F429463

General Info

Members Datasets Scaffolds Average Seq Length
383 214 766 124

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10065199|JGI24739J22299_100651991
Length 128
Sequence MFSHMMVGSNDIPRSKRFYDALFGALGGKPALEDDKGRLVYLHNGGIFIVTPPIDGEPATHANGATIGFTMEGPEQADAWHKAGAAHGGTAIEDPPGVRQGGFGKLYLAYLRDPDGNKLCALHRLPTD

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
201 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
214 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.26
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 1.04
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10065199 3300001989 Bacteria 1143
2 JGI24747J21853_1004486 3300001978 Bacteria 1255
3 JGI24739J22299_10035468 3300001989 Bacteria 1690
4 JGI24737J22298_10000861 3300001990 Bacteria 10817
5 JGI24737J22298_10033624 3300001990 Bacteria 1592
6 JGI24743J22301_10017066 3300001991 Bacteria 1360
7 JGI24745J21846_1027397 3300002073 Bacteria 682
8 JGI24745J21846_1028307 3300002073 Bacteria 672
9 JGI24738J21930_10007147 3300002075 Bacteria 2587
10 JGI24738J21930_10099678 3300002075 Bacteria 620
11 JGI24744J21845_10009030 3300002077 Bacteria 2049
12 JGI24035J26624_1034728 3300002126 Bacteria 555
13 Ga0065704_10372753 3300005289 Bacteria 783
14 Ga0065712_10788071 3300005290 Bacteria 516
15 Ga0065715_10069005 3300005293 Bacteria 815
16 Ga0065715_10129719 3300005293 Bacteria 2040
17 Ga0065715_10147511 3300005293 Bacteria 1770
18 Ga0070658_10307067 3300005327 Bacteria 1353
19 Ga0070658_10910681 3300005327 Bacteria 765
20 Ga0070676_10118020 3300005328 Bacteria 1661
21 Ga0070676_10236195 3300005328 Bacteria 1214
22 Ga0070690_100457338 3300005330 Bacteria 948
23 Ga0070690_101308491 3300005330 Bacteria 581
24 Ga0070670_100040179 3300005331 Bacteria 4023
25 Ga0070670_100045693 3300005331 Bacteria 3765
26 Ga0070670_100508506 3300005331 Bacteria 1072
27 Ga0070670_101343283 3300005331 Bacteria 655
28 Ga0070677_10047123 3300005333 Bacteria 1727
29 Ga0070677_10176281 3300005333 Bacteria 1015
30 Ga0068869_100102762 3300005334 Bacteria 2164
31 Ga0070666_10099137 3300005335 Bacteria 2006
32 Ga0070680_100105864 3300005336 Bacteria 2338
33 Ga0070680_101164781 3300005336 Bacteria 666
34 Ga0070682_100613992 3300005337 Bacteria 861
35 Ga0070682_100949778 3300005337 Bacteria 710
36 Ga0070660_100003232 3300005339 Bacteria 11185
37 Ga0070660_100169968 3300005339 Bacteria 1760
38 Ga0070660_101361837 3300005339 Bacteria 603
39 Ga0070660_101366546 3300005339 Bacteria 601
40 Ga0070661_100119030 3300005344 Bacteria 1977
41 Ga0070661_100238811 3300005344 Bacteria 1399
42 Ga0070661_100274782 3300005344 Bacteria 1306
43 Ga0070668_100096678 3300005347 Bacteria 2335
44 Ga0070668_100133567 3300005347 Bacteria 1994
45 Ga0070668_100486016 3300005347 Bacteria 1067
46 Ga0070669_100460329 3300005353 Bacteria 1050
47 Ga0070669_100637843 3300005353 Bacteria 895
48 Ga0070675_100027757 3300005354 Bacteria 4551
49 Ga0070675_100074041 3300005354 Bacteria 2828
50 Ga0070675_100277161 3300005354 Bacteria 1473
51 Ga0070675_100308116 3300005354 Bacteria 1396
52 Ga0070671_100317008 3300005355 Bacteria 1328
53 Ga0070674_100090754 3300005356 Bacteria 2204
54 Ga0070674_100143303 3300005356 Bacteria 1796
55 Ga0070674_100427514 3300005356 Bacteria 1088
56 Ga0070673_100313397 3300005364 Bacteria 1384
57 Ga0070673_101388165 3300005364 Bacteria 661
58 Ga0070659_100014363 3300005366 Bacteria 5917
59 Ga0070659_100057706 3300005366 Bacteria 3062
60 Ga0070659_100119000 3300005366 Bacteria 2137
61 Ga0070659_100254697 3300005366 Bacteria 1455
62 Ga0070659_100409641 3300005366 Bacteria 1145
63 Ga0070659_100750281 3300005366 Bacteria 846
