F429203

General Info

Members Datasets Scaffolds Average Seq Length
382 217 382 143

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100476134|Ga0070708_1004761342
Length 159
Sequence MIYRMGAALMSLLGLFVSAYLYLYKIGRIGTLACGTGGCETVQLSEWSRFAGVDVALIGLVGYALLFAVALAALRPGLAEREWPAALLTALAGLGVLFTAYLTYLELFVIHAICRWCVGSALIITTLFMLGLLDLRRLRSGGAGGTAVSTGTGSARGAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
189 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
190 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
193 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
194 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
201 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
202 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.42
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8174435 2162886012 Bacteria 1333
2 rootL2_10164352 3300003322 Bacteria 4423
3 Ga0070676_10111710 3300005328 Bacteria 1702
4 Ga0070670_100600001 3300005331 Bacteria 985
5 Ga0068869_100224858 3300005334 Bacteria 1489
6 Ga0070680_100005407 3300005336 Bacteria 9670
7 Ga0070691_10053653 3300005341 Bacteria 1929
8 Ga0070691_10092759 3300005341 Bacteria 1491
9 Ga0070687_100355952 3300005343 Bacteria 946
10 Ga0070692_10219449 3300005345 Bacteria 1123
11 Ga0070669_100105231 3300005353 Bacteria 2134
12 Ga0070671_100097308 3300005355 Bacteria 2468
13 Ga0070674_100000401 3300005356 Bacteria 21777
14 Ga0070674_100583021 3300005356 Bacteria 943
15 Ga0070674_101758601 3300005356 Unclassified 561
16 Ga0070673_100381764 3300005364 Bacteria 1256
17 Ga0070659_100144678 3300005366 Bacteria 1936
18 Ga0070701_10428641 3300005438 Bacteria 844
19 Ga0070711_100014365 3300005439 Bacteria 4990
20 Ga0070705_100000621 3300005440 Bacteria 20496
21 Ga0070705_100027223 3300005440 Bacteria 3120
22 Ga0070700_100096424 3300005441 Bacteria 1940
23 Ga0070700_100101584 3300005441 Bacteria 1895
24 Ga0070694_100206397 3300005444 Bacteria 1467
25 Ga0070694_100480464 3300005444 Bacteria 986
26 Ga0070694_100995328 3300005444 Bacteria 696
27 Ga0070708_100476134 3300005445 Bacteria 1178
28 Ga0070708_100516359 3300005445 Bacteria 1127
29 Ga0070663_100335506 3300005455 Bacteria 1220
30 Ga0070663_100886309 3300005455 Bacteria 770
31 Ga0070678_100000727 3300005456 Bacteria 16382
32 Ga0070662_100000249 3300005457 Bacteria 31841
33 Ga0070681_10434567 3300005458 Bacteria 1225
34 Ga0070681_11529259 3300005458 Bacteria 592
35 Ga0068867_100000798 3300005459 Bacteria 21331
36 Ga0068867_100413541 3300005459 Unclassified 1141
37 Ga0070706_100089767 3300005467 Bacteria 2850
38 Ga0070706_100525540 3300005467 Bacteria 1101
39 Ga0070707_100255117 3300005468 Bacteria 1707
40 Ga0070707_100447992 3300005468 Unclassified 1252
41 Ga0070707_100697269 3300005468 Bacteria 978
42 Ga0070698_100107205 3300005471 Bacteria 2761
43 Ga0070699_100000017 3300005518 Bacteria 201366
44 Ga0070699_100004735 3300005518 Bacteria 12027
45 Ga0070679_100160270 3300005530 Bacteria 2224
46 Ga0070679_100445287 3300005530 Bacteria 1240
47 Ga0070684_100304777 3300005535 Bacteria 1462
48 Ga0070697_100010131 3300005536 Bacteria 7354
49 Ga0070697_100732939 3300005536 Bacteria 873
50 Ga0070686_100028542 3300005544 Bacteria 3385
51 Ga0070686_100447453 3300005544 Unclassified 992
52 Ga0070695_100108589 3300005545 Bacteria 1879
53 Ga0070695_100345897 3300005545 Unclassified 1113
54 Ga0070695_100726706 3300005545 Bacteria 790
55 Ga0070696_100000578 3300005546 Bacteria 23368
56 Ga0070696_100157522 3300005546 Bacteria 1671
57 Ga0070696_100161305 3300005546 Bacteria 1652
58 Ga0070696_100259504 3300005546 Bacteria 1317
59 Ga0070696_100380392 3300005546 Bacteria 1100
60 Ga0070696_100739060 3300005546 Bacteria 805
61 Ga0070693_100012337 3300005547 Bacteria 4323
62 Ga0070693_100068416 3300005547 Bacteria 2084
63 Ga0070693_100567889 3300005547 Bacteria 814
64 Ga0070704_100081306 3300005549 Bacteria 2386
65 Ga0070704_100245139 3300005549 Bacteria 1468
66 Ga0070704_100349199 3300005549 Bacteria 1248
67 Ga0068855_100080895 3300005563 Bacteria 3767
68 Ga0068857_100001149 3300005577 Bacteria 20636
69 Ga0068854_100005070 3300005578 Bacteria 8296
70 Ga0068854_100149674 3300005578 Unclassified 1799
71 Ga0070702_100002431 3300005615 Bacteria 8025
72 Ga0070702_100067868 3300005615 Bacteria 2097
73 Ga0068852_100254512 3300005616 Bacteria 1683
74 Ga0068859_100514503 3300005617 Bacteria 1292
75 Ga0068864_100063626 3300005618 Bacteria 3197
76 Ga0068866_10000023 3300005718 Bacteria 60315
77 Ga0068866_10039476 3300005718 Bacteria 2331
78 Ga0068866_10279117 3300005718 Bacteria 1034
79 Ga0068861_100012449 3300005719 Bacteria 5936
80 Ga0068870_10511512 3300005840 Bacteria 802
81 Ga0068863_100036987 3300005841 Bacteria 4648
82 Ga0068863_100322805 3300005841 Bacteria 1500
83 Ga0068858_100136536 3300005842 Bacteria 2301
84 Ga0068858_100750897 3300005842 Bacteria 951
85 Ga0068860_100006226 3300005843 Bacteria 11997
86 Ga0068860_100200386 3300005843 Bacteria 1934
87 Ga0068860_100643561 3300005843 Bacteria 1068
88 Ga0068862_100078250 3300005844 Bacteria 2865
89 Ga0070712_100023217 3300006175 Bacteria 4095
90 Ga0075428_100146217 3300006844 Bacteria 2569
91 Ga0075428_100602566 3300006844 Bacteria 1173
92 Ga0075430_100079734 3300006846 Bacteria 2743
93 Ga0075430_100106415 3300006846 Bacteria 2340
94 Ga0075430_101104145 3300006846 Bacteria 653
95 Ga0075431_100007055 3300006847 Bacteria 11158
96 Ga0075431_100091959 3300006847 Bacteria 3131
97 Ga0075431_101369930 3300006847 Bacteria 667
98 Ga0075433_10918316 3300006852 Unclassified 763
