F429533

General Info

Members Datasets Scaffolds Average Seq Length
383 231 375 209

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100005711|Ga0068858_1000057113
Length 232
Sequence MGFRATAAIIGYPVRMTDAPETTAPKTTRLSVFPLPGALLFPGMHLPLHIFEPRYRAMISDSMARDRRIGMIQPRPGPLTPGEAPALFTIGCVGRIAEFETSEDGRYNLVLEGIALFRILRELDVTTAFRQVEAELLPVRDEPEILSLSRRSSLEMESRRFADAQGYAVDWEAVNRLDDEALVNGIAQIAPFDVAAKQALLEANGIEDRAELIIQLMQFFGRHDGEESVTLQ

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
5 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
6 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
7 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
8 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
163 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
229 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 16.19
Nodule 0
Rhizoplane 3.66
Rhizosphere 72.06
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000023 3300001904 Bacteria 25735
2 JGI24752J21851_1000647 3300001976 Bacteria 4642
3 JGI24752J21851_1000649 3300001976 Bacteria 4637
4 JGI24740J21852_10030171 3300001979 Bacteria 1769
5 JGI24739J22299_10004650 3300001989 Bacteria 5249
6 JGI24739J22299_10029846 3300001989 Bacteria 1893
7 JGI24737J22298_10002290 3300001990 Bacteria 6807
8 JGI24750J21931_1000150 3300002070 Bacteria 11455
9 JGI24750J21931_1003965 3300002070 Bacteria 1783
10 JGI24748J21848_1000037 3300002074 Bacteria 72188
11 JGI24738J21930_10001522 3300002075 Bacteria 6409
12 JGI24749J21850_1001968 3300002076 Bacteria 2900
13 JGI24034J26672_10000024 3300002239 Bacteria 114754
14 JGI24034J26672_10000025 3300002239 Bacteria 110791
15 JGI24751J29686_10006785 3300002459 Bacteria 2333
16 JGI25165J46597_1000010 3300003214 Bacteria 442113
17 JGI25153J46596_10002609 3300003215 Bacteria 10308
18 JGI25153J46596_10011649 3300003215 Bacteria 3868
19 Ga0055537_1001357 3300003773 Bacteria 9869
20 Ga0055524_1000387 3300003775 Bacteria 37906
21 Ga0055530_10021267 3300003791 Bacteria 1916
22 Ga0055530_10021891 3300003791 Bacteria 1873
23 Ga0055531_10005489 3300003794 Bacteria 7418
24 Ga0065165_1004058 3300005262 Bacteria 9507
25 Ga0065165_1006425 3300005262 Bacteria 6168
26 Ga0065165_1031530 3300005262 Bacteria 1674
27 Ga0065704_10120183 3300005289 Bacteria 1777
28 Ga0065707_10000450 3300005295 Bacteria 70667
29 Ga0065707_10132676 3300005295 Bacteria 1894
30 Ga0065707_10221004 3300005295 Bacteria 1225
31 Ga0070658_10028226 3300005327 Bacteria 4505
32 Ga0070658_10069966 3300005327 Bacteria 2872
33 Ga0070690_100000202 3300005330 Bacteria 31141
34 Ga0070670_100000195 3300005331 Bacteria 56039
35 Ga0070670_100030625 3300005331 Bacteria 4633
36 Ga0070666_10000053 3300005335 Bacteria 97883
37 Ga0070666_10002955 3300005335 Bacteria 10299
38 Ga0070689_100009404 3300005340 Bacteria 6929
39 Ga0070668_100023355 3300005347 Bacteria 4677
40 Ga0070668_100228180 3300005347 Bacteria 1538
41 Ga0070669_100000008 3300005353 Bacteria 226764
42 Ga0070669_100000009 3300005353 Bacteria 224683
43 Ga0070671_100000010 3300005355 Bacteria 202799
44 Ga0070667_100001362 3300005367 Bacteria 21916
45 Ga0070667_100006048 3300005367 Bacteria 10053
46 Ga0070667_100278344 3300005367 Bacteria 1502
47 Ga0070705_100049695 3300005440 Bacteria 2436
48 Ga0070685_10001448 3300005466 Bacteria 12452
49 Ga0068853_100000256 3300005539 Bacteria 37353
50 Ga0068853_100027338 3300005539 Bacteria 4793
51 Ga0068853_100353428 3300005539 Bacteria 1367
52 Ga0068853_100750641 3300005539 Bacteria 932
53 Ga0070686_100000050 3300005544 Bacteria 97879
54 Ga0070665_100000004 3300005548 Bacteria 785500
55 Ga0070665_100234325 3300005548 Bacteria 1836
56 Ga0068855_100897505 3300005563 Bacteria 936
57 Ga0068857_100031466 3300005577 Bacteria 4689
58 Ga0068857_100235910 3300005577 Bacteria 1674
59 Ga0068854_100161321 3300005578 Bacteria 1736
60 Ga0068856_100817405 3300005614 Bacteria 951
61 Ga0068852_100196731 3300005616 Bacteria 1906
62 Ga0068859_100000396 3300005617 Bacteria 43397
63 Ga0068859_100002837 3300005617 Bacteria 17580
64 Ga0068859_100088092 3300005617 Bacteria 3153
65 Ga0068859_100185315 3300005617 Bacteria 2165
66 Ga0068864_100000189 3300005618 Bacteria 56038
67 Ga0068864_100000851 3300005618 Bacteria 25734
68 Ga0068864_100011199 3300005618 Bacteria 7412
69 Ga0068864_100028681 3300005618 Bacteria 4708
70 Ga0068861_100001538 3300005719 Bacteria 14628
71 Ga0068861_100004386 3300005719 Bacteria 9461
72 Ga0068863_100000010 3300005841 Bacteria 237758
73 Ga0068863_100000073 3300005841 Bacteria 110576
74 Ga0068863_100125707 3300005841 Bacteria 2446
75 Ga0068863_100587915 3300005841 Bacteria 1101
76 Ga0068858_100000268 3300005842 Bacteria 55747
77 Ga0068858_100004631 3300005842 Bacteria 13468
78 Ga0068858_100004934 3300005842 Bacteria 13074
79 Ga0068858_100005711 3300005842 Bacteria 12156
80 Ga0068858_100510974 3300005842 Bacteria 1161
81 Ga0068860_100000189 3300005843 Bacteria 97880
82 Ga0068860_100001052 3300005843 Bacteria 30421
83 Ga0068862_100000233 3300005844 Bacteria 62058
84 Ga0068862_100000334 3300005844 Bacteria 51308
85 Ga0068862_100000352 3300005844 Bacteria 49864
86 Ga0081455_10000212 3300005937 Bacteria 74448
87 Ga0081540_1075351 3300005983 Bacteria 1542
88 Ga0075368_10000034 3300006042 Bacteria 31979
89 Ga0097620_100000396 3300006931 Bacteria 43397
90 Ga0097620_100088095 3300006931 Bacteria 3153
91 Ga0097620_100185324 3300006931 Bacteria 2165
92 Ga0105251_10000468 3300009011 Bacteria 38504
