F428799

General Info

Members Datasets Scaffolds Average Seq Length
380 242 760 142

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0499074|Ga0501069_0499074_180_680
Length 166
Sequence MWRVPPGTEGHPGLSRLDESKEEGMTTARDIMSGGAECASENDSLVDAARKMRDLGVGSLPICGEDDRLKGVITDRDIVVNCIAEGGDPSTARVSEMADGKPVTIGADDSIDEILRTMTEHAVRRLPVIDGHQLVGIVSQADVAKNLPEDKVGDLVQAISSDPANG

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
167 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
168 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
173 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
213 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
240 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
241 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
242 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 5.79
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 4.74
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0499074 3300049585 Bacteria 726
2 JGI24746J21847_1010286 3300001977 Bacteria 1385
3 JGI24738J21930_10010194 3300002075 Bacteria 2097
4 JGI24742J22300_10055487 3300002244 Bacteria 723
5 JGI25406J46586_10025544 3300003203 Bacteria 2292
6 Ga0007416J51690_1018505 3300003577 Bacteria 506
7 Ga0070658_10085843 3300005327 Bacteria 2589
8 Ga0070658_10277596 3300005327 Bacteria 1426
9 Ga0070676_10461342 3300005328 Bacteria 895
10 Ga0070683_100016808 3300005329 Bacteria 6455
11 Ga0070683_100021090 3300005329 Bacteria 5811
12 Ga0070683_100023394 3300005329 Bacteria 5527
13 Ga0070683_100286167 3300005329 Bacteria 1568
14 Ga0070683_101287417 3300005329 Bacteria 703
15 Ga0070670_100536255 3300005331 Bacteria 1043
16 Ga0068869_100699677 3300005334 Bacteria 864
17 Ga0070682_100050828 3300005337 Bacteria 2590
18 Ga0070682_100291965 3300005337 Bacteria 1193
19 Ga0068868_100265566 3300005338 Bacteria 1449
20 Ga0070660_100007778 3300005339 Bacteria 7474
21 Ga0070689_100078590 3300005340 Bacteria 2587
22 Ga0070691_10452718 3300005341 Bacteria 733
23 Ga0070687_100108145 3300005343 Bacteria 1569
24 Ga0070661_100309943 3300005344 Bacteria 1230
25 Ga0070692_11182944 3300005345 Bacteria 543
26 Ga0070668_102129039 3300005347 Bacteria 518
27 Ga0070675_100324148 3300005354 Bacteria 1361
28 Ga0070671_100474046 3300005355 Bacteria 1075
29 Ga0070671_101439739 3300005355 Bacteria 609
30 Ga0070674_100099639 3300005356 Bacteria 2114
31 Ga0070674_100497518 3300005356 Bacteria 1015
32 Ga0070674_101674418 3300005356 Bacteria 575
33 Ga0070673_100030305 3300005364 Bacteria 4046
34 Ga0070659_100061185 3300005366 Bacteria 2975
35 Ga0070659_100152613 3300005366 Bacteria 1885
36 Ga0070667_100512768 3300005367 Bacteria 1100
37 Ga0070701_10039387 3300005438 Bacteria 2397
38 Ga0070700_100042664 3300005441 Bacteria 2787
39 Ga0070700_100167326 3300005441 Bacteria 1519
40 Ga0070700_100706752 3300005441 Bacteria 802
41 Ga0070694_100582495 3300005444 Bacteria 899
42 Ga0070663_100019992 3300005455 Bacteria 4424