64 Ga0070659_101071648 3300005366 Bacteria 709
65 Ga0070659_101565514 3300005366 Bacteria 588
66 Ga0070667_100610137 3300005367 Bacteria 1006
67 Ga0070667_100869229 3300005367 Bacteria 839
68 Ga0070700_100783915 3300005441 Bacteria 766
69 Ga0070663_100107050 3300005455 Bacteria 2095
70 Ga0070663_100159875 3300005455 Bacteria 1733
71 Ga0070678_100116771 3300005456 Bacteria 2097
72 Ga0070678_100489116 3300005456 Bacteria 1084
73 Ga0070662_100072944 3300005457 Bacteria 2536
74 Ga0070662_100228487 3300005457 Bacteria 1488
75 Ga0070662_100694478 3300005457 Bacteria 860
76 Ga0070662_100795746 3300005457 Bacteria 804
77 Ga0070681_10151488 3300005458 Bacteria 2245
78 Ga0070681_10614401 3300005458 Bacteria 1001
79 Ga0070681_10880731 3300005458 Bacteria 813
80 Ga0070681_10913486 3300005458 Bacteria 796
81 Ga0070681_11140555 3300005458 Bacteria 701
82 Ga0068867_100637977 3300005459 Bacteria 933
83 Ga0070679_101157542 3300005530 Bacteria 718
84 Ga0068853_100381033 3300005539 Bacteria 1317
85 Ga0068853_100574857 3300005539 Bacteria 1069
86 Ga0068853_100996307 3300005539 Bacteria 806
87 Ga0070672_100091227 3300005543 Bacteria 2458
88 Ga0070672_100117494 3300005543 Bacteria 2174
89 Ga0070672_100382778 3300005543 Bacteria 1203
90 Ga0070695_101242856 3300005545 Bacteria 614
91 Ga0070696_100025312 3300005546 Bacteria 4034
92 Ga0070693_100108279 3300005547 Bacteria 1705
93 Ga0070665_100000144 3300005548 Bacteria 132302
94 Ga0068855_100262017 3300005563 Bacteria 1925
95 Ga0070664_100039687 3300005564 Bacteria 3967
96 Ga0070664_100132818 3300005564 Bacteria 2187
97 Ga0070664_101596123 3300005564 Bacteria 618
98 Ga0068857_101210189 3300005577 Bacteria 732
99 Ga0068854_101410163 3300005578 Bacteria 630
100 Ga0068854_101486425 3300005578 Bacteria 615
101 Ga0068854_101521737 3300005578 Bacteria 608
102 Ga0068854_102107441 3300005578 Bacteria 521
103 Ga0068852_100328806 3300005616 Bacteria 1487
104 Ga0068852_102347449 3300005616 Bacteria 554
105 Ga0068859_100022780 3300005617 Bacteria 6280
106 Ga0068859_100074257 3300005617 Bacteria 3439
107 Ga0068859_100464650 3300005617 Bacteria 1361
108 Ga0068859_101598877 3300005617 Bacteria 720
109 Ga0068859_102682186 3300005617 Bacteria 548
110 Ga0068864_100637246 3300005618 Bacteria 1037
111 Ga0068864_100919332 3300005618 Bacteria 865
112 Ga0068861_100096044 3300005719 Bacteria 2348
113 Ga0068861_102429657 3300005719 Bacteria 527
114 Ga0068870_10377569 3300005840 Bacteria 917
115 Ga0068863_100022543 3300005841 Bacteria 6013
116 Ga0068863_100899216 3300005841 Bacteria 886
117 Ga0068860_100006651 3300005843 Bacteria 11609
118 Ga0068862_100000201 3300005844 Bacteria 66112
119 Ga0068862_100585412 3300005844 Bacteria 1069
120 Ga0068862_100941016 3300005844 Bacteria 851
121 Ga0081539_10025492 3300005985 Bacteria 3806
122 Ga0075368_10000299 3300006042 Bacteria 14296
123 Ga0075363_100019346 3300006048 Bacteria 3404
124 Ga0075432_10344498 3300006058 Bacteria 630
125 Ga0075367_10000054 3300006178 Bacteria 27401
126 Ga0075366_10343380 3300006195 Bacteria 916
127 Ga0075370_10031568 3300006353 Bacteria 2958
128 Ga0068871_100506598 3300006358 Bacteria 1089
129 Ga0068871_100652622 3300006358 Bacteria 961
130 Ga0075433_10101142 3300006852 Bacteria 2552
131 Ga0075434_100673390 3300006871 Bacteria 1052
132 Ga0075434_101352628 3300006871 Bacteria 722
133 Ga0068865_100092469 3300006881 Bacteria 2198
134 Ga0075436_100591333 3300006914 Bacteria 817
135 Ga0097620_100022780 3300006931 Bacteria 6280
136 Ga0097620_100074259 3300006931 Bacteria 3439
137 Ga0097620_100464662 3300006931 Bacteria 1361
138 Ga0097620_101598632 3300006931 Bacteria 720