93 Ga0105250_10043498 3300009092 Bacteria 1800
94 Ga0105245_10007068 3300009098 Bacteria 9847
95 Ga0105247_10001269 3300009101 Bacteria 18684
96 Ga0105247_10006001 3300009101 Bacteria 7567
97 Ga0105247_10065502 3300009101 Bacteria 2260
98 Ga0105243_10104087 3300009148 Bacteria 2362
99 Ga0105241_10177829 3300009174 Bacteria 1762
100 Ga0105248_10000026 3300009177 Bacteria 257155
101 Ga0105248_10002472 3300009177 Bacteria 20525
102 Ga0105248_10021003 3300009177 Bacteria 7235
103 Ga0105248_10249536 3300009177 Bacteria 1998
104 Ga0105237_10099952 3300009545 Bacteria 2892
105 Ga0105237_10258527 3300009545 Bacteria 1744
106 Ga0105238_10006048 3300009551 Bacteria 12001
107 Ga0105238_10705085 3300009551 Bacteria 1021
108 Ga0105249_10000157 3300009553 Bacteria 83216
109 Ga0105249_10000614 3300009553 Bacteria 32520
110 Ga0105249_10001016 3300009553 Bacteria 24808
111 Ga0105249_10152441 3300009553 Bacteria 2226
112 Ga0105239_10417583 3300010375 Bacteria 1519
113 Ga0105239_10449616 3300010375 Bacteria 1461
114 Ga0105239_10912066 3300010375 Bacteria 1009
115 Ga0157373_10126721 3300013100 Bacteria 1796
116 Ga0157373_10166013 3300013100 Bacteria 1553
117 Ga0157371_10032110 3300013102 Bacteria 3780
118 Ga0157370_10040725 3300013104 Bacteria 4485
119 Ga0157370_10335384 3300013104 Bacteria 1394
120 Ga0157369_10023012 3300013105 Bacteria 6946
121 Ga0157374_10215721 3300013296 Bacteria 1882
122 Ga0157378_10128408 3300013297 Bacteria 2344
123 Ga0157378_10167283 3300013297 Bacteria 2060
124 Ga0163162_10001763 3300013306 Bacteria 20278
125 Ga0163162_10010553 3300013306 Bacteria 8985
126 Ga0163162_10045865 3300013306 Bacteria 4380
127 Ga0163162_10510725 3300013306 Bacteria 1332
128 Ga0157372_10232057 3300013307 Bacteria 2140
129 Ga0157372_10656958 3300013307 Bacteria 1221
130 Ga0163163_10026993 3300014325 Bacteria 5494
131 Ga0163163_10094509 3300014325 Bacteria 3008
132 Ga0163163_10633232 3300014325 Bacteria 1133
133 Ga0157380_10000740 3300014326 Bacteria 20395
134 Ga0157380_10003622 3300014326 Bacteria 10622
135 Ga0157379_10019263 3300014968 Bacteria 6026
136 Ga0157379_10105600 3300014968 Bacteria 2528
137 Ga0183363_1015 3300015690 Bacteria 74376
138 Ga0163161_10000020 3300017792 Bacteria 214642
139 Ga0213876_10140805 3300021384 Bacteria 1283
140 Ga0213875_10010742 3300021388 Bacteria 4578
141 Ga0207672_1001261 3300025223 Bacteria 2127
142 Ga0209233_1000044 3300025261 Bacteria 489783
143 Ga0209565_1000029 3300025263 Bacteria 340335
144 Ga0209673_1004556 3300025273 Bacteria 7363
145 Ga0209675_1006164 3300025291 Bacteria 4874
146 Ga0209758_1002578 3300025297 Bacteria 18191
147 Ga0209050_1003344 3300025298 Bacteria 11952
148 Ga0209256_1000008 3300025299 Bacteria 975723
149 Ga0209257_1002893 3300025304 Bacteria 15944
150 Ga0207697_10000036 3300025315 Bacteria 49927
151 Ga0207697_10003102 3300025315 Bacteria 8315
152 Ga0207656_10017112 3300025321 Bacteria 2835
153 Ga0207656_10022035 3300025321 Bacteria 2552
154 Ga0207713_1051050 3300025735 Bacteria 1646
155 Ga0207710_10001449 3300025900 Bacteria 11812
156 Ga0207710_10002285 3300025900 Bacteria 8971
157 Ga0207710_10037271 3300025900 Bacteria 2147
158 Ga0207680_10000017 3300025903 Bacteria 97899
159 Ga0207680_10000044 3300025903 Bacteria 64236
160 Ga0207647_10001726 3300025904 Bacteria 16752
161 Ga0207705_10113943 3300025909 Bacteria 2000
162 Ga0207705_10144259 3300025909 Bacteria 1780
163 Ga0207654_10009517 3300025911 Bacteria 4937
164 Ga0207695_10005689 3300025913 Bacteria 16443
165 Ga0207695_10013250 3300025913 Bacteria 9838
166 Ga0207695_10194332 3300025913 Bacteria 1946
167 Ga0207671_10011973 3300025914 Bacteria 7013
168 Ga0207671_10172822 3300025914 Bacteria 1679
169 Ga0207649_10175727 3300025920 Bacteria 1495
170 Ga0207681_10000002 3300025923 Bacteria 985597
171 Ga0207681_10000020 3300025923 Bacteria 240498
172 Ga0207694_10001864 3300025924 Bacteria 17537
173 Ga0207694_10016124 3300025924 Bacteria 5638
174 Ga0207650_10000243 3300025925 Bacteria 59507
175 Ga0207650_10030983 3300025925 Bacteria 3859
176 Ga0207650_10060975 3300025925 Bacteria 2815
177 Ga0207687_10004631 3300025927 Bacteria 9149
178 Ga0207644_10000002 3300025931 Bacteria 942221
179 Ga0207644_10001497 3300025931 Bacteria 15046
180 Ga0207690_10133726 3300025932 Bacteria 1818
181 Ga0207706_10015588 3300025933 Bacteria 6865
182 Ga0207706_10024558 3300025933 Bacteria 5402
183 Ga0207709_10130641 3300025935 Bacteria 1711
184 Ga0207670_10032568 3300025936 Bacteria 3353
185 Ga0207691_10500283 3300025940 Bacteria 1032
186 Ga0207711_10000004 3300025941 Bacteria 870636
187 Ga0207711_10001647 3300025941 Bacteria 20601
188 Ga0207711_10016688 3300025941 Bacteria 6097
189 Ga0207711_10028452 3300025941 Bacteria 4703
190 Ga0207689_10246983 3300025942 Bacteria 1476
191 Ga0207667_10021852 3300025949 Bacteria 7081
192 Ga0207667_10171498 3300025949 Bacteria 2230
193 Ga0207667_10537985 3300025949 Bacteria 1182
194 Ga0207712_10000099 3300025961 Bacteria 97890
195 Ga0207712_10009203 3300025961 Bacteria 6255
196 Ga0207712_10020825 3300025961 Bacteria 4300
197 Ga0207712_10110554 3300025961 Bacteria 2060
198 Ga0207668_10001703 3300025972 Bacteria 12868
199 Ga0207668_10052293 3300025972 Bacteria 2825
200 Ga0207640_10019425 3300025981 Bacteria 4014
201 Ga0207640_10059035 3300025981 Bacteria 2530
202 Ga0207640_10091030 3300025981 Bacteria 2112
203 Ga0207658_10000393 3300025986 Bacteria 42203
204 Ga0207658_10000430 3300025986 Bacteria 39640