99 Ga0075433_11590679 3300006852 Unclassified 564
100 Ga0075429_100003519 3300006880 Bacteria 13343
101 Ga0075429_100006816 3300006880 Bacteria 9913
102 Ga0075429_101296388 3300006880 Unclassified 635
103 Ga0068865_100040543 3300006881 Bacteria 3165
104 Ga0075436_100202707 3300006914 Bacteria 1405
105 Ga0097620_100514494 3300006931 Bacteria 1292
106 Ga0105240_10088316 3300009093 Bacteria 3794
107 Ga0111539_10904032 3300009094 Unclassified 1027
108 Ga0114129_10095615 3300009147 Bacteria 4115
109 Ga0114129_10659136 3300009147 Unclassified 1350
110 Ga0114129_10776182 3300009147 Bacteria 1225
111 Ga0114129_11320485 3300009147 Bacteria 893
112 Ga0114129_12600497 3300009147 Bacteria 604
113 Ga0105243_10610819 3300009148 Bacteria 1051
114 Ga0105241_10032421 3300009174 Bacteria 3917
115 Ga0105241_10831981 3300009174 Unclassified 852
116 Ga0105242_10001116 3300009176 Bacteria 21161
117 Ga0105242_10253688 3300009176 Bacteria 1586
118 Ga0105248_10002777 3300009177 Bacteria 19467
119 Ga0105238_10554845 3300009551 Bacteria 1153
120 Ga0105249_10069689 3300009553 Bacteria 3246
121 Ga0105249_10093339 3300009553 Bacteria 2819
122 Ga0105239_10031233 3300010375 Bacteria 5859
123 Ga0105246_10056742 3300011119 Bacteria 2708
124 Ga0157378_10000391 3300013297 Bacteria 43180
125 Ga0163162_10023904 3300013306 Bacteria 6030
126 Ga0163162_10583712 3300013306 Unclassified 1244
127 Ga0157372_10727553 3300013307 Bacteria 1154
128 Ga0157375_10057001 3300013308 Bacteria 3860
129 Ga0157375_10367468 3300013308 Bacteria 1605
130 Ga0163163_10186038 3300014325 Bacteria 2125
131 Ga0163163_10224186 3300014325 Bacteria 1929
132 Ga0157379_10113363 3300014968 Bacteria 2437
133 Ga0157376_10302321 3300014969 Bacteria 1515
134 Ga0163161_10010248 3300017792 Bacteria 6490
135 Ga0207642_10000141 3300025899 Bacteria 20354
136 Ga0207642_10358470 3300025899 Bacteria 862
137 Ga0207642_10773901 3300025899 Bacteria 609
138 Ga0207699_10443178 3300025906 Bacteria 930
139 Ga0207645_10131404 3300025907 Bacteria 1629
140 Ga0207643_10045670 3300025908 Bacteria 2474
141 Ga0207643_10877122 3300025908 Bacteria 582
142 Ga0207654_10012985 3300025911 Bacteria 4275
143 Ga0207707_10043868 3300025912 Bacteria 3899
144 Ga0207707_10067195 3300025912 Bacteria 3123
145 Ga0207693_10049474 3300025915 Bacteria 3301
146 Ga0207663_10330910 3300025916 Bacteria 1147
147 Ga0207660_10016653 3300025917 Bacteria 4870
148 Ga0207660_10429747 3300025917 Bacteria 1066
149 Ga0207662_10478624 3300025918 Bacteria 855
150 Ga0207662_11299660 3300025918 Bacteria 517
151 Ga0207657_10647715 3300025919 Unclassified 822
152 Ga0207649_10239845 3300025920 Bacteria 1301
153 Ga0207652_10142576 3300025921 Bacteria 2143
154 Ga0207652_10519733 3300025921 Bacteria 1071
155 Ga0207646_10058526 3300025922 Bacteria 3442
156 Ga0207646_10165442 3300025922 Bacteria 1997
157 Ga0207681_10011492 3300025923 Bacteria 5440
158 Ga0207694_10400219 3300025924 Bacteria 1142
159 Ga0207687_10497870 3300025927 Archaea 1017
160 Ga0207644_11600143 3300025931 Unclassified 546
161 Ga0207690_10220315 3300025932 Bacteria 1451
162 Ga0207690_10242227 3300025932 Unclassified 1389
163 Ga0207706_10000457 3300025933 Bacteria 43553
164 Ga0207706_11150201 3300025933 Unclassified 647
165 Ga0207686_10000049 3300025934 Bacteria 115396
166 Ga0207709_10002628 3300025935 Bacteria 11181
167 Ga0207669_10000401 3300025937 Bacteria 19104
168 Ga0207669_11305480 3300025937 Bacteria 616
169 Ga0207704_10001407 3300025938 Bacteria 10754
170 Ga0207711_10000686 3300025941 Bacteria 33567
171 Ga0207689_10000895 3300025942 Bacteria 28650
172 Ga0207679_10449507 3300025945 Unclassified 1142
173 Ga0207679_11713815 3300025945 Bacteria 575
174 Ga0207667_10133988 3300025949 Bacteria 2551
175 Ga0207651_10859584 3300025960 Unclassified 806
176 Ga0207712_10001103 3300025961 Bacteria 18895
177 Ga0207712_10041175 3300025961 Bacteria 3174
178 Ga0207668_10020974 3300025972 Bacteria 4161
179 Ga0207640_10003689 3300025981 Bacteria 8256
180 Ga0207703_10367463 3300026035 Bacteria 1328
181 Ga0207639_10198033 3300026041 Bacteria 1720
182 Ga0207678_10181242 3300026067 Bacteria 1799
183 Ga0207678_10293136 3300026067 Bacteria 1398
184 Ga0207641_10039610 3300026088 Bacteria 3942
185 Ga0207648_10000011 3300026089 Bacteria 182284
186 Ga0207648_10307617 3300026089 Bacteria 1422
187 Ga0207676_10009558 3300026095 Bacteria 6904
188 Ga0207676_10065438 3300026095 Bacteria 2894
189 Ga0207676_10295100 3300026095 Bacteria 1478
190 Ga0207676_10531090 3300026095 Bacteria 1121
191 Ga0207674_10035432 3300026116 Bacteria 5207
192 Ga0207683_10002251 3300026121 Bacteria 16942
193 Ga0207683_12021173 3300026121 Bacteria 525
194 Ga0207698_10071454 3300026142 Bacteria 2754
195 Ga0209996_1051120 3300027395 Unclassified 626
196 Ga0209995_1008929 3300027471 Bacteria 1620
197 Ga0209974_10165284 3300027876 Bacteria 804
198 Ga0268265_10033283 3300028380 Bacteria 3746
199 Ga0268265_11163163 3300028380 Bacteria 768
200 Ga0268264_10007568 3300028381 Bacteria 9058
201 Ga0268264_11504629 3300028381 Bacteria 684
202 Ga0307408_100053512 3300031548 Bacteria 2915
203 Ga0307408_100073308 3300031548 Bacteria 2537
204 Ga0307405_10027768 3300031731 Bacteria 3287
205 Ga0307405_10031244 3300031731 Bacteria 3133
206 Ga0307413_10004487 3300031824 Bacteria 6080
207 Ga0307413_10021899 3300031824 Bacteria 3432
208 Ga0307413_10033794 3300031824 Bacteria 2916
209 Ga0307413_10049720 3300031824 Bacteria 2514
210 Ga0307413_10063616 3300031824 Bacteria 2288
211 Ga0307413_10078320 3300031824 Unclassified 2108
212 Ga0307410_10001421 3300031852 Bacteria 10773