139 Ga0097620_102682307 3300006931 Bacteria 548
140 Ga0075435_100547751 3300007076 Bacteria 1002
141 Ga0105240_10290385 3300009093 Bacteria 1875
142 Ga0105245_10521658 3300009098 Bacteria 1207
143 Ga0105245_10585733 3300009098 Bacteria 1140
144 Ga0105247_10021636 3300009101 Bacteria 3871
145 Ga0105243_10141421 3300009148 Bacteria 2054
146 Ga0105243_11307000 3300009148 Bacteria 742
147 Ga0105241_10881259 3300009174 Bacteria 830
148 Ga0105242_10493586 3300009176 Bacteria 1163
149 Ga0105248_10203326 3300009177 Bacteria 2232
150 Ga0105238_10176417 3300009551 Bacteria 2114
151 Ga0105238_10421336 3300009551 Bacteria 1330
152 Ga0105249_10000350 3300009553 Bacteria 46331
153 Ga0105246_10473249 3300011119 Bacteria 1058
154 Ga0157373_10142581 3300013100 Bacteria 1685
155 Ga0157373_10156451 3300013100 Bacteria 1603
156 Ga0157373_10225512 3300013100 Bacteria 1323
157 Ga0157373_10701678 3300013100 Bacteria 741
158 Ga0157371_10448767 3300013102 Bacteria 948
159 Ga0157369_10017243 3300013105 Bacteria 8117
160 Ga0157374_10381652 3300013296 Bacteria 1404
161 Ga0157378_10130531 3300013297 Bacteria 2325
162 Ga0163162_11773131 3300013306 Bacteria 705
163 Ga0163162_13116058 3300013306 Bacteria 532
164 Ga0157372_10387653 3300013307 Bacteria 1628
165 Ga0157372_10887084 3300013307 Bacteria 1035
166 Ga0157375_11602823 3300013308 Bacteria 770
167 Ga0157380_10037690 3300014326 Bacteria 3747
168 Ga0157380_11883640 3300014326 Bacteria 658
169 Ga0157377_10165142 3300014745 Bacteria 1380
170 Ga0157377_11709836 3300014745 Bacteria 508
171 Ga0157376_10809493 3300014969 Bacteria 950
172 Ga0157376_10859365 3300014969 Bacteria 923
173 Ga0206354_11115621 3300020081 Bacteria 628
174 Ga0213872_10015733 3300021361 Bacteria 3515
175 Ga0207673_1026564 3300025290 Bacteria 794
176 Ga0207697_10016662 3300025315 Bacteria 3027
177 Ga0207697_10017851 3300025315 Bacteria 2913
178 Ga0207682_10000883 3300025893 Bacteria 13912
179 Ga0207682_10304442 3300025893 Bacteria 747
180 Ga0207642_10619647 3300025899 Bacteria 675
181 Ga0207710_10011000 3300025900 Bacteria 3812
182 Ga0207688_10008839 3300025901 Bacteria 5482
183 Ga0207688_10078715 3300025901 Bacteria 1879
184 Ga0207680_10188002 3300025903 Bacteria 1400
185 Ga0207647_10024227 3300025904 Bacteria 4003
186 Ga0207647_10047185 3300025904 Bacteria 2680
187 Ga0207645_10096206 3300025907 Bacteria 1907
188 Ga0207645_10403112 3300025907 Bacteria 920
189 Ga0207643_10187082 3300025908 Bacteria 1255
190 Ga0207705_10010152 3300025909 Bacteria 6852
191 Ga0207705_10014317 3300025909 Bacteria 5708
192 Ga0207705_11556159 3300025909 Bacteria 500
193 Ga0207707_10311824 3300025912 Bacteria 1359
194 Ga0207707_10564390 3300025912 Bacteria 966
195 Ga0207693_10772254 3300025915 Bacteria 742
196 Ga0207660_10061953 3300025917 Bacteria 2694
197 Ga0207660_10821553 3300025917 Bacteria 758
198 Ga0207662_10066291 3300025918 Bacteria 2175
199 Ga0207657_10001814 3300025919 Bacteria 23056
200 Ga0207657_10139646 3300025919 Bacteria 1980
201 Ga0207657_10609613 3300025919 Bacteria 851
202 Ga0207649_10198379 3300025920 Bacteria 1416
203 Ga0207649_10235911 3300025920 Bacteria 1310
204 Ga0207649_11197691 3300025920 Bacteria 600
205 Ga0207652_10798827 3300025921 Bacteria 838
206 Ga0207652_11087450 3300025921 Bacteria 700
207 Ga0207681_10007952 3300025923 Bacteria 6483
208 Ga0207681_10335257 3300025923 Bacteria 1207
209 Ga0207694_11801290 3300025924 Bacteria 514
210 Ga0207650_10016377 3300025925 Bacteria 5182
211 Ga0207650_10081872 3300025925 Bacteria 2449
212 Ga0207650_11133213 3300025925 Bacteria 666
213 Ga0207659_10034963 3300025926 Bacteria 3470
214 Ga0207659_10040023 3300025926 Bacteria 3274