205 Ga0207658_10007810 3300025986 Bacteria 7285
206 Ga0207658_10506977 3300025986 Bacteria 1075
207 Ga0207703_10000139 3300026035 Bacteria 86495
208 Ga0207703_10001170 3300026035 Bacteria 24778
209 Ga0207703_10005752 3300026035 Bacteria 9934
210 Ga0207703_10015392 3300026035 Bacteria 5966
211 Ga0207639_10009382 3300026041 Bacteria 6747
212 Ga0207639_10060645 3300026041 Bacteria 2919
213 Ga0207639_10087207 3300026041 Bacteria 2487
214 Ga0207639_10099497 3300026041 Bacteria 2346
215 Ga0207702_10003500 3300026078 Bacteria 14313
216 Ga0207641_10000018 3300026088 Bacteria 298209
217 Ga0207641_10000171 3300026088 Bacteria 90550
218 Ga0207676_10000027 3300026095 Bacteria 245868
219 Ga0207676_10000072 3300026095 Bacteria 101978
220 Ga0207676_10000489 3300026095 Bacteria 33247
221 Ga0207676_10159644 3300026095 Bacteria 1951
222 Ga0207674_10018943 3300026116 Bacteria 7462
223 Ga0207674_10041501 3300026116 Bacteria 4759
224 Ga0207674_10095817 3300026116 Bacteria 2953
225 Ga0207674_10191484 3300026116 Bacteria 1995
226 Ga0207675_100002114 3300026118 Bacteria 19682
227 Ga0207675_100002191 3300026118 Bacteria 19409
228 Ga0207698_10001620 3300026142 Bacteria 13098
229 Ga0207698_10239998 3300026142 Bacteria 1651
230 Ga0209983_1009335 3300027665 Bacteria 2005
231 Ga0268266_10000009 3300028379 Bacteria 1097737
232 Ga0268266_10191093 3300028379 Bacteria 1869
233 Ga0268265_10000097 3300028380 Bacteria 110755
234 Ga0268265_10000187 3300028380 Bacteria 73568
235 Ga0268265_10002184 3300028380 Bacteria 15120
236 Ga0268264_10000010 3300028381 Bacteria 596543
237 Ga0268264_10000023 3300028381 Bacteria 471408
238 Ga0307517_10112412 3300028786 Bacteria 2063
239 Ga0307515_10306351 3300028794 Bacteria 1268
240 Ga0307513_10024219 3300031456 Bacteria 7067
241 Ga0307513_10153468 3300031456 Bacteria 2207
242 Ga0307509_10143135 3300031507 Bacteria 2322
243 Ga0307508_10000011 3300031616 Bacteria 248001
244 Ga0307508_10100659 3300031616 Bacteria 2485
245 Ga0307516_10189408 3300031730 Bacteria 1784
246 Ga0307405_10150071 3300031731 Bacteria 1637
247 Ga0307412_10005910 3300031911 Bacteria 6895
248 Ga0307412_10183105 3300031911 Bacteria 1577
249 Ga0307416_100188246 3300032002 Bacteria 1943
250 Ga0307414_10033629 3300032004 Bacteria 3391
251 Ga0307510_10001394 3300033180 Bacteria 26509
252 Ga0395905_0364069 3300037471 Bacteria 1339
253 Ga0436364_0693360 3300037853 Bacteria 4902
254 Ga0237819_00130 3300038705 Bacteria 28324
255 Ga0237816_00594 3300039145 Bacteria 3065
256 Ga0436365_1644582 3300039437 Bacteria 1650
257 Ga0439439_0092210 3300041406 Bacteria 828
258 Ga0439439_0121913 3300041406 Bacteria 727
259 Ga0439461_0012277 3300041410 Bacteria 1600
260 Ga0439465_0027445 3300041413 Bacteria 1803
261 Ga0451793_0601646 3300041452 Bacteria 1079
262 Ga0451807_1216956 3300041486 Bacteria 1223
263 Ga0439431_0014061 3300041997 Bacteria 1852
264 Ga0439442_045605 3300042002 Bacteria 924
265 Ga0439445_0014555 3300042004 Bacteria 1916
266 Ga0439432_027662 3300042006 Bacteria 1850
267 Ga0439457_015269 3300042014 Bacteria 1716
268 Ga0439462_0000151 3300042015 Bacteria 11324
269 Ga0450923_127079 3300042125 Bacteria 605
270 Ga0450910_031374 3300042147 Bacteria 835
271 Ga0450909_002516 3300042185 Bacteria 2598
272 Ga0439434_0011832 3300042435 Bacteria 2580
273 Ga0453684_0233710 3300044712 Bacteria 2121
274 Ga0466970_0177110 3300044765 Bacteria 1183
275 Ga0495585_0180727 3300046492 Bacteria 1084
276 Ga0495607_0011146 3300046501 Bacteria 6003
277 Ga0495583_0005113 3300046506 Bacteria 9037
278 Ga0495643_0032966 3300046522 Bacteria 2870
279 Ga0495648_0006183 3300046524 Bacteria 9811
280 Ga0495663_0010901 3300046525 Bacteria 2528
281 Ga0495663_0012850 3300046525 Bacteria 2337
282 Ga0495666_0181713 3300046526 Bacteria 971
283 Ga0495654_0021598 3300046530 Bacteria 3347
284 Ga0495622_0166984 3300046557 Bacteria 991
285 Ga0495668_0002162 3300046616 Bacteria 16877
286 Ga0495668_0138172 3300046616 Bacteria 1334
287 Ga0495625_0000094 3300046660 Bacteria 144517
288 Ga0495625_0002964 3300046660 Bacteria 17643
289 Ga0495625_0052870 3300046660 Bacteria 2907
290 Ga0495625_0063665 3300046660 Bacteria 2604
291 Ga0495625_0159161 3300046660 Bacteria 1514
292 Ga0495670_0000016 3300046691 Bacteria 128045
293 Ga0495670_0009870 3300046691 Bacteria 4696
294 Ga0495670_0044129 3300046691 Bacteria 2226
295 Ga0495671_0012219 3300046692 Bacteria 4694
296 Ga0495671_0097184 3300046692 Bacteria 1440
297 Ga0495589_0021219 3300046794 Bacteria 3320
298 Ga0495677_0004063 3300047445 Bacteria 5649
299 Ga0495681_0031995 3300047470 Bacteria 2653
300 Ga0496101_0098950 3300048904 Bacteria 2180
301 Ga0496101_0234266 3300048904 Bacteria 1428
302 Ga0496102_0052322 3300048905 Bacteria 3720
303 Ga0496103_0006677 3300048906 Bacteria 6885
304 Ga0496103_0022364 3300048906 Bacteria 3807
305 Ga0496103_0184428 3300048906 Bacteria 1341
306 Ga0496103_0667323 3300048906 Bacteria 660
307 Ga0496106_0089666 3300048909 Bacteria 2372
308 Ga0496106_0341243 3300048909 Bacteria 1203
309 Ga0496111_0193759 3300048914 Bacteria 1511
310 Ga0496115_0242557 3300048918 Bacteria 1485
311 Ga0496116_0209700 3300048919 Bacteria 1011
312 Ga0496117_0000535 3300048920 Bacteria 62454
313 Ga0496117_0006156 3300048920 Bacteria 12260
314 Ga0496118_0001906 3300048921 Bacteria 29700
315 Ga0496118_0002459 3300048921 Bacteria 24907
316 Ga0496119_0137734 3300048922 Bacteria 1322
317 Ga0496121_0000441 3300048924 Bacteria 82090
318 Ga0496121_0012164 3300048924 Bacteria 9442