213 Ga0307410_10021912 3300031852 Bacteria 3939
214 Ga0307410_10027668 3300031852 Bacteria 3586
215 Ga0307406_10025209 3300031901 Bacteria 3559
216 Ga0307406_10062737 3300031901 Unclassified 2405
217 Ga0307406_10076498 3300031901 Bacteria 2211
218 Ga0307406_10099280 3300031901 Bacteria 1979
219 Ga0307407_10015225 3300031903 Bacteria 3793
220 Ga0307407_10024538 3300031903 Bacteria 3164
221 Ga0307407_10227108 3300031903 Bacteria 1265
222 Ga0307412_10072644 3300031911 Bacteria 2352
223 Ga0307412_10074629 3300031911 Bacteria 2324
224 Ga0307409_100004650 3300031995 Bacteria 7756
225 Ga0307409_100071253 3300031995 Bacteria 2763
226 Ga0307409_100171514 3300031995 Bacteria 1910
227 Ga0307409_100173367 3300031995 Bacteria 1901
228 Ga0307409_100255206 3300031995 Bacteria 1605
229 Ga0307409_100368997 3300031995 Bacteria 1360
230 Ga0307409_100714653 3300031995 Bacteria 1002
231 Ga0307416_100004439 3300032002 Bacteria 8456
232 Ga0307416_100007825 3300032002 Bacteria 6832
233 Ga0307416_100015759 3300032002 Bacteria 5230
234 Ga0307416_100025794 3300032002 Bacteria 4317
235 Ga0307416_100498792 3300032002 Unclassified 1281
236 Ga0307416_100812160 3300032002 Bacteria 1031
237 Ga0307414_10018503 3300032004 Bacteria 4292
238 Ga0307414_10023515 3300032004 Bacteria 3910
239 Ga0307414_10065054 3300032004 Unclassified 2600
240 Ga0307414_10277856 3300032004 Bacteria 1406
241 Ga0307414_11125743 3300032004 Bacteria 725
242 Ga0307411_10051027 3300032005 Bacteria 2697
243 Ga0307411_10071186 3300032005 Bacteria 2356
244 Ga0307411_10090557 3300032005 Bacteria 2134
245 Ga0307415_100005227 3300032126 Bacteria 6865
246 Ga0307415_100051029 3300032126 Bacteria 2805
247 Ga0307415_100320569 3300032126 Bacteria 1292
248 Ga0307415_100618928 3300032126 Bacteria 966
249 Ga0307415_100702648 3300032126 Bacteria 913
250 Ga0373958_0145370 3300034819 Bacteria 590
251 Ga0373959_0086453 3300034820 Bacteria 729
252 Ga0373929_0017851 3300035085 Bacteria 1405
253 Ga0373940_0006120 3300035088 Bacteria 2648
254 Ga0373940_0050418 3300035088 Bacteria 1168
255 Ga0373949_0018815 3300035090 Bacteria 1569
256 Ga0373941_0094058 3300035115 Bacteria 1033
257 Ga0373960_0007828 3300035121 Bacteria 2542
258 Ga0373962_0176502 3300035242 Bacteria 712
259 Ga0373931_0160301 3300035691 Bacteria 1318
260 Ga0373931_0178398 3300035691 Bacteria 1256
261 Ga0395905_0106490 3300037471 Bacteria 2633
262 Ga0395901_0988406 3300038443 Bacteria 818
263 Ga0242420_006299 3300038996 Bacteria 1871
264 Ga0439457_017442 3300042014 Bacteria 1595
265 Ga0439446_0258326 3300042156 Bacteria 602
266 Ga0451577_0082732 3300042876 Bacteria 2863
267 Ga0451577_0486050 3300042876 Bacteria 1121
268 Ga0451577_0746241 3300042876 Bacteria 886
269 Ga0466964_0036697 3300044706 Bacteria 1967
270 Ga0453684_0139282 3300044712 Bacteria 2900
271 Ga0451576_0042056 3300045051 Bacteria 4825
272 Ga0451576_0926809 3300045051 Bacteria 914
273 Ga0495603_0222350 3300046455 Bacteria 1089
274 Ga0495641_0484135 3300046461 Bacteria 564
275 Ga0495622_0059115 3300046557 Bacteria 1775
276 Ga0495668_0194816 3300046616 Bacteria 1110
277 Ga0495659_0166289 3300046664 Unclassified 893
278 Ga0496100_0053068 3300048903 Bacteria 2639
279 Ga0496100_0125368 3300048903 Bacteria 1802
280 Ga0496100_0400115 3300048903 Bacteria 1046
281 Ga0496101_0051495 3300048904 Bacteria 2967
282 Ga0496102_0076062 3300048905 Bacteria 3087
283 Ga0496102_0199806 3300048905 Bacteria 1884
284 Ga0496103_0898704 3300048906 Bacteria 555
285 Ga0496104_0040471 3300048907 Bacteria 4368
286 Ga0496104_0184571 3300048907 Bacteria 1996
287 Ga0496105_0062259 3300048908 Bacteria 3079
288 Ga0496105_0279755 3300048908 Bacteria 1346
289 Ga0496106_0045699 3300048909 Bacteria 3290
290 Ga0496106_0059903 3300048909 Bacteria 2885
291 Ga0496106_0219032 3300048909 Bacteria 1518
292 Ga0496106_0352009 3300048909 Unclassified 1183
293 Ga0496108_0008066 3300048911 Bacteria 8544
294 Ga0496108_0038935 3300048911 Bacteria 3962
295 Ga0496108_0050523 3300048911 Bacteria 3480
296 Ga0496109_0015661 3300048912 Bacteria 6614
297 Ga0496109_0022447 3300048912 Bacteria 5589
298 Ga0496109_0069621 3300048912 Bacteria 3227
299 Ga0496110_0003328 3300048913 Bacteria 12280
300 Ga0496110_0053106 3300048913 Bacteria 3562
301 Ga0496110_0061037 3300048913 Bacteria 3326
302 Ga0496111_0010557 3300048914 Bacteria 6203
303 Ga0496111_0057181 3300048914 Bacteria 2824
304 Ga0496111_0096516 3300048914 Bacteria 2169
305 Ga0496112_0018597 3300048915 Bacteria 6546
306 Ga0496112_0070512 3300048915 Bacteria 3454
307 Ga0496112_0890090 3300048915 Unclassified 812
308 Ga0496113_0005261 3300048916 Bacteria 8058
309 Ga0496113_0022916 3300048916 Bacteria 4424
310 Ga0496114_0020610 3300048917 Bacteria 5352
311 Ga0496114_0060620 3300048917 Bacteria 3163
312 Ga0496114_1240245 3300048917 Unclassified 632
313 Ga0496115_0139066 3300048918 Bacteria 2003
314 Ga0501032_0608435 3300049569 Bacteria 695
315 Ga0501034_0005637 3300049571 Bacteria 13626
316 Ga0501034_0116880 3300049571 Bacteria 2655
317 Ga0501047_0085409 3300049581 Bacteria 3032
318 Ga0501047_0230211 3300049581 Bacteria 1707
319 Ga0501067_0004871 3300049583 Bacteria 7455
320 Ga0501067_0007550 3300049583 Bacteria 6045
321 Ga0501067_0024025 3300049583 Bacteria 3380
322 Ga0501067_0035994 3300049583 Bacteria 2749
323 Ga0501068_0000107 3300049584 Bacteria 35803
324 Ga0501068_0000534 3300049584 Bacteria 19220
325 Ga0501069_0037892 3300049585 Bacteria 2660
326 Ga0501069_0070369 3300049585 Bacteria 1959
327 Ga0501070_0026763 3300049586 Bacteria 4837