215 Ga0207659_10298036 3300025926 Bacteria 1323
216 Ga0207659_10398298 3300025926 Bacteria 1151
217 Ga0207687_10266740 3300025927 Bacteria 1367
218 Ga0207690_10001188 3300025932 Bacteria 16448
219 Ga0207690_10023248 3300025932 Bacteria 3867
220 Ga0207690_10070261 3300025932 Bacteria 2411
221 Ga0207690_10285078 3300025932 Bacteria 1287
222 Ga0207690_10626779 3300025932 Bacteria 880
223 Ga0207690_11398284 3300025932 Bacteria 585
224 Ga0207706_10012557 3300025933 Bacteria 7713
225 Ga0207706_10016514 3300025933 Bacteria 6662
226 Ga0207706_10126074 3300025933 Bacteria 2252
227 Ga0207706_10178442 3300025933 Bacteria 1865
228 Ga0207706_10977649 3300025933 Bacteria 712
229 Ga0207686_10348009 3300025934 Bacteria 1115
230 Ga0207709_10368994 3300025935 Bacteria 1089
231 Ga0207709_10725641 3300025935 Bacteria 797
232 Ga0207670_10382724 3300025936 Bacteria 1121
233 Ga0207669_10190708 3300025937 Bacteria 1478
234 Ga0207669_10264453 3300025937 Bacteria 1288
235 Ga0207704_10249095 3300025938 Bacteria 1332
236 Ga0207691_10067282 3300025940 Bacteria 3239
237 Ga0207691_10106533 3300025940 Bacteria 2497
238 Ga0207691_10497232 3300025940 Bacteria 1036
239 Ga0207711_10621699 3300025941 Bacteria 1008
240 Ga0207689_10018881 3300025942 Bacteria 5815
241 Ga0207689_10271966 3300025942 Bacteria 1403
242 Ga0207661_11027930 3300025944 Bacteria 759
243 Ga0207679_10094617 3300025945 Bacteria 2320
244 Ga0207679_10242057 3300025945 Bacteria 1529
245 Ga0207679_10375534 3300025945 Bacteria 1245
246 Ga0207679_10533378 3300025945 Bacteria 1051
247 Ga0207667_10356900 3300025949 Bacteria 1491
248 Ga0207667_11002220 3300025949 Bacteria 823
249 Ga0207651_10165861 3300025960 Bacteria 1736
250 Ga0207651_11026686 3300025960 Bacteria 737
251 Ga0207712_10000299 3300025961 Bacteria 46419
252 Ga0207668_10700227 3300025972 Bacteria 890
253 Ga0207668_12164858 3300025972 Bacteria 500
254 Ga0207640_10111592 3300025981 Bacteria 1939
255 Ga0207640_10422607 3300025981 Bacteria 1091
256 Ga0207640_10758796 3300025981 Bacteria 837
257 Ga0207640_11901024 3300025981 Bacteria 539
258 Ga0207658_10770748 3300025986 Bacteria 872
259 Ga0207658_10937832 3300025986 Bacteria 789
260 Ga0207677_10509259 3300026023 Bacteria 1042
261 Ga0207703_10006101 3300026035 Bacteria 9641
262 Ga0207703_10230254 3300026035 Bacteria 1661
263 Ga0207639_10578433 3300026041 Bacteria 1034
264 Ga0207639_10706952 3300026041 Bacteria 935
265 Ga0207678_10034910 3300026067 Bacteria 4379
266 Ga0207678_10738956 3300026067 Bacteria 867
267 Ga0207708_10598484 3300026075 Bacteria 934
268 Ga0207708_10728306 3300026075 Bacteria 850
269 Ga0207702_10470241 3300026078 Bacteria 1222
270 Ga0207641_10026892 3300026088 Bacteria 4750
271 Ga0207641_10269263 3300026088 Bacteria 1598
272 Ga0207648_10074088 3300026089 Bacteria 2967
273 Ga0207648_11072216 3300026089 Bacteria 755
274 Ga0207674_10852131 3300026116 Bacteria 879
275 Ga0207674_11274532 3300026116 Bacteria 704
276 Ga0207675_100063446 3300026118 Bacteria 3452
277 Ga0207675_102012275 3300026118 Bacteria 595
278 Ga0207683_10016322 3300026121 Bacteria 6320
279 Ga0207683_10338370 3300026121 Bacteria 1380
280 Ga0207683_10348347 3300026121 Bacteria 1359
281 Ga0207698_10410901 3300026142 Bacteria 1296
282 Ga0209813_10000063 3300027866 Bacteria 43741
283 Ga0207428_10082057 3300027907 Bacteria 2517
284 Ga0268265_10000219 3300028380 Bacteria 66148
285 Ga0268265_10056491 3300028380 Bacteria 2986
286 Ga0268265_11750956 3300028380 Bacteria 627
287 Ga0268265_12520505 3300028380 Bacteria 520
288 Ga0268264_10000906 3300028381 Bacteria 31144
289 Ga0268264_10555927 3300028381 Bacteria 1126
290 Ga0307513_10479903 3300031456 Bacteria 963