319 Ga0496122_0314736 3300048925 Bacteria 836
320 Ga0496123_0001952 3300048926 Bacteria 26806
321 Ga0496124_0181559 3300048927 Bacteria 1619
322 Ga0496125_0127995 3300048928 Bacteria 1795
323 Ga0501034_0588850 3300049571 Bacteria 1019
324 Ga0501034_1078152 3300049571 Bacteria 685
325 Ga0501037_0096950 3300049573 Bacteria 2131
326 Ga0501043_0133456 3300049579 Bacteria 1946
327 Ga0501046_0197988 3300049580 Bacteria 1496
328 Ga0501047_0399109 3300049581 Bacteria 1208
329 Ga0501047_0467231 3300049581 Bacteria 1090
330 Ga0501241_027855 3300049758 Bacteria 1058
331 Ga0501035_0163776 3300049822 Bacteria 1924
332 Ga0501044_0274426 3300049823 Bacteria 1621
333 Ga0501044_1229863 3300049823 Bacteria 616
334 Ga0500643_000550 3300053087 Bacteria 26088
335 Ga0500643_002364 3300053087 Bacteria 9833
336 Ga0500643_006964 3300053087 Bacteria 4640
337 Ga0500643_015578 3300053087 Bacteria 2602
338 Ga0500643_019068 3300053087 Bacteria 2265
339 Ga0500643_024468 3300053087 Bacteria 1916
340 Ga0500643_084251 3300053087 Bacteria 871
341 Ga0500583_0166692 3300053092 Bacteria 1097
342 Ga0500641_0003973 3300053096 Bacteria 5230
343 Ga0500556_0085065 3300053104 Bacteria 1201
344 Ga0500562_082524 3300053108 Bacteria 870
345 Ga0500592_000427 3300053116 Bacteria 7038
346 Ga0500595_011043 3300053119 Bacteria 3557
347 Ga0500597_024404 3300053120 Bacteria 2427
348 Ga0500608_030827 3300053122 Bacteria 2543
349 Ga0500618_012816 3300053125 Bacteria 2185
350 Ga0500658_0000189 3300053134 Bacteria 29335
351 Ga0500658_0019168 3300053134 Bacteria 2572
352 Ga0500559_0000456 3300053136 Bacteria 29143
353 Ga0500559_0009597 3300053136 Bacteria 4180
354 Ga0500559_0231834 3300053136 Bacteria 870
355 Ga0500568_0009769 3300053139 Bacteria 4536
356 Ga0500568_0065343 3300053139 Bacteria 1401
357 Ga0500573_0000093 3300053140 Bacteria 40260
358 Ga0500577_0006170 3300053142 Bacteria 3285
359 Ga0500604_0030160 3300053151 Bacteria 1585
360 Ga0500616_0003849 3300053153 Bacteria 11090
361 Ga0500616_0011809 3300053153 Bacteria 5139
362 Ga0500622_0035776 3300053156 Bacteria 2598
363 Ga0500622_0094641 3300053156 Bacteria 1478
364 Ga0500624_000003 3300053157 Bacteria 253364
365 Ga0500624_000173 3300053157 Bacteria 25864
366 Ga0500627_0008001 3300053158 Bacteria 3727
367 Ga0500627_0061636 3300053158 Bacteria 1651
368 Ga0500638_313582 3300053162 Bacteria 599
369 Ga0500636_0007644 3300053177 Bacteria 6252
370 Ga0500636_0085124 3300053177 Bacteria 1817
371 Ga0500637_0000073 3300053178 Bacteria 35884
372 Ga0500611_000556 3300053727 Bacteria 3786
373 Ga0500645_005336 3300053730 Bacteria 4755
374 Ga0500645_129708 3300053730 Bacteria 701
375 Ga0500601_018981 3300053737 Bacteria 791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042125 Ga0450923_127079 Ga0450923_127079_11_523 169
2 3300053122 Ga0500608_030827 Ga0500608_030827_57_605 179
3 3300048906 Ga0496103_0667323 Ga0496103_0667323_12_572 184
4 3300049823 Ga0501044_1229863 Ga0501044_1229863_15_584 184
5 3300053120 Ga0500597_024404 Ga0500597_024404_882_1454 184
6 3300053157 Ga0500624_000003 Ga0500624_000003_65487_66059 184
7 3300053177 Ga0500636_0085124 Ga0500636_0085124_855_1502 184
8 3300053178 Ga0500637_0000073 Ga0500637_0000073_25849_26421 184
9 3300053162 Ga0500638_313582 Ga0500638_313582_24_584 186
10 3300046691 Ga0495670_0009870 Ga0495670_0009870_1417_2067 188
11 3300049571 Ga0501034_1078152 Ga0501034_1078152_11_616 196
12 iso_pu_bacteria 2830075706 2830076018 197
13 iso_pu_bacteria 2643221622 2644127446 198
14 3300013100 Ga0157373_10126721 Ga0157373_101267212 199
15 3300013102 Ga0157371_10032110 Ga0157371_100321103 199
16 3300013104 Ga0157370_10335384 Ga0157370_103353841 199
17 3300044712 Ga0453684_0233710 Ga0453684_0233710_70_672 199
18 3300053087 Ga0500643_084251 Ga0500643_084251_46_654 199
19 3300053104 Ga0500556_0085065 Ga0500556_0085065_73_681 199
20 3300053153 Ga0500616_0003849 Ga0500616_0003849_7484_8092 199
21 iso_pu_bacteria 2990265787 2990268164 199
22 iso_pu_bacteria 2993693658 2993696811 199
23 3300005262 Ga0065165_1031530 Ga0065165_10315302 200
24 3300049823 Ga0501044_0274426 Ga0501044_0274426_163_786 200
25 3300005262 Ga0065165_1006425 Ga0065165_10064253 201
26 3300005617 Ga0068859_100002837 Ga0068859_1000028379 201
27 3300005983 Ga0081540_1075351 Ga0081540_10753513 201
28 3300031616 Ga0307508_10100659 Ga0307508_101006592 201
29 3300031730 Ga0307516_10189408 Ga0307516_101894082 201
30 3300037471 Ga0395905_0364069 Ga0395905_0364069_447_1052 201
31 3300042147 Ga0450910_031374 Ga0450910_031374_74_709 201
32 3300049579 Ga0501043_0133456 Ga0501043_0133456_993_1601 201
33 3300049580 Ga0501046_0197988 Ga0501046_0197988_691_1317 201
34 3300049581 Ga0501047_0467231 Ga0501047_0467231_189_815 201
35 3300049822 Ga0501035_0163776 Ga0501035_0163776_191_817 201
36 3300053092 Ga0500583_0166692 Ga0500583_0166692_381_989 201
37 3300053140 Ga0500573_0000093 Ga0500573_0000093_27622_28230 201
38 3300053156 Ga0500622_0094641 Ga0500622_0094641_266_874 201
39 3300053730 Ga0500645_005336 Ga0500645_005336_1116_1727 201
40 iso_pu_bacteria 2885429604 2885432695 201
41 3300003215 JGI25153J46596_10002609 JGI25153J46596_1000260911 202
42 3300003215 JGI25153J46596_10011649 JGI25153J46596_100116495 202
43 3300003773 Ga0055537_1001357 Ga0055537_10013577 202
44 3300003775 Ga0055524_1000387 Ga0055524_100038721 202
45 3300003791 Ga0055530_10021267 Ga0055530_100212672 202
46 3300003791 Ga0055530_10021891 Ga0055530_100218912 202
