0081455_10018744
497 Ga0081455_10022642
498 Ga0081455_10023817
499 Ga0075365_10110965
500 Ga0097621_100131582
501 Ga0068871_100026316
502 Ga0068871_100083796
503 Ga0068871_100208155
504 Ga0075428_100031678
505 Ga0075428_100067465
506 Ga0075428_100173669
507 Ga0075430_100004656
508 Ga0075430_100067509
509 Ga0075430_100227612
510 Ga0075431_100032156
511 Ga0075431_100179370
512 Ga0075431_100280584
513 Ga0075433_10002639
514 Ga0075433_10016683
515 Ga0075433_10122751
516 Ga0075434_100221173
517 Ga0075429_100001970
518 Ga0075429_100007893
519 Ga0075429_100071934
520 Ga0075429_100132951
521 Ga0068865_100018592
522 Ga0068865_100031041
523 Ga0068865_100297468
524 Ga0097620_100126425
525 Ga0097620_100526318
526 Ga0075435_100000516
527 Ga0075435_100194953
528 Ga0075435_100211479
529 Ga0105240_10174434
530 Ga0111539_10002085
531 Ga0111539_10013208
532 Ga0111539_10287587
533 Ga0105245_10005665
534 Ga0105247_10100500
535 Ga0114129_10001171
536 Ga0114129_10001275
537 Ga0114129_10017114
538 Ga0114129_10085923
539 Ga0114129_10148175
540 Ga0114129_10565040
541 Ga0105243_10005349
542 Ga0105243_10016404
543 Ga0105242_10011433
544 Ga0105242_10015753
545 Ga0105242_10048076
546 Ga0105242_10120468
547 Ga0105248_10357731
548 Ga0105238_10009482
549 Ga0105238_10154116
550 Ga0105249_10100744
551 Ga0105249_10260296
552 Ga0105239_10023443
553 Ga0105239_10550168
554 Ga0105246_10102401
555 Ga0105246_10122257
556 Ga0105246_10160026
557 Ga0105246_10216475
558 Ga0157371_10107137
559 Ga0157371_10357908
560 Ga0157374_10053628
561 Ga0157378_10004807
562 Ga0163162_10073244
563 Ga0157372_10299016
564 Ga0157375_10006384
565 Ga0157375_10015835
566 Ga0157375_10164831
567 Ga0157375_10308815
568 Ga0163163_10004894
569 Ga0163163_10110788
570 Ga0157377_10000714
571 Ga0207697_10041302
572 Ga0207642_10014940
573 Ga0207688_10035480
574 Ga0207645_10001597
575 Ga0207643_10192088
576 Ga0207705_10003499
577 Ga0207684_10196127
578 Ga0207684_10373542
579 Ga0207707_10076949
580 Ga0207695_10108024
581 Ga0207660_10151618
582 Ga0207662_10017743
583 Ga0207662_10083089
584 Ga0207652_10132668
585 Ga0207646_10094400
586 Ga0207681_10037776
587 Ga0207681_10107195
588 Ga0207681_10183525
589 Ga0207694_10017974
590 Ga0207650_10005271
591 Ga0207650_10162130
592 Ga0207650_10197380
593 Ga0207650_10326765
594 Ga0207659_10003761
595 Ga0207659_10006745
596 Ga0207659_10065258
597 Ga0207687_10012549
598 Ga0207690_10014212
599 Ga0207706_10021785
600 Ga0207706_10024682
601 Ga0207686_10002151
602 Ga0207686_10099656
603 Ga0207709_10018317
604 Ga0207709_10089620
605 Ga0207670_10057482
606 Ga0207669_10010759
607 Ga0207669_10087707
608 Ga0207669_10111667
609 Ga0207704_10031081
610 Ga0207704_10105343
611 Ga0207711_10294129
612 Ga0207689_10002769
613 Ga0207689_10013881
614 Ga0207689_10085593
615 Ga0207679_10356541
616 Ga0207667_10143549
617 Ga0207651_10039413
618 Ga0207651_10099621
619 Ga0207651_10162456
620 Ga0207640_10067420
621 Ga0207640_10070715
622 Ga0207640_10270587
623 Ga0207658_10246212
624 Ga0207703_10008060
625 Ga0207639_10016679
626 Ga0207678_10015209
627 Ga0207678_10172145
628 Ga0207708_10004481
629 Ga0207708_10007479
630 Ga0207702_10029255
631 Ga0207641_10183391
632 Ga0207648_10009414
633 Ga0207674_10033917
634 Ga0207674_10053968
635 Ga0207674_10322684
636 Ga0207675_100005349
637 Ga0207675_100012350
638 Ga0207683_10002189
639 Ga0207683_10024257
640 Ga0207683_10024838
641 Ga0207683_10061964
642 Ga0207683_10086589
643 Ga0207698_10024972
644 Ga0209983_1014258
645 Ga0209971_1000176
646 Ga0209998_10000057
647 Ga0209974_10004407
648 Ga0209974_10050821
649 Ga0207428_10044967
650 Ga0268266_10131733
651 Ga0268265_10083387
652 Ga0268264_10226515
653 Ga0307405_10128398
654 Ga0307413_10019017
655 Ga0307410_10040352
656 Ga0307406_10123333
657 Ga0307407_10018499
658 Ga0307407_10248011
659 Ga0307412_10087532
660 Ga0307412_10168390
661 Ga0307409_100247550
662 Ga0307416_100016099
663 Ga0307416_100503058
664 Ga0307414_10129834
665 Ga0307411_10013969
666 Ga0307411_10076148
667 Ga0373947_0012323
668 Ga0395899_0029818
669 Ga0395900_0039283
670 Ga0395898_0032746
671 Ga0395898_0254092
672 Ga0395901_0059943
673 Ga0395901_0127534
674 Ga0439439_0000348
675 Ga0439451_019340
676 Ga0439446_0001915
677 Ga0439434_0010710
678 Ga0439460_0063054
679 Ga0451577_0134441
680 Ga0453683_0028939
681 Ga0466965_0143688
682 Ga0453684_0030713
683 Ga0453684_0129335
684 Ga0453684_0173866
685 Ga0453684_0285488
686 Ga0451576_0075331
687 Ga0451576_0267281
688 Ga0451576_0348619
689 Ga0495603_0015308
690 Ga0495603_0040159
691 Ga0495629_0005503
692 Ga0495641_0106748
693 Ga0495582_0047887
694 Ga0495662_0165118
695 Ga0495594_0043360
696 Ga0495642_0102926
697 Ga0495587_0083142
698 Ga0495598_0031556
699 Ga0495621_0021858
700 Ga0495659_0030294
701 Ga0495658_0112181
702 Ga0495613_0170485
703 Ga0495604_0122480
704 Ga0496102_0059693
705 Ga0496103_0126935
706 Ga0496104_0240822
707 Ga0496104_0282072
708 Ga0496106_0031954
709 Ga0496108_0011480
710 Ga0496109_0019543
711 Ga0496109_0078307
712 Ga0496110_0003628
713 Ga0496110_0032497
714 Ga0496110_0365318
715 Ga0496110_0561556
716 Ga0496111_0000237
717 Ga0496111_0284062
718 Ga0496112_0041310
719 Ga0496112_0087488
720 Ga0496113_0029067
721 Ga0496114_0053397
722 Ga0496114_0112989
723 Ga0496114_0128032
724 Ga0496114_0310115
725 Ga0501031_0019241
726 Ga0501036_0183839
727 Ga0501036_0304042
728 Ga0501039_0107542
729 Ga0501042_0059727
730 Ga0501048_0048769
731 Ga0501067_0005255
732 Ga0501067_0085232
733 Ga0501069_0005842
734 Ga0501069_0042115
735 Ga0501072_0166380
736 Ga0501075_0123307
737 Ga0501076_0017328
738 Ga0501079_0119270
739 Ga0501081_0304088
740 nmdc:mga05p37_12435_c1
741 nmdc:mga05p37_561124_c1
742 nmdc:mga05p37_858_c1
743 nmdc:mga09592_109215_c1
744 nmdc:mga09592_273647_c1
745 nmdc:mga09592_61443_c1
746 nmdc:mga0qj67_130857_c1
747 nmdc:mga0qj67_33217_c1
748 nmdc:mga06r32_267544_c1
749 nmdc:mga06r32_6458_c1
750 nmdc:mga08y16_2936_c1
751 nmdc:mga08y16_30444_c1
752 nmdc:mga0n895_156370_c1
753 nmdc:mga0n895_22214_c1
754 nmdc:mga0n895_342133_c1
755 nmdc:mga0rr50_14089_c1
756 nmdc:mga0rr50_25868_c1
757 nmdc:mga0rr50_8428_c1
758 nmdc:mga0a205_115627_c1
759 nmdc:mga0a205_12761_c1
760 nmdc:mga0a205_127974_c1
761 nmdc:mga0a205_27911_c1
762 Ga0495612_0103885
763 Ga0501084_0236040
764 Ga0501082_0130795
765 Ga0530510_0355120
766 2644446326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02868