291 Ga0307408_100178041 3300031548 Bacteria 1703
292 Ga0307408_102413809 3300031548 Bacteria 510
293 Ga0307405_10032646 3300031731 Bacteria 3079
294 Ga0307405_10326119 3300031731 Bacteria 1175
295 Ga0307413_11022045 3300031824 Bacteria 710
296 Ga0307410_10000933 3300031852 Bacteria 12527
297 Ga0307406_10746345 3300031901 Bacteria 821
298 Ga0307406_11679556 3300031901 Bacteria 562
299 Ga0307407_10048603 3300031903 Bacteria 2416
300 Ga0307412_10255184 3300031911 Bacteria 1364
301 Ga0307412_10565989 3300031911 Bacteria 957
302 Ga0307409_100025009 3300031995 Bacteria 4179
303 Ga0307416_100016114 3300032002 Bacteria 5182
304 Ga0307416_102124156 3300032002 Bacteria 663
305 Ga0307414_10020194 3300032004 Bacteria 4146
306 Ga0307411_10007910 3300032005 Bacteria 5464
307 Ga0307411_10924284 3300032005 Bacteria 776
308 Ga0373951_0147789 3300035091 Bacteria 657
309 Ga0373946_0081837 3300035171 Bacteria 1415
310 Ga0316574_0791534 3300035398 Bacteria 578
311 Ga0373935_0252646 3300035692 Bacteria 1234
312 Ga0373927_0053493 3300035695 Bacteria 2612
313 Ga0373947_0189277 3300035725 Bacteria 1342
314 Ga0395899_0276280 3300037312 Bacteria 1144
315 Ga0395899_0353971 3300037312 Bacteria 981
316 Ga0395899_0607240 3300037312 Bacteria 696
317 Ga0395900_0001044 3300037418 Bacteria 35504
318 Ga0395900_0120287 3300037418 Bacteria 2695
319 Ga0395900_0322942 3300037418 Bacteria 1523
320 Ga0395900_0551424 3300037418 Bacteria 1097
321 Ga0395900_0821846 3300037418 Bacteria 856
322 Ga0395900_1409058 3300037418 Bacteria 610
323 Ga0395900_1826778 3300037418 Bacteria 518
324 Ga0395898_0236425 3300037466 Bacteria 1742
325 Ga0395898_0264758 3300037466 Bacteria 1639
326 Ga0395898_0421926 3300037466 Bacteria 1271
327 Ga0395905_0001217 3300037471 Bacteria 32113
328 Ga0395905_0027217 3300037471 Bacteria 5392
329 Ga0395905_0048199 3300037471 Bacteria 3994
330 Ga0395905_0059074 3300037471 Bacteria 3585
331 Ga0395905_0308289 3300037471 Bacteria 1471
332 Ga0395905_0475800 3300037471 Bacteria 1148
333 Ga0395905_1606817 3300037471 Bacteria 555
334 Ga0395901_0020625 3300038443 Bacteria 6745
335 Ga0395901_0093469 3300038443 Bacteria 3149
336 Ga0395901_0150085 3300038443 Bacteria 2449
337 Ga0395901_0303563 3300038443 Bacteria 1655
338 Ga0395901_0420133 3300038443 Bacteria 1371
339 Ga0237819_00546 3300038705 Bacteria 12675
340 Ga0436361_0645163 3300039447 Bacteria 1803
341 Ga0439449_0084257 3300042007 Bacteria 1173
342 Ga0466961_0430931 3300044693 Bacteria 799
343 Ga0466957_0111677 3300044842 Bacteria 1734
344 Ga0466957_1048062 3300044842 Bacteria 587
345 Ga0466958_0389985 3300045836 Bacteria 898
346 Ga0466967_0760210 3300045976 Bacteria 961
347 Ga0495627_000478 3300046453 Bacteria 33914
348 Ga0495651_0872661 3300046462 Bacteria 552
349 Ga0495650_0055811 3300046471 Bacteria 1606
350 Ga0495648_0064339 3300046524 Bacteria 2161
351 Ga0495663_0093846 3300046525 Bacteria 981
352 Ga0495621_0053445 3300046539 Bacteria 1450
353 Ga0495633_0160863 3300046558 Bacteria 1036
354 Ga0495670_0136024 3300046691 Bacteria 1283
355 Ga0495604_0853784 3300047317 Bacteria 571
356 Ga0495672_0087676 3300047320 Bacteria 1718
357 Ga0495673_0105863 3300047469 Bacteria 1130
358 Ga0495686_0018836 3300047472 Bacteria 4623
359 Ga0495686_0319433 3300047472 Bacteria 851
360 Ga0496102_1552672 3300048905 Bacteria 580
361 Ga0496107_0237288 3300048910 Bacteria 1357
362 Ga0496109_0143789 3300048912 Bacteria 2231
363 Ga0496113_0446330 3300048916 Bacteria 1039
364 Ga0501034_0337184 3300049571 Bacteria 1438
365 Ga0501069_0049435 3300049585 Bacteria 2337
366 Ga0501070_0570300 3300049586 Bacteria 904
367 Ga0501074_0542787 3300049590 Bacteria 823