43 Ga0070678_100347135 3300005456 Bacteria 1275
44 Ga0068867_100101727 3300005459 Bacteria 2196
45 Ga0068867_100824456 3300005459 Bacteria 829
46 Ga0068867_100986632 3300005459 Bacteria 763
47 Ga0070685_10055607 3300005466 Bacteria 2299
48 Ga0070684_100039716 3300005535 Bacteria 4049
49 Ga0070684_100114303 3300005535 Bacteria 2423
50 Ga0068853_100011393 3300005539 Bacteria 7222
51 Ga0068853_100020245 3300005539 Bacteria 5531
52 Ga0070672_100031136 3300005543 Bacteria 4013
53 Ga0070672_100272429 3300005543 Bacteria 1430
54 Ga0070686_100261902 3300005544 Bacteria 1268
55 Ga0070693_100241546 3300005547 Bacteria 1193
56 Ga0070693_100591096 3300005547 Bacteria 800
57 Ga0070704_100059118 3300005549 Bacteria 2733
58 Ga0070704_100177367 3300005549 Bacteria 1701
59 Ga0070664_100344564 3300005564 Bacteria 1354
60 Ga0068857_101115196 3300005577 Bacteria 762
61 Ga0068854_100048838 3300005578 Bacteria 3021
62 Ga0068854_100086098 3300005578 Bacteria 2329
63 Ga0070702_100249715 3300005615 Bacteria 1202
64 Ga0070702_100613987 3300005615 Bacteria 817
65 Ga0068852_100017316 3300005616 Bacteria 5650
66 Ga0068852_100034956 3300005616 Bacteria 4186
67 Ga0068852_100076382 3300005616 Bacteria 2957
68 Ga0068859_100657725 3300005617 Bacteria 1140
69 Ga0068864_100422814 3300005618 Bacteria 1270
70 Ga0068866_10003998 3300005718 Bacteria 6054
71 Ga0068866_11263153 3300005718 Bacteria 535
72 Ga0068861_100051043 3300005719 Bacteria 3138
73 Ga0068861_100891820 3300005719 Bacteria 841
74 Ga0068851_10065140 3300005834 Bacteria 1874
75 Ga0068851_10228618 3300005834 Bacteria 1048
76 Ga0068870_10079123 3300005840 Bacteria 1812
77 Ga0068858_100068043 3300005842 Bacteria 3299
78 Ga0068860_100601322 3300005843 Bacteria 1105
79 Ga0068862_100898310 3300005844 Bacteria 871
80 Ga0081455_10026781 3300005937 Bacteria 5294
81 Ga0081539_10001973 3300005985 Bacteria 31246
82 Ga0075365_10010630 3300006038 Bacteria 5373
83 Ga0075363_100000942 3300006048 Bacteria 10319
84 Ga0075364_10455552 3300006051 Bacteria 874
85 Ga0075364_10640267 3300006051 Bacteria 726
86 Ga0075364_10752551 3300006051 Bacteria 665
87 Ga0075370_10057310 3300006353 Bacteria 2214
88 Ga0075428_100498249 3300006844 Bacteria 1303
89 Ga0075428_101730632 3300006844 Bacteria 652
90 Ga0075430_100148629 3300006846 Bacteria 1951
91 Ga0075433_10003000 3300006852 Bacteria 12965
92 Ga0068865_100092651 3300006881 Bacteria 2196
93 Ga0068865_101057129 3300006881 Bacteria 713
94 Ga0075436_100022854 3300006914 Bacteria 4296
95 Ga0097620_100657737 3300006931 Bacteria 1140
96 Ga0075435_100000409 3300007076 Bacteria 26383
97 Ga0111539_10056680 3300009094 Bacteria 4656
98 Ga0111539_10150358 3300009094 Bacteria 2725
99 Ga0111539_10276312 3300009094 Bacteria 1955
100 Ga0105245_10011914 3300009098 Bacteria 7561
101 Ga0105245_10018523 3300009098 Bacteria 6089
102 Ga0105245_10148660 3300009098 Bacteria 2213
103 Ga0105245_10531190 3300009098 Bacteria 1196
104 Ga0105243_10242860 3300009148 Bacteria 1603
105 Ga0105243_10250469 3300009148 Bacteria 1581