328 Ga0501070_0087098 3300049586 Bacteria 2585
329 Ga0501070_0225739 3300049586 Bacteria 1535
330 Ga0501071_0002672 3300049587 Bacteria 10915
331 Ga0501071_0003974 3300049587 Bacteria 9328
332 Ga0501072_0059381 3300049588 Bacteria 3015
333 Ga0501073_0032056 3300049589 Bacteria 3748
334 Ga0501073_0490572 3300049589 Bacteria 849
335 Ga0501073_0678361 3300049589 Bacteria 711
336 Ga0501074_0010562 3300049590 Bacteria 6701
337 Ga0501074_0056514 3300049590 Bacteria 2828
338 Ga0501074_0985672 3300049590 Bacteria 593
339 Ga0501076_0345608 3300049592 Bacteria 1221
340 Ga0501206_103033 3300049653 Bacteria 519
341 Ga0501209_285386 3300049656 Bacteria 518
342 Ga0501233_009060 3300049668 Bacteria 1935
343 Ga0501235_199966 3300049669 Bacteria 540
344 Ga0501248_010464 3300049678 Bacteria 824
345 Ga0501250_029025 3300049680 Bacteria 759
346 Ga0501253_024718 3300049683 Bacteria 1092
347 Ga0501225_0025962 3300049705 Bacteria 1611
348 Ga0501225_0300556 3300049705 Bacteria 543
349 Ga0501079_0111680 3300049741 Bacteria 2124
350 Ga0501080_0032577 3300049742 Bacteria 4861
351 Ga0501080_0073121 3300049742 Bacteria 3189
352 Ga0501080_0158144 3300049742 Bacteria 2093
353 Ga0501081_1544622 3300049743 Bacteria 504
354 Ga0501083_0027780 3300049744 Bacteria 3902
355 Ga0501083_0032336 3300049744 Bacteria 3589
356 Ga0501263_009343 3300049760 Bacteria 1185
357 Ga0501268_005159 3300049765 Bacteria 1867
358 Ga0501270_004405 3300049767 Bacteria 1578
359 Ga0501044_0338025 3300049823 Bacteria 1427
360 Ga0501204_053672 3300049850 Bacteria 624
361 nmdc:mga05p37_1266840_c1 3300050507 Bacteria 755
362 nmdc:mga05p37_399180_c1 3300050507 Bacteria 1272
363 nmdc:mga05p37_443686_c2 3300050507 Unclassified 763
364 nmdc:mga09592_5138_c1 3300050508 Bacteria 10630
365 nmdc:mga0qj67_72577_c1 3300050509 Bacteria 793
366 nmdc:mga06r32_10243_c1 3300050510 Bacteria 8458
367 nmdc:mga06r32_1310467_c1 3300050510 Bacteria 668
368 nmdc:mga06r32_532933_c1 3300050510 Bacteria 1149
369 nmdc:mga06r32_70503_c1 3300050510 Bacteria 3380
370 nmdc:mga08y16_704013_c1 3300050511 Unclassified 1010
371 nmdc:mga0n895_185974_c1 3300050512 Bacteria 2108
372 nmdc:mga0n895_621884_c1 3300050512 Bacteria 1081
373 nmdc:mga0a205_1172375_c1 3300050515 Bacteria 616
374 nmdc:mga0a205_829720_c1 3300050515 Unclassified 772
375 Ga0501084_0000269 3300054114 Bacteria 39257
376 Ga0501084_0017391 3300054114 Bacteria 5977
377 Ga0590071_007153 3300059421 Bacteria 2642
378 Ga0590075_089857 3300059424 Bacteria 797
379 Ga0590077_020162 3300059426 Bacteria 1415
380 Ga0501082_0012998 3300060353 Bacteria 7155
381 Ga0501082_0040549 3300060353 Bacteria 4015
382 Ga0530510_0171310 3300061734 Bacteria 1608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100005407 Ga0070680_10000540713 128
2 3300005530 Ga0070679_100160270 Ga0070679_1001602705 128
3 3300005535 Ga0070684_100304777 Ga0070684_1003047772 128
4 3300005546 Ga0070696_100739060 Ga0070696_1007390601 128
5 3300005547 Ga0070693_100567889 Ga0070693_1005678891 128
6 3300005577 Ga0068857_100001149 Ga0068857_1000011498 128
7 3300005618 Ga0068864_100063626 Ga0068864_1000636266 128
8 3300011119 Ga0105246_10056742 Ga0105246_100567426 128
9 3300025912 Ga0207707_10043868 Ga0207707_100438682 128
10 3300025917 Ga0207660_10016653 Ga0207660_100166539 128
11 3300025920 Ga0207649_10239845 Ga0207649_102398452 128
12 3300025921 Ga0207652_10142576 Ga0207652_101425762 128
13 3300025945 Ga0207679_10449507 Ga0207679_104495072 128
14 3300049586 Ga0501070_0225739 Ga0501070_0225739_515_946 128
15 3300049742 Ga0501080_0158144 Ga0501080_0158144_220_651 128
16 3300026095 Ga0207676_10065438 Ga0207676_100654386 129
17 3300026116 Ga0207674_10035432 Ga0207674_100354323 129
18 3300042876 Ga0451577_0746241 Ga0451577_0746241_25_456 130
19 3300049683 Ga0501253_024718 Ga0501253_024718_90_482 130
20 3300049705 Ga0501225_0025962 Ga0501225_0025962_122_541 130
21 3300031824 Ga0307413_10021899 Ga0307413_100218992 134
22 3300031852 Ga0307410_10027668 Ga0307410_100276687 134
23 3300031903 Ga0307407_10227108 Ga0307407_102271082 134
24 3300031911 Ga0307412_10072644 Ga0307412_100726442 134
25 3300031995 Ga0307409_100004650 Ga0307409_1000046503 134
26 3300032002 Ga0307416_100004439 Ga0307416_1000044393 134
27 3300032126 Ga0307415_100618928 Ga0307415_1006189282 134
28 3300049653 Ga0501206_103033 Ga0501206_103033_14_445 134
29 3300049656 Ga0501209_285386 Ga0501209_285386_70_501 134
30 3300049669 Ga0501235_199966 Ga0501235_199966_87_518 134
31 3300049765 Ga0501268_005159 Ga0501268_005159_375_806 134
32 3300045051 Ga0451576_0926809 Ga0451576_0926809_217_651 135
33 3300005467 Ga0070706_100525540 Ga0070706_1005255401 136
34 3300005468 Ga0070707_100697269 Ga0070707_1006972692 136
35 3300005518 Ga0070699_100000017 Ga0070699_10000001733 137
36 3300005841 Ga0068863_100036987 Ga0068863_1000369873 137
37 3300005842 Ga0068858_100136536 Ga0068858_1001365362 137
38 3300025922 Ga0207646_10058526 Ga0207646_100585267 137
39 3300006844 Ga0075428_100146217 Ga0075428_1001462175 138
40 3300006847 Ga0075431_100091959 Ga0075431_1000919593 138
41 3300006880 Ga0075429_100003519 Ga0075429_1000035199 138
42 3300009147 Ga0114129_10095615 Ga0114129_100956152 138
43 3300050507 nmdc:mga05p37_399180_c1 nmdc:mga05p37_399180_c1_80_496 138
44 3300050508 nmdc:mga09592_5138_c1 nmdc:mga09592_5138_c1_8126_8542 138
45 3300050510 nmdc:mga06r32_70503_c1 nmdc:mga06r32_70503_c1_332_748 138
46 3300005331 Ga0070670_100600001 Ga0070670_1006000012 139
47 3300005444 Ga0070694_100995328 Ga0070694_1009953281 139
48 3300005445 Ga0070708_100516359 Ga0070708_1005163592 139