368 Ga0501268_029493 3300049765 Bacteria 986
369 Ga0501270_130894 3300049767 Bacteria 555
370 Ga0501044_1003111 3300049823 Bacteria 707
371 nmdc:mga03n38_438444_c1 3300050490 Bacteria 725
372 nmdc:mga0k408_374514_c1 3300050493 Bacteria 848
373 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
374 nmdc:mga04h51_180_c1 3300050495 Bacteria 17760
375 nmdc:mga07m45_80402_c1 3300050496 Bacteria 1861
376 nmdc:mga0n895_399763_c1 3300050512 Bacteria 1389
377 nmdc:mga0n895_642732_c1 3300050512 Bacteria 1060
378 nmdc:mga0rr50_1475511_c1 3300050513 Bacteria 575
379 nmdc:mga0a205_17186_c1 3300050515 Bacteria 6777
380 Ga0501082_0163131 3300060353 Bacteria 1937
381 Ga0466962_0070239 3300061719 Bacteria 1673
382 2512644717 2512564014 Bacteria 4639632
383 2919711687 2919709256 Bacteria 4318106
384 JGI24739J22299_10065199
385 JGI24747J21853_1004486
386 JGI24739J22299_10035468
387 JGI24737J22298_10000861
388 JGI24737J22298_10033624
389 JGI24743J22301_10017066
390 JGI24745J21846_1027397
391 JGI24745J21846_1028307
392 JGI24738J21930_10007147
393 JGI24738J21930_10099678
394 JGI24744J21845_10009030
395 JGI24035J26624_1034728
396 Ga0065704_10372753
397 Ga0065712_10788071
398 Ga0065715_10069005
399 Ga0065715_10129719
400 Ga0065715_10147511
401 Ga0070658_10307067
402 Ga0070658_10910681
403 Ga0070676_10118020
404 Ga0070676_10236195
405 Ga0070690_100457338
406 Ga0070690_101308491
407 Ga0070670_100040179
408 Ga0070670_100045693
409 Ga0070670_100508506
410 Ga0070670_101343283
411 Ga0070677_10047123
412 Ga0070677_10176281
413 Ga0068869_100102762
414 Ga0070666_10099137
415 Ga0070680_100105864
416 Ga0070680_101164781
417 Ga0070682_100613992
418 Ga0070682_100949778
419 Ga0070660_100003232
420 Ga0070660_100169968
421 Ga0070660_101361837
422 Ga0070660_101366546
423 Ga0070661_100119030
424 Ga0070661_100238811
425 Ga0070661_100274782
426 Ga0070668_100096678
427 Ga0070668_100133567
428 Ga0070668_100486016
429 Ga0070669_100460329
430 Ga0070669_100637843
431 Ga0070675_100027757
432 Ga0070675_100074041
433 Ga0070675_100277161
434 Ga0070675_100308116
435 Ga0070671_100317008
436 Ga0070674_100090754
437 Ga0070674_100143303
438 Ga0070674_100427514
439 Ga0070673_100313397
440 Ga0070673_101388165
441 Ga0070659_100014363
442 Ga0070659_100057706
443 Ga0070659_100119000
444 Ga0070659_100254697
445 Ga0070659_100409641
446 Ga0070659_100750281
447 Ga0070659_101071648
448 Ga0070659_101565514
449 Ga0070667_100610137
450 Ga0070667_100869229
451 Ga0070700_100783915
452 Ga0070663_100107050
453 Ga0070663_100159875
454 Ga0070678_100116771
455 Ga0070678_100489116
456 Ga0070662_100072944
457 Ga0070662_100228487
458 Ga0070662_100694478
459 Ga0070662_100795746
460 Ga0070681_10151488
461 Ga0070681_10614401
462 Ga0070681_10880731
463 Ga0070681_10913486
464 Ga0070681_11140555
465 Ga0068867_100637977
466 Ga0070679_101157542
467 Ga0068853_100381033
468 Ga0068853_100574857
469 Ga0068853_100996307
470 Ga0070672_100091227
471 Ga0070672_100117494
472 Ga0070672_100382778
473 Ga0070695_101242856
474 Ga0070696_100025312
475 Ga0070693_100108279
476 Ga0070665_100000144
477 Ga0068855_100262017
478 Ga0070664_100039687
479 Ga0070664_100132818
480 Ga0070664_101596123
481 Ga0068857_101210189
482 Ga0068854_101410163
483 Ga0068854_101486425
484 Ga0068854_101521737
485 Ga0068854_102107441
486 Ga0068852_100328806
487 Ga0068852_102347449
488 Ga0068859_100022780
489 Ga0068859_100074257
490 Ga0068859_100464650
491 Ga0068859_101598877
492 Ga0068859_102682186
493 Ga0068864_100637246
494 Ga0068864_100919332
495 Ga0068861_100096044
496 Ga0068861_102429657
497 Ga0068870_10377569
498 Ga0068863_100022543
499 Ga0068863_100899216
500 Ga0068860_100006651