106 Ga0105243_10692303 3300009148 Bacteria 992
107 Ga0105242_10091232 3300009176 Bacteria 2564
108 Ga0105242_10306678 3300009176 Bacteria 1451
109 Ga0105248_10022992 3300009177 Bacteria 6924
110 Ga0105248_10740532 3300009177 Bacteria 1109
111 Ga0105237_10119139 3300009545 Bacteria 2634
112 Ga0105238_10596803 3300009551 Bacteria 1112
113 Ga0105249_10061768 3300009553 Bacteria 3439
114 Ga0105239_10064452 3300010375 Bacteria 4023
115 Ga0105246_10058617 3300011119 Bacteria 2668
116 Ga0157371_10294905 3300013102 Bacteria 1173
117 Ga0157374_10519679 3300013296 Bacteria 1196
118 Ga0157374_11595656 3300013296 Bacteria 676
119 Ga0157372_10031341 3300013307 Bacteria 5823
120 Ga0157372_10264435 3300013307 Bacteria 1997
121 Ga0157372_12106448 3300013307 Bacteria 648
122 Ga0157372_12641461 3300013307 Bacteria 576
123 Ga0157375_11512972 3300013308 Bacteria 792
124 Ga0157375_11897519 3300013308 Bacteria 707
125 Ga0163163_11274853 3300014325 Bacteria 797
126 Ga0157380_10019243 3300014326 Bacteria 5087
127 Ga0157380_10274260 3300014326 Bacteria 1539
128 Ga0157380_11889449 3300014326 Bacteria 657
129 Ga0157380_11898330 3300014326 Bacteria 656
130 Ga0157377_10010107 3300014745 Bacteria 4655
131 Ga0157377_10634923 3300014745 Bacteria 766
132 Ga0157379_10106297 3300014968 Bacteria 2519
133 Ga0197907_10481511 3300020069 Bacteria 858
134 Ga0197907_11301561 3300020069 Bacteria 591
135 Ga0206356_11251539 3300020070 Bacteria 513
136 Ga0206349_1484499 3300020075 Bacteria 500
137 Ga0206349_1563232 3300020075 Bacteria 957
138 Ga0206349_1747054 3300020075 Bacteria 730
139 Ga0206352_10958898 3300020078 Bacteria 584
140 Ga0206350_11031720 3300020080 Bacteria 960
141 Ga0206354_10154495 3300020081 Bacteria 914
142 Ga0206354_10263196 3300020081 Bacteria 595
143 Ga0206354_11478461 3300020081 Bacteria 523
144 Ga0206354_11599383 3300020081 Bacteria 558
145 Ga0206353_10315984 3300020082 Bacteria 601
146 Ga0154015_1310272 3300020610 Bacteria 517
147 Ga0224712_10067502 3300022467 Bacteria 1443
148 Ga0224712_10557868 3300022467 Bacteria 557
149 Ga0224712_10663473 3300022467 Bacteria 512
150 Ga0207656_10123498 3300025321 Bacteria 1207
151 Ga0207656_10167883 3300025321 Bacteria 1048
152 Ga0207642_10100257 3300025899 Bacteria 1452
153 Ga0207642_10938350 3300025899 Bacteria 555
154 Ga0207710_10378890 3300025900 Bacteria 724
155 Ga0207688_10002868 3300025901 Bacteria 9365
156 Ga0207688_10626130 3300025901 Bacteria 679
157 Ga0207647_10023009 3300025904 Bacteria 4130
158 Ga0207645_10295925 3300025907 Bacteria 1077
159 Ga0207643_10001963 3300025908 Bacteria 11342
160 Ga0207643_10066409 3300025908 Bacteria 2068
161 Ga0207705_10032669 3300025909 Bacteria 3720
162 Ga0207705_10229261 3300025909 Bacteria 1412
163 Ga0207705_10413794 3300025909 Bacteria 1043
164 Ga0207662_10022565 3300025918 Bacteria 3609
165 Ga0207662_10153145 3300025918 Bacteria 1468
166 Ga0207657_10002646 3300025919 Bacteria 19334
167 Ga0207649_10364193 3300025920 Bacteria 1073