49 3300005467 Ga0070706_100089767 Ga0070706_1000897672 139
50 3300005468 Ga0070707_100255117 Ga0070707_1002551172 139
51 3300005468 Ga0070707_100447992 Ga0070707_1004479921 139
52 3300005471 Ga0070698_100107205 Ga0070698_1001072052 139
53 3300005536 Ga0070697_100732939 Ga0070697_1007329392 139
54 3300005545 Ga0070695_100726706 Ga0070695_1007267061 139
55 3300006847 Ga0075431_101369930 Ga0075431_1013699302 139
56 3300014325 Ga0163163_10224186 Ga0163163_102241862 139
57 3300025922 Ga0207646_10165442 Ga0207646_101654423 139
58 3300037471 Ga0395905_0106490 Ga0395905_0106490_1018_1437 139
59 3300049589 Ga0501073_0678361 Ga0501073_0678361_131_550 139
60 3300049590 Ga0501074_0985672 Ga0501074_0985672_108_527 139
61 3300050510 nmdc:mga06r32_1310467_c1 nmdc:mga06r32_1310467_c1_148_567 139
62 3300046557 Ga0495622_0059115 Ga0495622_0059115_162_587 140
63 3300046664 Ga0495659_0166289 Ga0495659_0166289_400_825 140
64 3300049705 Ga0501225_0300556 Ga0501225_0300556_50_472 140
65 3300050512 nmdc:mga0n895_621884_c1 nmdc:mga0n895_621884_c1_19_441 140
66 3300006880 Ga0075429_100006816 Ga0075429_1000068168 141
67 3300009147 Ga0114129_12600497 Ga0114129_126004972 141
68 3300027471 Ga0209995_1008929 Ga0209995_10089292 141
69 3300050510 nmdc:mga06r32_532933_c1 nmdc:mga06r32_532933_c1_668_1093 141
70 3300005439 Ga0070711_100014365 Ga0070711_1000143652 142
71 3300005546 Ga0070696_100157522 Ga0070696_1001575222 142
72 3300005546 Ga0070696_100380392 Ga0070696_1003803922 142
73 3300005617 Ga0068859_100514503 Ga0068859_1005145032 142
74 3300005841 Ga0068863_100322805 Ga0068863_1003228052 142
75 3300006175 Ga0070712_100023217 Ga0070712_1000232175 142
76 3300006844 Ga0075428_100602566 Ga0075428_1006025662 142
77 3300006846 Ga0075430_100079734 Ga0075430_1000797342 142
78 3300006880 Ga0075429_101296388 Ga0075429_1012963882 142
79 3300006931 Ga0097620_100514494 Ga0097620_1005144942 142
80 3300014325 Ga0163163_10186038 Ga0163163_101860382 142
81 3300025915 Ga0207693_10049474 Ga0207693_100494745 142
82 3300025916 Ga0207663_10330910 Ga0207663_103309102 142
83 3300025945 Ga0207679_11713815 Ga0207679_117138152 142
84 3300026088 Ga0207641_10039610 Ga0207641_100396102 142
85 3300026095 Ga0207676_10009558 Ga0207676_100095582 142
86 3300026095 Ga0207676_10531090 Ga0207676_105310902 142
87 3300034819 Ga0373958_0145370 Ga0373958_0145370_38_469 142
88 3300034820 Ga0373959_0086453 Ga0373959_0086453_286_717 142
89 3300035085 Ga0373929_0017851 Ga0373929_0017851_781_1212 142
90 3300035088 Ga0373940_0006120 Ga0373940_0006120_718_1149 142
91 3300035115 Ga0373941_0094058 Ga0373941_0094058_253_684 142
92 3300035121 Ga0373960_0007828 Ga0373960_0007828_1086_1517 142
93 3300035242 Ga0373962_0176502 Ga0373962_0176502_228_659 142
94 3300035691 Ga0373931_0160301 Ga0373931_0160301_593_1024 142
95 3300035691 Ga0373931_0178398 Ga0373931_0178398_293_724 142
96 3300038996 Ga0242420_006299 Ga0242420_006299_619_1050 142
97 3300048903 Ga0496100_0053068 Ga0496100_0053068_2018_2449 142
98 3300048905 Ga0496102_0076062 Ga0496102_0076062_571_1002 142
99 3300048905 Ga0496102_0199806 Ga0496102_0199806_525_956 142
100 3300048907 Ga0496104_0040471 Ga0496104_0040471_2083_2514 142
101 3300048907 Ga0496104_0184571 Ga0496104_0184571_881_1312 142
102 3300048908 Ga0496105_0062259 Ga0496105_0062259_270_701 142
103 3300048908 Ga0496105_0279755 Ga0496105_0279755_506_937 142
104 3300048909 Ga0496106_0219032 Ga0496106_0219032_609_1040 142
105 3300048911 Ga0496108_0038935 Ga0496108_0038935_2276_2707 142
106 3300048911 Ga0496108_0050523 Ga0496108_0050523_2365_2796 142
107 3300048912 Ga0496109_0022447 Ga0496109_0022447_2885_3316 142
108 3300048912 Ga0496109_0069621 Ga0496109_0069621_317_748 142
109 3300048913 Ga0496110_0053106 Ga0496110_0053106_1990_2421 142
110 3300048913 Ga0496110_0061037 Ga0496110_0061037_1998_2429 142
111 3300048914 Ga0496111_0057181 Ga0496111_0057181_863_1294 142
112 3300048914 Ga0496111_0096516 Ga0496111_0096516_1029_1460 142
113 3300048915 Ga0496112_0018597 Ga0496112_0018597_5431_5862 142
114 3300048915 Ga0496112_0070512 Ga0496112_0070512_2339_2770 142
115 3300048916 Ga0496113_0005261 Ga0496113_0005261_2266_2697 142
116 3300048917 Ga0496114_0060620 Ga0496114_0060620_2229_2660 142
117 3300048918 Ga0496115_0139066 Ga0496115_0139066_348_779 142
118 3300050509 nmdc:mga0qj67_72577_c1 nmdc:mga0qj67_72577_c1_140_568 142
119 3300050512 nmdc:mga0n895_185974_c1 nmdc:mga0n895_185974_c1_1601_2032 142
120 3300050515 nmdc:mga0a205_1172375_c1 nmdc:mga0a205_1172375_c1_60_491 142
121 3300005549 Ga0070704_100081306 Ga0070704_1000813064 143
122 3300031824 Ga0307413_10004487 Ga0307413_1000448710 143
123 3300031852 Ga0307410_10021912 Ga0307410_100219123 143
124 3300031901 Ga0307406_10076498 Ga0307406_100764982 143
125 3300031903 Ga0307407_10015225 Ga0307407_100152255 143
126 3300031995 Ga0307409_100714653 Ga0307409_1007146532 143
127 3300032002 Ga0307416_100015759 Ga0307416_1000157597 143
128 3300032004 Ga0307414_10023515 Ga0307414_100235152 143
129 3300032126 Ga0307415_100051029 Ga0307415_1000510294 143
130 3300044706 Ga0466964_0036697 Ga0466964_0036697_1415_1846 143
131 3300049569 Ga0501032_0608435 Ga0501032_0608435_16_447 143
132 3300049571 Ga0501034_0005637 Ga0501034_0005637_1637_2068 143
133 3300049571 Ga0501034_0116880 Ga0501034_0116880_1297_1728 143
134 3300049581 Ga0501047_0085409 Ga0501047_0085409_2218_2649 143
135 3300049581 Ga0501047_0230211 Ga0501047_0230211_278_709 143
136 3300049583 Ga0501067_0004871 Ga0501067_0004871_680_1111 143