Peptidase_M4_C

Thermolysin metallopeptidase, alpha-helical domain

212

352

0.78

PF02128

Peptidase_M36

Fungalysin metallopeptidase (M36)

87

353

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a7g-assembly1.cif.gz_E on the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength 0.7746 69 339
7z6t-assembly1.cif.gz_AAA aspergillus clavatus m36 protease without the propeptide 0.749 70 343
4k90-assembly1.cif.gz_A extracellular metalloproteinase from aspergillus 0.7308 66 343
7qp3-assembly1.cif.gz_A pseudogymnoascus pannorum m36 protease without the propeptide 0.7276 66 343
2vqx-assembly1.cif.gz_A precursor of protealysin, metalloproteinase from serratia proteamaculans. 0.7264 88 341
ID Description Score Start End Superfamily
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8184 207 341 1.10.390.10
1bqbA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7931 201 340 1.10.390.10
1bqbA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7676 201 340 1.10.390.10
4k90A02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.681 204 343 1.10.390.10
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.667 207 341 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A077M453-F1-model_v4 Bacillolysin 0.9612 33 342 GO:0004222
GO:0006508
AF-A0A0S4LEC8-F1-model_v4 Putative Bacillolysin 0.9565 35 341 GO:0004222
GO:0005615
GO:0006508
GO:0008270
AF-A0A7Z1FV95-F1-model_v4 deleted 0.9552 35 342
AF-C2XTH3-F1-model_v4 Bacillolysin 0.955 35 342 GO:0004222
GO:0005615
GO:0006508
GO:0008270
AF-A0RDG4-F1-model_v4 deleted 0.9546 35 342

Map