501 Ga0068862_100000201
502 Ga0068862_100585412
503 Ga0068862_100941016
504 Ga0081539_10025492
505 Ga0075368_10000299
506 Ga0075363_100019346
507 Ga0075432_10344498
508 Ga0075367_10000054
509 Ga0075366_10343380
510 Ga0075370_10031568
511 Ga0068871_100506598
512 Ga0068871_100652622
513 Ga0075433_10101142
514 Ga0075434_100673390
515 Ga0075434_101352628
516 Ga0068865_100092469
517 Ga0075436_100591333
518 Ga0097620_100022780
519 Ga0097620_100074259
520 Ga0097620_100464662
521 Ga0097620_101598632
522 Ga0097620_102682307
523 Ga0075435_100547751
524 Ga0105240_10290385
525 Ga0105245_10521658
526 Ga0105245_10585733
527 Ga0105247_10021636
528 Ga0105243_10141421
529 Ga0105243_11307000
530 Ga0105241_10881259
531 Ga0105242_10493586
532 Ga0105248_10203326
533 Ga0105238_10176417
534 Ga0105238_10421336
535 Ga0105249_10000350
536 Ga0105246_10473249
537 Ga0157373_10142581
538 Ga0157373_10156451
539 Ga0157373_10225512
540 Ga0157373_10701678
541 Ga0157371_10448767
542 Ga0157369_10017243
543 Ga0157374_10381652
544 Ga0157378_10130531
545 Ga0163162_11773131
546 Ga0163162_13116058
547 Ga0157372_10387653
548 Ga0157372_10887084
549 Ga0157375_11602823
550 Ga0157380_10037690
551 Ga0157380_11883640
552 Ga0157377_10165142
553 Ga0157377_11709836
554 Ga0157376_10809493
555 Ga0157376_10859365
556 Ga0206354_11115621
557 Ga0213872_10015733
558 Ga0207673_1026564
559 Ga0207697_10016662
560 Ga0207697_10017851
561 Ga0207682_10000883
562 Ga0207682_10304442
563 Ga0207642_10619647
564 Ga0207710_10011000
565 Ga0207688_10008839
566 Ga0207688_10078715
567 Ga0207680_10188002
568 Ga0207647_10024227
569 Ga0207647_10047185
570 Ga0207645_10096206
571 Ga0207645_10403112
572 Ga0207643_10187082
573 Ga0207705_10010152
574 Ga0207705_10014317
575 Ga0207705_11556159
576 Ga0207707_10311824
577 Ga0207707_10564390
578 Ga0207693_10772254
579 Ga0207660_10061953
580 Ga0207660_10821553
581 Ga0207662_10066291
582 Ga0207657_10001814
583 Ga0207657_10139646
584 Ga0207657_10609613
585 Ga0207649_10198379
586 Ga0207649_10235911
587 Ga0207649_11197691
588 Ga0207652_10798827
589 Ga0207652_11087450
590 Ga0207681_10007952
591 Ga0207681_10335257
592 Ga0207694_11801290
593 Ga0207650_10016377
594 Ga0207650_10081872
595 Ga0207650_11133213
596 Ga0207659_10034963
597 Ga0207659_10040023
598 Ga0207659_10298036
599 Ga0207659_10398298
600 Ga0207687_10266740
601 Ga0207690_10001188
602 Ga0207690_10023248
603 Ga0207690_10070261
604 Ga0207690_10285078
605 Ga0207690_10626779
606 Ga0207690_11398284
607 Ga0207706_10012557
608 Ga0207706_10016514
609 Ga0207706_10126074
610 Ga0207706_10178442
611 Ga0207706_10977649
612 Ga0207686_10348009
613 Ga0207709_10368994
614 Ga0207709_10725641
615 Ga0207670_10382724
616 Ga0207669_10190708
617 Ga0207669_10264453
618 Ga0207704_10249095
619 Ga0207691_10067282
620 Ga0207691_10106533
621 Ga0207691_10497232
622 Ga0207711_10621699
623 Ga0207689_10018881
624 Ga0207689_10271966
625 Ga0207661_11027930
626 Ga0207679_10094617
627 Ga0207679_10242057
628 Ga0207679_10375534
629 Ga0207679_10533378
630 Ga0207667_10356900
631 Ga0207667_11002220
632 Ga0207651_10165861
633 Ga0207651_11026686
634 Ga0207712_10000299
635 Ga0207668_10700227
636 Ga0207668_12164858
637 Ga0207640_10111592
638 Ga0207640_10422607
639 Ga0207640_10758796
640 Ga0207640_11901024
641 Ga0207658_10770748
642 Ga0207658_10937832
643 Ga0207677_10509259
644 Ga0207703_10006101
645 Ga0207703_10230254
646 Ga0207639_10578433
647 Ga0207639_10706952
648 Ga0207678_10034910
649 Ga0207678_10738956
650 Ga0207708_10598484
651 Ga0207708_10728306
652 Ga0207702_10470241
653 Ga0207641_10026892
654 Ga0207641_10269263
655 Ga0207648_10074088
656 Ga0207648_11072216
657 Ga0207674_10852131