137 3300049583 Ga0501067_0007550 Ga0501067_0007550_2819_3250 143
138 3300049583 Ga0501067_0024025 Ga0501067_0024025_1762_2193 143
139 3300049584 Ga0501068_0000107 Ga0501068_0000107_4868_5299 143
140 3300049584 Ga0501068_0000534 Ga0501068_0000534_11897_12328 143
141 3300049585 Ga0501069_0037892 Ga0501069_0037892_2171_2602 143
142 3300049585 Ga0501069_0070369 Ga0501069_0070369_1245_1676 143
143 3300049586 Ga0501070_0026763 Ga0501070_0026763_4231_4662 143
144 3300049586 Ga0501070_0087098 Ga0501070_0087098_224_655 143
145 3300049587 Ga0501071_0002672 Ga0501071_0002672_1597_2028 143
146 3300049587 Ga0501071_0003974 Ga0501071_0003974_1793_2224 143
147 3300049588 Ga0501072_0059381 Ga0501072_0059381_1376_1807 143
148 3300049589 Ga0501073_0032056 Ga0501073_0032056_3142_3573 143
149 3300049589 Ga0501073_0490572 Ga0501073_0490572_360_791 143
150 3300049590 Ga0501074_0010562 Ga0501074_0010562_855_1286 143
151 3300049590 Ga0501074_0056514 Ga0501074_0056514_2339_2770 143
152 3300049592 Ga0501076_0345608 Ga0501076_0345608_174_605 143
153 3300049668 Ga0501233_009060 Ga0501233_009060_1275_1706 143
154 3300049678 Ga0501248_010464 Ga0501248_010464_74_505 143
155 3300049680 Ga0501250_029025 Ga0501250_029025_162_593 143
156 3300049741 Ga0501079_0111680 Ga0501079_0111680_1031_1462 143
157 3300049742 Ga0501080_0032577 Ga0501080_0032577_3911_4342 143
158 3300049742 Ga0501080_0073121 Ga0501080_0073121_495_926 143
159 3300049743 Ga0501081_1544622 Ga0501081_1544622_44_475 143
160 3300049744 Ga0501083_0027780 Ga0501083_0027780_2911_3342 143
161 3300049744 Ga0501083_0032336 Ga0501083_0032336_1011_1442 143
162 3300049760 Ga0501263_009343 Ga0501263_009343_116_547 143
163 3300049767 Ga0501270_004405 Ga0501270_004405_226_657 143
164 3300049823 Ga0501044_0338025 Ga0501044_0338025_683_1114 143
165 3300049850 Ga0501204_053672 Ga0501204_053672_91_522 143
166 3300054114 Ga0501084_0000269 Ga0501084_0000269_37847_38278 143
167 3300054114 Ga0501084_0017391 Ga0501084_0017391_240_671 143
168 3300060353 Ga0501082_0012998 Ga0501082_0012998_1732_2163 143
169 3300060353 Ga0501082_0040549 Ga0501082_0040549_674_1105 143
170 3300003322 rootL2_10164352 rootL2_101643521 144
171 3300005328 Ga0070676_10111710 Ga0070676_101117102 144
172 3300005334 Ga0068869_100224858 Ga0068869_1002248583 144
173 3300005341 Ga0070691_10053653 Ga0070691_100536532 144
174 3300005341 Ga0070691_10092759 Ga0070691_100927593 144
175 3300005343 Ga0070687_100355952 Ga0070687_1003559521 144
176 3300005345 Ga0070692_10219449 Ga0070692_102194492 144
177 3300005353 Ga0070669_100105231 Ga0070669_1001052312 144
178 3300005355 Ga0070671_100097308 Ga0070671_1000973083 144
179 3300005356 Ga0070674_100000401 Ga0070674_10000040114 144
180 3300005356 Ga0070674_100583021 Ga0070674_1005830212 144
181 3300005356 Ga0070674_101758601 Ga0070674_1017586011 144
182 3300005364 Ga0070673_100381764 Ga0070673_1003817642 144
183 3300005366 Ga0070659_100144678 Ga0070659_1001446782 144
184 3300005438 Ga0070701_10428641 Ga0070701_104286411 144
185 3300005440 Ga0070705_100000621 Ga0070705_1000006217 144
186 3300005440 Ga0070705_100027223 Ga0070705_1000272233 144
187 3300005441 Ga0070700_100096424 Ga0070700_1000964242 144
188 3300005441 Ga0070700_100101584 Ga0070700_1001015842 144
189 3300005444 Ga0070694_100480464 Ga0070694_1004804641 144
190 3300005455 Ga0070663_100335506 Ga0070663_1003355062 144
191 3300005455 Ga0070663_100886309 Ga0070663_1008863092 144
192 3300005456 Ga0070678_100000727 Ga0070678_10000072716 144
193 3300005457 Ga0070662_100000249 Ga0070662_1000002492 144
194 3300005458 Ga0070681_10434567 Ga0070681_104345671 144
195 3300005458 Ga0070681_11529259 Ga0070681_115292591 144
196 3300005459 Ga0068867_100000798 Ga0068867_10000079811 144
197 3300005459 Ga0068867_100413541 Ga0068867_1004135412 144
198 3300005530 Ga0070679_100445287 Ga0070679_1004452872 144
199 3300005544 Ga0070686_100028542 Ga0070686_1000285424 144
200 3300005544 Ga0070686_100447453 Ga0070686_1004474532 144
201 3300005545 Ga0070695_100345897 Ga0070695_1003458972 144
202 3300005546 Ga0070696_100161305 Ga0070696_1001613052 144
203 3300005546 Ga0070696_100259504 Ga0070696_1002595042 144
204 3300005547 Ga0070693_100012337 Ga0070693_1000123375 144
205 3300005547 Ga0070693_100068416 Ga0070693_1000684163 144
206 3300005549 Ga0070704_100245139 Ga0070704_1002451392 144
207 3300005563 Ga0068855_100080895 Ga0068855_1000808952 144
208 3300005578 Ga0068854_100005070 Ga0068854_1000050706 144
209 3300005578 Ga0068854_100149674 Ga0068854_1001496743 144
210 3300005615 Ga0070702_100002431 Ga0070702_1000024312 144
211 3300005615 Ga0070702_100067868 Ga0070702_1000678684 144
212 3300005616 Ga0068852_100254512 Ga0068852_1002545122 144
213 3300005718 Ga0068866_10000023 Ga0068866_1000002355 144
214 3300005718 Ga0068866_10039476 Ga0068866_100394761 144
215 3300005718 Ga0068866_10279117 Ga0068866_102791172 144
216 3300005719 Ga0068861_100012449 Ga0068861_1000124495 144
217 3300005840 Ga0068870_10511512 Ga0068870_105115122 144
218 3300005842 Ga0068858_100750897 Ga0068858_1007508972 144
219 3300005843 Ga0068860_100006226 Ga0068860_10000622611 144
220 3300005843 Ga0068860_100200386 Ga0068860_1002003862 144
221 3300005843 Ga0068860_100643561 Ga0068860_1006435612 144
222 3300005844 Ga0068862_100078250 Ga0068862_1000782504 144
223 3300006846 Ga0075430_100106415 Ga0075430_1001064152 144
224 3300006846 Ga0075430_101104145 Ga0075430_1011041452 144
225 3300006847 Ga0075431_100007055 Ga0075431_10000705512 144
226 3300006852 Ga0075433_10918316 Ga0075433_109183162 144