168 Ga0207649_10385433 3300025920 Bacteria 1045
169 Ga0207649_10641248 3300025920 Bacteria 820
170 Ga0207681_10325879 3300025923 Bacteria 1223
171 Ga0207694_10481373 3300025924 Bacteria 1038
172 Ga0207659_10247197 3300025926 Bacteria 1446
173 Ga0207687_10889772 3300025927 Bacteria 762
174 Ga0207690_10039796 3300025932 Bacteria 3069
175 Ga0207690_10056378 3300025932 Bacteria 2650
176 Ga0207690_10081815 3300025932 Bacteria 2258
177 Ga0207706_10035924 3300025933 Bacteria 4403
178 Ga0207686_10157237 3300025934 Bacteria 1589
179 Ga0207709_11201098 3300025935 Bacteria 625
180 Ga0207709_11345293 3300025935 Bacteria 591
181 Ga0207670_10260838 3300025936 Bacteria 1343
182 Ga0207670_11185556 3300025936 Bacteria 646
183 Ga0207669_10054201 3300025937 Bacteria 2421
184 Ga0207669_10078498 3300025937 Bacteria 2104
185 Ga0207704_10024926 3300025938 Bacteria 3255
186 Ga0207691_10012640 3300025940 Bacteria 8089
187 Ga0207691_10095595 3300025940 Bacteria 2657
188 Ga0207711_10239744 3300025941 Bacteria 1662
189 Ga0207689_10457043 3300025942 Bacteria 1068
190 Ga0207689_11010506 3300025942 Bacteria 701
191 Ga0207661_10094184 3300025944 Bacteria 2501
192 Ga0207661_10110418 3300025944 Bacteria 2325
193 Ga0207661_10279223 3300025944 Bacteria 1492
194 Ga0207661_10281035 3300025944 Bacteria 1488
195 Ga0207661_10465686 3300025944 Bacteria 1152
196 Ga0207661_10813773 3300025944 Bacteria 860
197 Ga0207661_11064517 3300025944 Bacteria 745
198 Ga0207679_10043640 3300025945 Bacteria 3230
199 Ga0207679_11418753 3300025945 Bacteria 637
200 Ga0207651_10189896 3300025960 Bacteria 1638
201 Ga0207712_10097433 3300025961 Bacteria 2179
202 Ga0207712_11691217 3300025961 Bacteria 567
203 Ga0207668_11152652 3300025972 Bacteria 696
204 Ga0207640_10081007 3300025981 Bacteria 2218
205 Ga0207658_10268194 3300025986 Bacteria 1458
206 Ga0207703_10499145 3300026035 Bacteria 1142
207 Ga0207639_10104847 3300026041 Bacteria 2293
208 Ga0207678_10031214 3300026067 Bacteria 4648
209 Ga0207678_10439929 3300026067 Bacteria 1132
210 Ga0207708_10024084 3300026075 Bacteria 4603
211 Ga0207708_10062177 3300026075 Bacteria 2852
212 Ga0207708_11272204 3300026075 Bacteria 644
213 Ga0207641_10228133 3300026088 Bacteria 1730
214 Ga0207648_10007808 3300026089 Bacteria 10448
215 Ga0207648_10035129 3300026089 Bacteria 4417
216 Ga0207648_10490072 3300026089 Bacteria 1124
217 Ga0207676_10132307 3300026095 Bacteria 2123
218 Ga0207674_10246668 3300026116 Bacteria 1733
219 Ga0207675_100004690 3300026118 Bacteria 13164
220 Ga0207675_100133476 3300026118 Bacteria 2354
221 Ga0207675_100833167 3300026118 Bacteria 937
222 Ga0207683_10549212 3300026121 Bacteria 1068
223 Ga0207698_10086429 3300026142 Bacteria 2550
224 Ga0207698_10327645 3300026142 Bacteria 1437
225 Ga0207428_10116921 3300027907 Bacteria 2047
226 Ga0268265_10256190 3300028380 Bacteria 1553
227 Ga0268265_10857881 3300028380 Bacteria 889
228 Ga0268264_10216529 3300028381 Bacteria 1761