47 3300003794 Ga0055531_10005489 Ga0055531_100054893 202
48 3300005262 Ga0065165_1004058 Ga0065165_100405810 202
49 3300005539 Ga0068853_100027338 Ga0068853_1000273386 202
50 3300015690 Ga0183363_1015 Ga0183363_101558 202
51 3300025263 Ga0209565_1000029 Ga0209565_1000029225 202
52 3300025273 Ga0209673_1004556 Ga0209673_10045564 202
53 3300025291 Ga0209675_1006164 Ga0209675_10061647 202
54 3300025297 Ga0209758_1002578 Ga0209758_100257813 202
55 3300025298 Ga0209050_1003344 Ga0209050_100334412 202
56 3300025299 Ga0209256_1000008 Ga0209256_1000008833 202
57 3300025304 Ga0209257_1002893 Ga0209257_10028939 202
58 3300026041 Ga0207639_10060645 Ga0207639_100606452 202
59 3300027665 Ga0209983_1009335 Ga0209983_10093352 202
60 3300028786 Ga0307517_10112412 Ga0307517_101124123 202
61 3300028794 Ga0307515_10306351 Ga0307515_103063512 202
62 3300041406 Ga0439439_0092210 Ga0439439_0092210_168_779 202
63 3300041406 Ga0439439_0121913 Ga0439439_0121913_21_632 202
64 3300041410 Ga0439461_0012277 Ga0439461_0012277_678_1289 202
65 3300041413 Ga0439465_0027445 Ga0439465_0027445_360_971 202
66 3300041486 Ga0451807_1216956 Ga0451807_1216956_215_826 202
67 3300041997 Ga0439431_0014061 Ga0439431_0014061_149_760 202
68 3300042002 Ga0439442_045605 Ga0439442_045605_72_683 202
69 3300042004 Ga0439445_0014555 Ga0439445_0014555_1055_1666 202
70 3300042006 Ga0439432_027662 Ga0439432_027662_880_1491 202
71 3300042014 Ga0439457_015269 Ga0439457_015269_322_933 202
72 3300042015 Ga0439462_0000151 Ga0439462_0000151_151_762 202
73 3300042185 Ga0450909_002516 Ga0450909_002516_1771_2382 202
74 3300042435 Ga0439434_0011832 Ga0439434_0011832_949_1560 202
75 3300044765 Ga0466970_0177110 Ga0466970_0177110_513_1121 202
76 3300046501 Ga0495607_0011146 Ga0495607_0011146_4063_4677 202
77 3300046660 Ga0495625_0063665 Ga0495625_0063665_70_678 202
78 3300046691 Ga0495670_0000016 Ga0495670_0000016_58077_58685 202
79 3300047470 Ga0495681_0031995 Ga0495681_0031995_392_1003 202
80 3300048904 Ga0496101_0234266 Ga0496101_0234266_79_690 202
81 3300048926 Ga0496123_0001952 Ga0496123_0001952_22664_23275 202
82 3300049758 Ga0501241_027855 Ga0501241_027855_69_680 202
83 3300053087 Ga0500643_006964 Ga0500643_006964_3086_3697 202
84 3300053096 Ga0500641_0003973 Ga0500641_0003973_3655_4266 202
85 3300053108 Ga0500562_082524 Ga0500562_082524_231_839 202
86 3300053134 Ga0500658_0019168 Ga0500658_0019168_1072_1683 202
87 3300053139 Ga0500568_0009769 Ga0500568_0009769_3668_4279 202
88 3300006042 Ga0075368_10000034 Ga0075368_1000003414 203
89 3300014325 Ga0163163_10633232 Ga0163163_106332322 203
90 3300021384 Ga0213876_10140805 Ga0213876_101408052 203
91 3300025949 Ga0207667_10171498 Ga0207667_101714983 203
92 3300039437 Ga0436365_1644582 Ga0436365_1644582_432_1055 203
93 3300046524 Ga0495648_0006183 Ga0495648_0006183_2925_3539 203
94 3300046660 Ga0495625_0000094 Ga0495625_0000094_71536_72174 203
95 3300046691 Ga0495670_0044129 Ga0495670_0044129_611_1249 203
96 3300053134 Ga0500658_0000189 Ga0500658_0000189_5909_6547 203
97 3300053136 Ga0500559_0231834 Ga0500559_0231834_140_751 203
98 3300053139 Ga0500568_0065343 Ga0500568_0065343_654_1292 203
99 3300053153 Ga0500616_0011809 Ga0500616_0011809_2204_2842 203
100 3300005577 Ga0068857_100031466 Ga0068857_1000314664 204
101 3300026116 Ga0207674_10041501 Ga0207674_100415014 204
102 3300032004 Ga0307414_10033629 Ga0307414_100336293 204
103 3300046692 Ga0495671_0097184 Ga0495671_0097184_587_1204 204
104 3300049573 Ga0501037_0096950 Ga0501037_0096950_86_700 204
105 3300049581 Ga0501047_0399109 Ga0501047_0399109_526_1149 204
106 3300005327 Ga0070658_10069966 Ga0070658_100699662 205
107 3300005367 Ga0070667_100278344 Ga0070667_1002783442 205
108 3300005618 Ga0068864_100028681 Ga0068864_1000286813 205
109 3300005842 Ga0068858_100000268 Ga0068858_10000026836 205
110 3300009177 Ga0105248_10002472 Ga0105248_100024723 205
111 3300009553 Ga0105249_10152441 Ga0105249_101524412 205
112 3300013306 Ga0163162_10001763 Ga0163162_100017633 205
113 3300013306 Ga0163162_10510725 Ga0163162_105107252 205
114 3300013307 Ga0157372_10656958 Ga0157372_106569582 205
115 3300025315 Ga0207697_10003102 Ga0207697_100031023 205
116 3300025909 Ga0207705_10113943 Ga0207705_101139432 205
117 3300025941 Ga0207711_10001647 Ga0207711_100016473 205
118 3300025961 Ga0207712_10110554 Ga0207712_101105542 205
119 3300025986 Ga0207658_10506977 Ga0207658_105069772 205
120 3300026035 Ga0207703_10000139 Ga0207703_1000013965 205
121 3300026095 Ga0207676_10000072 Ga0207676_10000072110 205
122 3300031456 Ga0307513_10024219 Ga0307513_100242195 205
123 3300033180 Ga0307510_10001394 Ga0307510_1000139427 205
124 3300046506 Ga0495583_0005113 Ga0495583_0005113_7106_7735 205
125 3300046522 Ga0495643_0032966 Ga0495643_0032966_59_688 205
126 3300046660 Ga0495625_0002964 Ga0495625_0002964_3098_3727 205
127 3300047445 Ga0495677_0004063 Ga0495677_0004063_3082_3711 205
128 3300048919 Ga0496116_0209700 Ga0496116_0209700_176_802 205
129 3300048924 Ga0496121_0000441 Ga0496121_0000441_21993_22622 205
130 3300048924 Ga0496121_0012164 Ga0496121_0012164_3603_4250 205
131 3300048925 Ga0496122_0314736 Ga0496122_0314736_163_789 205
132 3300049571 Ga0501034_0588850 Ga0501034_0588850_254_883 205
133 3300053087 Ga0500643_000550 Ga0500643_000550_13364_13981 205
134 3300053136 Ga0500559_0009597 Ga0500559_0009597_1060_1689 205
135 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010118 206