227 3300006881 Ga0068865_100040543 Ga0068865_1000405434 144
228 3300009093 Ga0105240_10088316 Ga0105240_100883163 144
229 3300009094 Ga0111539_10904032 Ga0111539_109040321 144
230 3300009147 Ga0114129_10659136 Ga0114129_106591362 144
231 3300009147 Ga0114129_11320485 Ga0114129_113204852 144
232 3300009148 Ga0105243_10610819 Ga0105243_106108192 144
233 3300009174 Ga0105241_10032421 Ga0105241_100324212 144
234 3300009174 Ga0105241_10831981 Ga0105241_108319812 144
235 3300009176 Ga0105242_10001116 Ga0105242_1000111610 144
236 3300009176 Ga0105242_10253688 Ga0105242_102536882 144
237 3300009177 Ga0105248_10002777 Ga0105248_100027777 144
238 3300009551 Ga0105238_10554845 Ga0105238_105548452 144
239 3300009553 Ga0105249_10069689 Ga0105249_100696892 144
240 3300009553 Ga0105249_10093339 Ga0105249_100933393 144
241 3300010375 Ga0105239_10031233 Ga0105239_100312332 144
242 3300013297 Ga0157378_10000391 Ga0157378_1000039116 144
243 3300013306 Ga0163162_10023904 Ga0163162_100239044 144
244 3300013306 Ga0163162_10583712 Ga0163162_105837122 144
245 3300013307 Ga0157372_10727553 Ga0157372_107275532 144
246 3300013308 Ga0157375_10057001 Ga0157375_100570014 144
247 3300013308 Ga0157375_10367468 Ga0157375_103674682 144
248 3300014968 Ga0157379_10113363 Ga0157379_101133632 144
249 3300014969 Ga0157376_10302321 Ga0157376_103023212 144
250 3300017792 Ga0163161_10010248 Ga0163161_100102482 144
251 3300025899 Ga0207642_10000141 Ga0207642_100001415 144
252 3300025899 Ga0207642_10358470 Ga0207642_103584702 144
253 3300025899 Ga0207642_10773901 Ga0207642_107739012 144
254 3300025907 Ga0207645_10131404 Ga0207645_101314042 144
255 3300025908 Ga0207643_10045670 Ga0207643_100456701 144
256 3300025908 Ga0207643_10877122 Ga0207643_108771222 144
257 3300025911 Ga0207654_10012985 Ga0207654_100129852 144
258 3300025912 Ga0207707_10067195 Ga0207707_100671952 144
259 3300025917 Ga0207660_10429747 Ga0207660_104297472 144
260 3300025918 Ga0207662_10478624 Ga0207662_104786241 144
261 3300025918 Ga0207662_11299660 Ga0207662_112996601 144
262 3300025919 Ga0207657_10647715 Ga0207657_106477152 144
263 3300025921 Ga0207652_10519733 Ga0207652_105197332 144
264 3300025923 Ga0207681_10011492 Ga0207681_100114928 144
265 3300025924 Ga0207694_10400219 Ga0207694_104002192 144
266 3300025927 Ga0207687_10497870 Ga0207687_104978701 144
267 3300025931 Ga0207644_11600143 Ga0207644_116001431 144
268 3300025932 Ga0207690_10220315 Ga0207690_102203152 144
269 3300025932 Ga0207690_10242227 Ga0207690_102422273 144
270 3300025933 Ga0207706_10000457 Ga0207706_1000045728 144
271 3300025933 Ga0207706_11150201 Ga0207706_111502012 144
272 3300025934 Ga0207686_10000049 Ga0207686_1000004952 144
273 3300025935 Ga0207709_10002628 Ga0207709_1000262811 144
274 3300025937 Ga0207669_10000401 Ga0207669_1000040111 144
275 3300025937 Ga0207669_11305480 Ga0207669_113054802 144
276 3300025938 Ga0207704_10001407 Ga0207704_100014078 144
277 3300025941 Ga0207711_10000686 Ga0207711_1000068618 144
278 3300025942 Ga0207689_10000895 Ga0207689_1000089512 144
279 3300025949 Ga0207667_10133988 Ga0207667_101339881 144
280 3300025960 Ga0207651_10859584 Ga0207651_108595841 144
281 3300025961 Ga0207712_10001103 Ga0207712_1000110316 144
282 3300025961 Ga0207712_10041175 Ga0207712_100411753 144
283 3300025972 Ga0207668_10020974 Ga0207668_100209742 144
284 3300025981 Ga0207640_10003689 Ga0207640_100036896 144
285 3300026035 Ga0207703_10367463 Ga0207703_103674632 144
286 3300026041 Ga0207639_10198033 Ga0207639_101980332 144
287 3300026067 Ga0207678_10181242 Ga0207678_101812422 144
288 3300026067 Ga0207678_10293136 Ga0207678_102931362 144
289 3300026089 Ga0207648_10000011 Ga0207648_1000001123 144
290 3300026089 Ga0207648_10307617 Ga0207648_103076172 144
291 3300026095 Ga0207676_10295100 Ga0207676_102951002 144
292 3300026121 Ga0207683_10002251 Ga0207683_1000225116 144
293 3300026121 Ga0207683_12021173 Ga0207683_120211731 144
294 3300026142 Ga0207698_10071454 Ga0207698_100714542 144
295 3300027395 Ga0209996_1051120 Ga0209996_10511202 144
296 3300027876 Ga0209974_10165284 Ga0209974_101652842 144
297 3300028380 Ga0268265_10033283 Ga0268265_100332833 144
298 3300028380 Ga0268265_11163163 Ga0268265_111631631 144
299 3300028381 Ga0268264_10007568 Ga0268264_100075682 144
300 3300028381 Ga0268264_11504629 Ga0268264_115046292 144
301 3300031548 Ga0307408_100053512 Ga0307408_1000535126 144
302 3300031548 Ga0307408_100073308 Ga0307408_1000733082 144
303 3300031731 Ga0307405_10027768 Ga0307405_100277686 144
304 3300031731 Ga0307405_10031244 Ga0307405_100312445 144
305 3300031824 Ga0307413_10033794 Ga0307413_100337942 144
306 3300031824 Ga0307413_10049720 Ga0307413_100497202 144
307 3300031824 Ga0307413_10063616 Ga0307413_100636162 144
308 3300031824 Ga0307413_10078320 Ga0307413_100783204 144
309 3300031852 Ga0307410_10001421 Ga0307410_1000142111 144
310 3300031901 Ga0307406_10025209 Ga0307406_100252092 144
311 3300031901 Ga0307406_10062737 Ga0307406_100627372 144
312 3300031901 Ga0307406_10099280 Ga0307406_100992802 144
313 3300031903 Ga0307407_10024538 Ga0307407_100245385 144
314 3300031911 Ga0307412_10074629 Ga0307412_100746292 144
315 3300031995 Ga0307409_100071253 Ga0307409_1000712533 144
316 3300031995 Ga0307409_100171514 Ga0307409_1001715142 144
317 3300031995 Ga0307409_100173367 Ga0307409_1001733673 144
318 3300031995 Ga0307409_100255206 Ga0307409_1002552063 144
319 3300031995 Ga0307409_100368997 Ga0307409_1003689972 144
320 3300032002 Ga0307416_100007825 Ga0307416_1000078256 144
321 3300032002 Ga0307416_100025794 Ga0307416_1000257945 144