658 Ga0207674_11274532
659 Ga0207675_100063446
660 Ga0207675_102012275
661 Ga0207683_10016322
662 Ga0207683_10338370
663 Ga0207683_10348347
664 Ga0207698_10410901
665 Ga0209813_10000063
666 Ga0207428_10082057
667 Ga0268265_10000219
668 Ga0268265_10056491
669 Ga0268265_11750956
670 Ga0268265_12520505
671 Ga0268264_10000906
672 Ga0268264_10555927
673 Ga0307513_10479903
674 Ga0307408_100178041
675 Ga0307408_102413809
676 Ga0307405_10032646
677 Ga0307405_10326119
678 Ga0307413_11022045
679 Ga0307410_10000933
680 Ga0307406_10746345
681 Ga0307406_11679556
682 Ga0307407_10048603
683 Ga0307412_10255184
684 Ga0307412_10565989
685 Ga0307409_100025009
686 Ga0307416_100016114
687 Ga0307416_102124156
688 Ga0307414_10020194
689 Ga0307411_10007910
690 Ga0307411_10924284
691 Ga0373951_0147789
692 Ga0373946_0081837
693 Ga0316574_0791534
694 Ga0373935_0252646
695 Ga0373927_0053493
696 Ga0373947_0189277
697 Ga0395899_0276280
698 Ga0395899_0353971
699 Ga0395899_0607240
700 Ga0395900_0001044
701 Ga0395900_0120287
702 Ga0395900_0322942
703 Ga0395900_0551424
704 Ga0395900_0821846
705 Ga0395900_1409058
706 Ga0395900_1826778
707 Ga0395898_0236425
708 Ga0395898_0264758
709 Ga0395898_0421926
710 Ga0395905_0001217
711 Ga0395905_0027217
712 Ga0395905_0048199
713 Ga0395905_0059074
714 Ga0395905_0308289
715 Ga0395905_0475800
716 Ga0395905_1606817
717 Ga0395901_0020625
718 Ga0395901_0093469
719 Ga0395901_0150085
720 Ga0395901_0303563
721 Ga0395901_0420133
722 Ga0237819_00546
723 Ga0436361_0645163
724 Ga0439449_0084257
725 Ga0466961_0430931
726 Ga0466957_0111677
727 Ga0466957_1048062
728 Ga0466958_0389985
729 Ga0466967_0760210
730 Ga0495627_000478
731 Ga0495651_0872661
732 Ga0495650_0055811
733 Ga0495648_0064339
734 Ga0495663_0093846
735 Ga0495621_0053445
736 Ga0495633_0160863
737 Ga0495670_0136024
738 Ga0495604_0853784
739 Ga0495672_0087676
740 Ga0495673_0105863
741 Ga0495686_0018836
742 Ga0495686_0319433
743 Ga0496102_1552672
744 Ga0496107_0237288
745 Ga0496109_0143789
746 Ga0496113_0446330
747 Ga0501034_0337184
748 Ga0501069_0049435
749 Ga0501070_0570300
750 Ga0501074_0542787
751 Ga0501268_029493
752 Ga0501270_130894
753 Ga0501044_1003111
754 nmdc:mga03n38_438444_c1
755 nmdc:mga0k408_374514_c1
756 nmdc:mga06z11_27_c1
757 nmdc:mga04h51_180_c1
758 nmdc:mga07m45_80402_c1
759 nmdc:mga0n895_399763_c1
760 nmdc:mga0n895_642732_c1
761 nmdc:mga0rr50_1475511_c1
762 nmdc:mga0a205_17186_c1
763 Ga0501082_0163131
764 Ga0466962_0070239
765 2512644717
766 2919711687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

121

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9598 1 120
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9349 1 121
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9327 1 121
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9295 1 120
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9198 1 121
ID Description Score Start End Superfamily
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9269 1 121 3.10.180.10
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9194 1 121 3.10.180.10
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.862 3 46 3.30.720.120
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8417 61 122 3.30.720.110
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8325 1 120 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3C7W078-F1-model_v4 Glyoxalase 0.9879 49 122
AF-N1ML27-F1-model_v4 Lactoylglutathione lyase and related lyases 0.9829 1 122 GO:0016829
AF-A0A6P2MET5-F1-model_v4 Glyoxalase 0.9791 31 122
AF-A0A059G9Y8-F1-model_v4 VOC domain-containing protein 0.9768 5 121
AF-A0A3T1DQ56-F1-model_v4 deleted 0.9761 49 122

Map