136 3300005841 Ga0068863_100587915 Ga0068863_1005879152 206
137 3300005842 Ga0068858_100005711 Ga0068858_1000057113 206
138 3300009098 Ga0105245_10007068 Ga0105245_100070684 206
139 3300009148 Ga0105243_10104087 Ga0105243_101040873 206
140 3300009551 Ga0105238_10006048 Ga0105238_100060488 206
141 3300009551 Ga0105238_10705085 Ga0105238_107050852 206
142 3300010375 Ga0105239_10417583 Ga0105239_104175832 206
143 3300013296 Ga0157374_10215721 Ga0157374_102157212 206
144 3300013297 Ga0157378_10167283 Ga0157378_101672833 206
145 3300025261 Ga0209233_1000044 Ga0209233_1000044365 206
146 3300025913 Ga0207695_10013250 Ga0207695_100132504 206
147 3300025924 Ga0207694_10001864 Ga0207694_1000186413 206
148 3300025927 Ga0207687_10004631 Ga0207687_100046314 206
149 3300025935 Ga0207709_10130641 Ga0207709_101306413 206
150 3300025940 Ga0207691_10500283 Ga0207691_105002832 206
151 3300025942 Ga0207689_10246983 Ga0207689_102469833 206
152 3300025949 Ga0207667_10537985 Ga0207667_105379851 206
153 3300026035 Ga0207703_10001170 Ga0207703_100011703 206
154 3300026041 Ga0207639_10087207 Ga0207639_100872072 206
155 3300026116 Ga0207674_10191484 Ga0207674_101914842 206
156 3300031456 Ga0307513_10153468 Ga0307513_101534683 206
157 3300031507 Ga0307509_10143135 Ga0307509_101431353 206
158 3300031616 Ga0307508_10000011 Ga0307508_1000001129 206
159 3300031911 Ga0307412_10005910 Ga0307412_100059103 206
160 3300041452 Ga0451793_0601646 Ga0451793_0601646_252_890 206
161 3300046492 Ga0495585_0180727 Ga0495585_0180727_346_999 206
162 3300046526 Ga0495666_0181713 Ga0495666_0181713_10_663 206
163 3300046557 Ga0495622_0166984 Ga0495622_0166984_188_841 206
164 3300048918 Ga0496115_0242557 Ga0496115_0242557_50_703 206
165 3300053136 Ga0500559_0000456 Ga0500559_0000456_25860_26513 206
166 3300053156 Ga0500622_0035776 Ga0500622_0035776_954_1595 206
167 3300053737 Ga0500601_018981 Ga0500601_018981_68_766 206
168 iso_pu_bacteria 2599185354 2600203228 206
169 iso_pu_bacteria 2751185897 2753766755 206
170 iso_pu_bacteria 2946787523 2946790361 206
171 3300002070 JGI24750J21931_1003965 JGI24750J21931_10039651 207
172 3300005295 Ga0065707_10221004 Ga0065707_102210042 207
173 3300005335 Ga0070666_10002955 Ga0070666_100029552 207
174 3300005347 Ga0070668_100023355 Ga0070668_1000233553 207
175 3300005353 Ga0070669_100000008 Ga0070669_100000008120 207
176 3300005355 Ga0070671_100000010 Ga0070671_100000010151 207
177 3300005367 Ga0070667_100006048 Ga0070667_1000060488 207
178 3300005440 Ga0070705_100049695 Ga0070705_1000496952 207
179 3300005539 Ga0068853_100000256 Ga0068853_1000002563 207
180 3300005548 Ga0070665_100234325 Ga0070665_1002343252 207
181 3300005577 Ga0068857_100235910 Ga0068857_1002359102 207
182 3300005617 Ga0068859_100000396 Ga0068859_1000003968 207
183 3300005618 Ga0068864_100000851 Ga0068864_10000085112 207
184 3300005719 Ga0068861_100001538 Ga0068861_1000015384 207
185 3300005841 Ga0068863_100125707 Ga0068863_1001257073 207
186 3300005842 Ga0068858_100004631 Ga0068858_10000463111 207
187 3300005843 Ga0068860_100001052 Ga0068860_1000010524 207
188 3300005844 Ga0068862_100000334 Ga0068862_10000033417 207
189 3300006931 Ga0097620_100000396 Ga0097620_10000039633 207
190 3300009101 Ga0105247_10001269 Ga0105247_1000126914 207
191 3300009177 Ga0105248_10249536 Ga0105248_102495362 207
192 3300009553 Ga0105249_10001016 Ga0105249_1000101618 207
193 3300013306 Ga0163162_10045865 Ga0163162_100458654 207
194 3300014325 Ga0163163_10094509 Ga0163163_100945094 207
195 3300025315 Ga0207697_10000036 Ga0207697_100000363 207
196 3300025900 Ga0207710_10001449 Ga0207710_100014499 207
197 3300025903 Ga0207680_10000044 Ga0207680_100000449 207
198 3300025923 Ga0207681_10000002 Ga0207681_10000002213 207
199 3300025925 Ga0207650_10030983 Ga0207650_100309834 207
200 3300025931 Ga0207644_10000002 Ga0207644_10000002212 207
201 3300025941 Ga0207711_10016688 Ga0207711_100166882 207
202 3300025961 Ga0207712_10020825 Ga0207712_100208254 207
203 3300025972 Ga0207668_10001703 Ga0207668_100017032 207
204 3300025986 Ga0207658_10007810 Ga0207658_100078104 207
205 3300026035 Ga0207703_10005752 Ga0207703_100057528 207
206 3300026041 Ga0207639_10009382 Ga0207639_100093823 207
207 3300026095 Ga0207676_10000489 Ga0207676_1000048923 207
208 3300026116 Ga0207674_10095817 Ga0207674_100958172 207
209 3300026118 Ga0207675_100002191 Ga0207675_10000219112 207
210 3300028379 Ga0268266_10191093 Ga0268266_101910932 207
211 3300028380 Ga0268265_10002184 Ga0268265_100021844 207
212 3300028381 Ga0268264_10000010 Ga0268264_10000010430 207
213 3300046660 Ga0495625_0052870 Ga0495625_0052870_298_939 207
214 3300046692 Ga0495671_0012219 Ga0495671_0012219_2782_3423 207
215 3300048906 Ga0496103_0184428 Ga0496103_0184428_68_691 207
216 3300048909 Ga0496106_0341243 Ga0496106_0341243_129_752 207
217 3300053087 Ga0500643_019068 Ga0500643_019068_1336_1959 207
218 3300053119 Ga0500595_011043 Ga0500595_011043_272_907 207
219 3300053125 Ga0500618_012816 Ga0500618_012816_182_805 207
220 3300053142 Ga0500577_0006170 Ga0500577_0006170_1320_1955 207
221 3300053157 Ga0500624_000173 Ga0500624_000173_22191_22814 207
222 3300053177 Ga0500636_0007644 Ga0500636_0007644_847_1470 207
223 3300053730 Ga0500645_129708 Ga0500645_129708_13_651 207
224 3300021388 Ga0213875_10010742 Ga0213875_100107423 208
225 3300025321 Ga0207656_10017112 Ga0207656_100171124 208
226 3300037853 Ga0436364_0693360 Ga0436364_0693360_1459_2103 208