229 Ga0307408_100087904 3300031548 Bacteria 2340
230 Ga0307408_100201735 3300031548 Bacteria 1610
231 Ga0307405_10078156 3300031731 Bacteria 2153
232 Ga0307405_10105617 3300031731 Bacteria 1897
233 Ga0307405_10329216 3300031731 Bacteria 1170
234 Ga0307413_10259601 3300031824 Unclassified 1294
235 Ga0307413_10551556 3300031824 Bacteria 935
236 Ga0307410_10000161 3300031852 Bacteria 24339
237 Ga0307410_10946451 3300031852 Bacteria 740
238 Ga0307410_10989642 3300031852 Bacteria 725
239 Ga0307406_10077882 3300031901 Bacteria 2194
240 Ga0307406_10193715 3300031901 Bacteria 1490
241 Ga0307406_10316666 3300031901 Bacteria 1205
242 Ga0307407_10011050 3300031903 Bacteria 4281
243 Ga0307407_10267737 3300031903 Bacteria 1178
244 Ga0307412_10074283 3300031911 Bacteria 2329
245 Ga0307412_10984847 3300031911 Bacteria 744
246 Ga0307409_100004330 3300031995 Bacteria 7954
247 Ga0307409_100219367 3300031995 Bacteria 1716
248 Ga0307409_100236300 3300031995 Bacteria 1660
249 Ga0307409_100247416 3300031995 Bacteria 1628
250 Ga0307409_100898932 3300031995 Bacteria 899
251 Ga0307409_101987022 3300031995 Bacteria 611
252 Ga0307416_100000094 3300032002 Bacteria 59035
253 Ga0307416_100025657 3300032002 Bacteria 4325
254 Ga0307416_100252803 3300032002 Bacteria 1717
255 Ga0307416_101147337 3300032002 Bacteria 882
256 Ga0307416_103519983 3300032002 Bacteria 524
257 Ga0307414_10101951 3300032004 Bacteria 2162
258 Ga0307414_10104169 3300032004 Bacteria 2142
259 Ga0307411_10014827 3300032005 Bacteria 4353
260 Ga0307411_10079854 3300032005 Bacteria 2248
261 Ga0307411_10157279 3300032005 Bacteria 1697
262 Ga0307411_10423183 3300032005 Bacteria 1107
263 Ga0307415_100002165 3300032126 Bacteria 9737
264 Ga0307415_100254079 3300032126 Bacteria 1430
265 Ga0307415_100270336 3300032126 Bacteria 1392
266 Ga0307415_100957509 3300032126 Bacteria 793
267 Ga0307415_101238487 3300032126 Bacteria 704
268 Ga0373925_1539849 3300037068 Bacteria 544
269 Ga0395899_0251969 3300037312 Bacteria 1211
270 Ga0395899_0800585 3300037312 Bacteria 582
271 Ga0395900_0290933 3300037418 Bacteria 1622
272 Ga0395900_0458796 3300037418 Bacteria 1229
273 Ga0395898_0408495 3300037466 Bacteria 1294
274 Ga0395905_0178437 3300037471 Bacteria 1994
275 Ga0395905_0257841 3300037471 Bacteria 1628
276 Ga0395901_0052557 3300038443 Bacteria 4234
277 Ga0395901_0137957 3300038443 Bacteria 2563
278 Ga0439465_0184880 3300041413 Bacteria 755
279 Ga0451791_1701894 3300041451 Bacteria 630
280 Ga0451793_1292107 3300041452 Bacteria 890
281 Ga0451802_1128159 3300041460 Bacteria 547
282 Ga0451807_2398805 3300041486 Bacteria 601
283 Ga0451849_0736314 3300041505 Bacteria 622
284 Ga0451853_1855989 3300041512 Bacteria 536
285 Ga0451853_2251444 3300041512 Bacteria 5628
286 Ga0439431_0009270 3300041997 Bacteria 2221
287 Ga0439442_010427 3300042002 Bacteria 1884
288 Ga0450915_008485 3300042119 Bacteria 688
289 Ga0450888_003825 3300042126 Bacteria 1545
290 Ga0439446_0074992 3300042156 Bacteria 1040