322 3300032002 Ga0307416_100498792 Ga0307416_1004987923 144
323 3300032002 Ga0307416_100812160 Ga0307416_1008121602 144
324 3300032004 Ga0307414_10018503 Ga0307414_100185032 144
325 3300032004 Ga0307414_10065054 Ga0307414_100650542 144
326 3300032004 Ga0307414_10277856 Ga0307414_102778562 144
327 3300032004 Ga0307414_11125743 Ga0307414_111257432 144
328 3300032005 Ga0307411_10051027 Ga0307411_100510272 144
329 3300032005 Ga0307411_10071186 Ga0307411_100711862 144
330 3300032005 Ga0307411_10090557 Ga0307411_100905572 144
331 3300032126 Ga0307415_100005227 Ga0307415_10000522710 144
332 3300032126 Ga0307415_100320569 Ga0307415_1003205692 144
333 3300032126 Ga0307415_100702648 Ga0307415_1007026482 144
334 3300035088 Ga0373940_0050418 Ga0373940_0050418_469_903 144
335 3300035090 Ga0373949_0018815 Ga0373949_0018815_479_913 144
336 3300042014 Ga0439457_017442 Ga0439457_017442_57_491 144
337 3300042156 Ga0439446_0258326 Ga0439446_0258326_157_591 144
338 3300042876 Ga0451577_0082732 Ga0451577_0082732_300_737 144
339 3300044712 Ga0453684_0139282 Ga0453684_0139282_1533_1970 144
340 3300045051 Ga0451576_0042056 Ga0451576_0042056_931_1368 144
341 3300046455 Ga0495603_0222350 Ga0495603_0222350_127_564 144
342 3300046616 Ga0495668_0194816 Ga0495668_0194816_139_573 144
343 3300048906 Ga0496103_0898704 Ga0496103_0898704_16_450 144
344 3300048909 Ga0496106_0059903 Ga0496106_0059903_810_1247 144
345 3300048909 Ga0496106_0352009 Ga0496106_0352009_614_1048 144
346 3300048917 Ga0496114_0020610 Ga0496114_0020610_3234_3671 144
347 3300048917 Ga0496114_1240245 Ga0496114_1240245_149_583 144
348 3300049583 Ga0501067_0035994 Ga0501067_0035994_518_952 144
349 3300050507 nmdc:mga05p37_1266840_c1 nmdc:mga05p37_1266840_c1_69_503 144
350 3300050510 nmdc:mga06r32_10243_c1 nmdc:mga06r32_10243_c1_5618_6052 144
351 3300050511 nmdc:mga08y16_704013_c1 nmdc:mga08y16_704013_c1_50_484 144
352 3300050515 nmdc:mga0a205_829720_c1 nmdc:mga0a205_829720_c1_92_526 144
353 3300061734 Ga0530510_0171310 Ga0530510_0171310_1011_1445 144
354 3300006914 Ga0075436_100202707 Ga0075436_1002027073 145
355 3300009147 Ga0114129_10776182 Ga0114129_107761822 145
356 3300025906 Ga0207699_10443178 Ga0207699_104431782 145
357 3300038443 Ga0395901_0988406 Ga0395901_0988406_181_639 145
358 3300059421 Ga0590071_007153 Ga0590071_007153_198_635 145
359 3300059424 Ga0590075_089857 Ga0590075_089857_221_658 145
360 3300059426 Ga0590077_020162 Ga0590077_020162_450_887 145
361 3300042876 Ga0451577_0486050 Ga0451577_0486050_129_572 147
362 3300046461 Ga0495641_0484135 Ga0495641_0484135_97_549 147
363 3300006852 Ga0075433_11590679 Ga0075433_115906791 150
364 3300048903 Ga0496100_0125368 Ga0496100_0125368_1163_1624 150
365 3300048904 Ga0496101_0051495 Ga0496101_0051495_139_600 150
366 3300048909 Ga0496106_0045699 Ga0496106_0045699_2706_3167 150
367 3300048911 Ga0496108_0008066 Ga0496108_0008066_3564_4025 150
368 3300048912 Ga0496109_0015661 Ga0496109_0015661_3554_4015 150
369 3300048913 Ga0496110_0003328 Ga0496110_0003328_89_550 150
370 3300048914 Ga0496111_0010557 Ga0496111_0010557_3429_3890 150
371 3300048915 Ga0496112_0890090 Ga0496112_0890090_89_550 150
372 3300048916 Ga0496113_0022916 Ga0496113_0022916_527_988 150
373 3300050507 nmdc:mga05p37_443686_c2 nmdc:mga05p37_443686_c2_103_555 150
374 3300048903 Ga0496100_0400115 Ga0496100_0400115_328_795 152
375 3300005445 Ga0070708_100476134 Ga0070708_1004761342 154
376 2162886012 MBSR1b_contig_8174435 MBSR1b_0061.00003670 155
377 3300005444 Ga0070694_100206397 Ga0070694_1002063972 155
378 3300005518 Ga0070699_100004735 Ga0070699_10000473510 155
379 3300005536 Ga0070697_100010131 Ga0070697_1000101315 155
380 3300005545 Ga0070695_100108589 Ga0070695_1001085892 155
381 3300005546 Ga0070696_100000578 Ga0070696_10000057822 155
382 3300005549 Ga0070704_100349199 Ga0070704_1003491992 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

6

132

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nv5-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.8052 4 133
4nv5-assembly2.cif.gz_B c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.7959 3 133
3kp9-assembly1.cif.gz_A structure of a bacterial homolog of vitamin k epoxide reductase 0.7819 4 133
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.7801 4 133
4nv6-assembly1.cif.gz_A c212a mutant of synechococcus vkor 0.768 4 133
ID Description Score Start End Superfamily
3kp9A01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8167 4 133 1.20.1440.130
4nv5A01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8052 4 133 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7757 3 137 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7618 3 135 1.20.1440.130
af_Q54V87_14_188_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7598 3 142 1.20.1440.130
ID Description Score Start End GO Terms
AF-A0A2V7S9F4-F1-model_v4 Vitamin K epoxide reductase 0.8934 1 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A7Y5PBN3-F1-model_v4 Vitamin K epoxide reductase family protein 0.8867 1 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A7W1UIM1-F1-model_v4 Vitamin K epoxide reductase family protein 0.8855 2 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A2V7IKM4-F1-model_v4 Vitamin K epoxide reductase 0.8853 1 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A800F7U1-F1-model_v4 Vitamin K epoxide reductase family protein 0.8835 1 137 GO:0016020
GO:0016491
GO:0048038

Feature Viewer

pLDDT pTM Quality
75.02 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map