227 3300038705 Ga0237819_00130 Ga0237819_00130_22874_23530 208
228 3300039145 Ga0237816_00594 Ga0237816_00594_2168_2824 208
229 3300048928 Ga0496125_0127995 Ga0496125_0127995_1061_1738 208
230 3300053087 Ga0500643_002364 Ga0500643_002364_2810_3436 208
231 3300001904 JGI24736J21556_1000023 JGI24736J21556_100002314 209
232 3300001976 JGI24752J21851_1000647 JGI24752J21851_10006475 209
233 3300001976 JGI24752J21851_1000649 JGI24752J21851_10006493 209
234 3300001979 JGI24740J21852_10030171 JGI24740J21852_100301712 209
235 3300001989 JGI24739J22299_10004650 JGI24739J22299_100046506 209
236 3300001989 JGI24739J22299_10029846 JGI24739J22299_100298462 209
237 3300001990 JGI24737J22298_10002290 JGI24737J22298_100022902 209
238 3300002070 JGI24750J21931_1000150 JGI24750J21931_10001503 209
239 3300002074 JGI24748J21848_1000037 JGI24748J21848_100003748 209
240 3300002075 JGI24738J21930_10001522 JGI24738J21930_100015224 209
241 3300002076 JGI24749J21850_1001968 JGI24749J21850_10019683 209
242 3300002239 JGI24034J26672_10000024 JGI24034J26672_1000002470 209
243 3300002239 JGI24034J26672_10000025 JGI24034J26672_1000002533 209
244 3300002459 JGI24751J29686_10006785 JGI24751J29686_100067852 209
245 3300005289 Ga0065704_10120183 Ga0065704_101201832 209
246 3300005295 Ga0065707_10000450 Ga0065707_1000045019 209
247 3300005295 Ga0065707_10132676 Ga0065707_101326763 209
248 3300005327 Ga0070658_10028226 Ga0070658_100282264 209
249 3300005330 Ga0070690_100000202 Ga0070690_1000002028 209
250 3300005331 Ga0070670_100000195 Ga0070670_10000019541 209
251 3300005331 Ga0070670_100030625 Ga0070670_1000306254 209
252 3300005335 Ga0070666_10000053 Ga0070666_1000005321 209
253 3300005340 Ga0070689_100009404 Ga0070689_1000094043 209
254 3300005347 Ga0070668_100228180 Ga0070668_1002281802 209
255 3300005353 Ga0070669_100000009 Ga0070669_10000000934 209
256 3300005367 Ga0070667_100001362 Ga0070667_10000136210 209
257 3300005466 Ga0070685_10001448 Ga0070685_1000144810 209
258 3300005539 Ga0068853_100353428 Ga0068853_1003534283 209
259 3300005539 Ga0068853_100750641 Ga0068853_1007506411 209
260 3300005544 Ga0070686_100000050 Ga0070686_10000005021 209
261 3300005548 Ga0070665_100000004 Ga0070665_100000004298 209
262 3300005563 Ga0068855_100897505 Ga0068855_1008975052 209
263 3300005578 Ga0068854_100161321 Ga0068854_1001613212 209
264 3300005614 Ga0068856_100817405 Ga0068856_1008174052 209
265 3300005616 Ga0068852_100196731 Ga0068852_1001967312 209
266 3300005617 Ga0068859_100088092 Ga0068859_1000880923 209
267 3300005617 Ga0068859_100185315 Ga0068859_1001853153 209
268 3300005618 Ga0068864_100000189 Ga0068864_10000018941 209
269 3300005618 Ga0068864_100011199 Ga0068864_1000111992 209
270 3300005719 Ga0068861_100004386 Ga0068861_10000438611 209
271 3300005841 Ga0068863_100000010 Ga0068863_10000001060 209
272 3300005841 Ga0068863_100000073 Ga0068863_10000007318 209
273 3300005842 Ga0068858_100004934 Ga0068858_10000493414 209
274 3300005842 Ga0068858_100510974 Ga0068858_1005109743 209
275 3300005843 Ga0068860_100000189 Ga0068860_10000018922 209
276 3300005844 Ga0068862_100000233 Ga0068862_10000023319 209
277 3300005844 Ga0068862_100000352 Ga0068862_10000035216 209
278 3300005937 Ga0081455_10000212 Ga0081455_1000021218 209
279 3300006931 Ga0097620_100088095 Ga0097620_1000880953 209
280 3300006931 Ga0097620_100185324 Ga0097620_1001853243 209
281 3300009011 Ga0105251_10000468 Ga0105251_1000046833 209
282 3300009092 Ga0105250_10043498 Ga0105250_100434983 209
283 3300009101 Ga0105247_10006001 Ga0105247_100060013 209
284 3300009101 Ga0105247_10065502 Ga0105247_100655022 209
285 3300009174 Ga0105241_10177829 Ga0105241_101778292 209
286 3300009177 Ga0105248_10000026 Ga0105248_10000026246 209
287 3300009177 Ga0105248_10021003 Ga0105248_100210035 209
288 3300009545 Ga0105237_10099952 Ga0105237_100999522 209
289 3300009545 Ga0105237_10258527 Ga0105237_102585273 209
290 3300009553 Ga0105249_10000157 Ga0105249_1000015722 209
291 3300009553 Ga0105249_10000614 Ga0105249_100006149 209
292 3300010375 Ga0105239_10449616 Ga0105239_104496162 209
293 3300010375 Ga0105239_10912066 Ga0105239_109120662 209
294 3300013100 Ga0157373_10166013 Ga0157373_101660132 209
295 3300013104 Ga0157370_10040725 Ga0157370_100407254 209
296 3300013105 Ga0157369_10023012 Ga0157369_100230126 209
297 3300013297 Ga0157378_10128408 Ga0157378_101284083 209
298 3300013306 Ga0163162_10010553 Ga0163162_100105534 209
299 3300013307 Ga0157372_10232057 Ga0157372_102320572 209
300 3300014325 Ga0163163_10026993 Ga0163163_100269936 209
301 3300014326 Ga0157380_10000740 Ga0157380_100007405 209
302 3300014326 Ga0157380_10003622 Ga0157380_100036226 209
303 3300014968 Ga0157379_10019263 Ga0157379_100192635 209
304 3300014968 Ga0157379_10105600 Ga0157379_101056001 209
305 3300017792 Ga0163161_10000020 Ga0163161_10000020136 209
306 3300025223 Ga0207672_1001261 Ga0207672_10012613 209
307 3300025321 Ga0207656_10022035 Ga0207656_100220353 209
308 3300025735 Ga0207713_1051050 Ga0207713_10510503 209
309 3300025900 Ga0207710_10002285 Ga0207710_1000228512 209
310 3300025900 Ga0207710_10037271 Ga0207710_100372713 209
311 3300025903 Ga0207680_10000017 Ga0207680_1000001774 209
312 3300025904 Ga0207647_10001726 Ga0207647_1000172614 209
313 3300025909 Ga0207705_10144259 Ga0207705_101442593 209
314 3300025911 Ga0207654_10009517 Ga0207654_100095172 209
315 3300025913 Ga0207695_10005689 Ga0207695_1000568913 209
316 3300025913 Ga0207695_10194332 Ga0207695_101943323 209
317 3300025914 Ga0207671_10011973 Ga0207671_100119734 209
318 3300025914 Ga0207671_10172822 Ga0207671_101728222 209
319 3300025920 Ga0207649_10175727 Ga0207649_101757272 209
320 3300025923 Ga0207681_10000020 Ga0207681_1000002018 209
321 3300025924 Ga0207694_10016124 Ga0207694_100161245 209
322 3300025925 Ga0207650_10000243 Ga0207650_100002437 209
323 3300025925 Ga0207650_10060975 Ga0207650_100609753 209
324 3300025931 Ga0207644_10001497 Ga0207644_100014974 209
325 3300025932 Ga0207690_10133726 Ga0207690_101337262 209
326 3300025933 Ga0207706_10015588 Ga0207706_100155885 209
327 3300025933 Ga0207706_10024558 Ga0207706_100245585 209
328 3300025936 Ga0207670_10032568 Ga0207670_100325683 209
329 3300025941 Ga0207711_10000004 Ga0207711_10000004261 209
330 3300025941 Ga0207711_10028452 Ga0207711_100284524 209
331 3300025949 Ga0207667_10021852 Ga0207667_100218527 209
332 3300025961 Ga0207712_10000099 Ga0207712_1000009922 209
333 3300025961 Ga0207712_10009203 Ga0207712_100092034 209
334 3300025972 Ga0207668_10052293 Ga0207668_100522933 209
335 3300025981 Ga0207640_10019425 Ga0207640_100194253 209
336 3300025981 Ga0207640_10059035 Ga0207640_100590353 209
337 3300025981 Ga0207640_10091030 Ga0207640_100910303 209
338 3300025986 Ga0207658_10000393 Ga0207658_1000039325 209
339 3300025986 Ga0207658_10000430 Ga0207658_1000043013 209
340 3300026035 Ga0207703_10015392 Ga0207703_100153922 209
341 3300026041 Ga0207639_10099497 Ga0207639_100994973 209
342 3300026078 Ga0207702_10003500 Ga0207702_1000350011 209
343 3300026088 Ga0207641_10000018 Ga0207641_1000001896 209
344 3300026088 Ga0207641_10000171 Ga0207641_1000017165 209
345 3300026095 Ga0207676_10000027 Ga0207676_1000002741 209
346 3300026095 Ga0207676_10159644 Ga0207676_101596442 209
347 3300026116 Ga0207674_10018943 Ga0207674_100189439 209
348 3300026118 Ga0207675_100002114 Ga0207675_10000211412 209
349 3300026142 Ga0207698_10001620 Ga0207698_1000162012 209
350 3300026142 Ga0207698_10239998 Ga0207698_102399982 209
351 3300028379 Ga0268266_10000009 Ga0268266_10000009496 209
352 3300028380 Ga0268265_10000097 Ga0268265_1000009718 209
353 3300028380 Ga0268265_10000187 Ga0268265_1000018712 209
354 3300028381 Ga0268264_10000023 Ga0268264_10000023436 209
355 3300031731 Ga0307405_10150071 Ga0307405_101500712 209
356 3300031911 Ga0307412_10183105 Ga0307412_101831052 209
357 3300032002 Ga0307416_100188246 Ga0307416_1001882462 209
358 3300046525 Ga0495663_0010901 Ga0495663_0010901_1552_2181 209
359 3300046525 Ga0495663_0012850 Ga0495663_0012850_1279_1908 209
360 3300046530 Ga0495654_0021598 Ga0495654_0021598_504_1133 209
361 3300046616 Ga0495668_0002162 Ga0495668_0002162_1076_1705 209
362 3300046616 Ga0495668_0138172 Ga0495668_0138172_607_1236 209
363 3300046660 Ga0495625_0159161 Ga0495625_0159161_156_785 209
364 3300046794 Ga0495589_0021219 Ga0495589_0021219_2612_3241 209
365 3300048904 Ga0496101_0098950 Ga0496101_0098950_1246_1875 209
366 3300048905 Ga0496102_0052322 Ga0496102_0052322_654_1283 209
367 3300048906 Ga0496103_0006677 Ga0496103_0006677_5498_6127 209
368 3300048906 Ga0496103_0022364 Ga0496103_0022364_2205_2834 209
369 3300048909 Ga0496106_0089666 Ga0496106_0089666_757_1386 209
370 3300048914 Ga0496111_0193759 Ga0496111_0193759_46_675 209
371 3300048920 Ga0496117_0000535 Ga0496117_0000535_3435_4064 209
372 3300048920 Ga0496117_0006156 Ga0496117_0006156_2135_2764 209
373 3300048921 Ga0496118_0001906 Ga0496118_0001906_18816_19445 209
374 3300048921 Ga0496118_0002459 Ga0496118_0002459_21127_21756 209
375 3300048922 Ga0496119_0137734 Ga0496119_0137734_562_1191 209
376 3300048927 Ga0496124_0181559 Ga0496124_0181559_519_1148 209
377 3300053087 Ga0500643_015578 Ga0500643_015578_1011_1646 209
378 3300053087 Ga0500643_024468 Ga0500643_024468_895_1530 209
379 3300053116 Ga0500592_000427 Ga0500592_000427_3059_3688 209
380 3300053151 Ga0500604_0030160 Ga0500604_0030160_833_1462 209
381 3300053158 Ga0500627_0008001 Ga0500627_0008001_2719_3348 209
382 3300053158 Ga0500627_0061636 Ga0500627_0061636_10_639 209
383 3300053727 Ga0500611_000556 Ga0500611_000556_1119_1748 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

29

218

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.888 7 111
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8437 7 111
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8221 7 195
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8051 7 195
3ljc-assembly1.cif.gz_A crystal structure of lon n-terminal domain. 0.8031 6 199
ID Description Score Start End Superfamily
af_B4FM67_80_193_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9186 3 110 2.30.130.40
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9143 2 111 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.914 7 111 2.30.130.40
af_P96280_7_116_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9115 7 111 2.30.130.40
af_A0A0G2K313_628_728_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9065 9 111 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A2P7QUC0-F1-model_v4 ATP-dependent protease 0.9623 3 209 GO:0006508
GO:0008233
AF-A0A4R6FHJ8-F1-model_v4 deleted 0.9524 7 204
AF-A0A0S3F3L0-F1-model_v4 ATP-dependent protease 0.946 6 209 GO:0006508
GO:0008233
AF-A0A7Y3W5B0-F1-model_v4 Peptidase S16 0.9444 8 199
AF-A0A2E6X6L1-F1-model_v4 Peptidase S16 0.9392 8 202

Feature Viewer

pLDDT pTM Quality
90.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map