291 Ga0439434_0024247 3300042435 Bacteria 1829
292 Ga0439435_0168312 3300042436 Bacteria 711
293 Ga0439444_0020009 3300042437 Bacteria 1174
294 Ga0439440_0011541 3300042993 Bacteria 1864
295 Ga0466960_0706706 3300044901 Bacteria 605
296 Ga0495596_0361008 3300046500 Bacteria 566
297 Ga0495620_0157050 3300046515 Bacteria 885
298 Ga0495631_0188299 3300046518 Bacteria 884
299 Ga0495644_0119743 3300046523 Bacteria 1001
300 Ga0495598_0071831 3300046537 Unclassified 1092
301 Ga0495597_0229097 3300046542 Unclassified 736
302 Ga0495660_0406848 3300046810 Unclassified 595
303 Ga0495677_0236857 3300047445 Bacteria 713
304 Ga0496100_1092106 3300048903 Bacteria 629
305 Ga0496102_0458237 3300048905 Bacteria 1196
306 Ga0496106_0402217 3300048909 Bacteria 1100
307 Ga0496107_0181092 3300048910 Bacteria 1565
308 Ga0496107_0609519 3300048910 Bacteria 806
309 Ga0496108_0018568 3300048911 Bacteria 5696
310 Ga0496108_0284184 3300048911 Bacteria 1440
311 Ga0496108_0642603 3300048911 Bacteria 923
312 Ga0496109_0040602 3300048912 Bacteria 4214
313 Ga0496109_0093809 3300048912 Bacteria 2778
314 Ga0496109_0362286 3300048912 Bacteria 1370
315 Ga0496110_0335954 3300048913 Bacteria 1376
316 Ga0496113_0587686 3300048916 Bacteria 892
317 Ga0496114_0267798 3300048917 Bacteria 1505
318 Ga0496119_0001137 3300048922 Bacteria 33415
319 Ga0501311_024959 3300049527 Bacteria 835
320 Ga0501031_0061823 3300049568 Bacteria 2440
321 Ga0501032_0254239 3300049569 Bacteria 1140
322 Ga0501033_1025014 3300049570 Bacteria 551
323 Ga0501036_0048001 3300049572 Bacteria 3615
324 Ga0501037_0767373 3300049573 Bacteria 638
325 Ga0501038_0282342 3300049574 Bacteria 1307
326 Ga0501039_0194259 3300049575 Bacteria 1596
327 Ga0501040_0246601 3300049576 Bacteria 1274
328 Ga0501040_0389292 3300049576 Bacteria 1000
329 Ga0501041_0055820 3300049577 Bacteria 2412
330 Ga0501041_0680418 3300049577 Bacteria 658
331 Ga0501043_0205360 3300049579 Bacteria 1528
332 Ga0501046_0409125 3300049580 Bacteria 979
333 Ga0501068_0301855 3300049584 Bacteria 1025
334 Ga0501070_0996197 3300049586 Bacteria 650
335 Ga0501070_1084723 3300049586 Bacteria 618
336 Ga0501071_0053461 3300049587 Bacteria 2913
337 Ga0501071_0165647 3300049587 Bacteria 1654
338 Ga0501072_0020727 3300049588 Bacteria 5095
339 Ga0501072_0061236 3300049588 Bacteria 2967
340 Ga0501074_0298675 3300049590 Bacteria 1144
341 Ga0501075_0015399 3300049591 Bacteria 5488
342 Ga0501075_0559711 3300049591 Bacteria 872
343 Ga0501076_0066259 3300049592 Bacteria 2882
344 Ga0501076_0094567 3300049592 Bacteria 2406
345 Ga0501208_090494 3300049655 Bacteria 642
346 Ga0501211_043513 3300049658 Bacteria 541
347 Ga0501227_196561 3300049665 Bacteria 570
348 Ga0501256_025302 3300049685 Bacteria 644
349 Ga0501079_0007854 3300049741 Bacteria 8079
350 Ga0501079_0140014 3300049741 Bacteria 1885
351 Ga0501080_1112942 3300049742 Bacteria 681
352 Ga0501081_0148008 3300049743 Bacteria 1686
353 Ga0501081_0360210 3300049743 Bacteria 1073
354 Ga0501083_0360782 3300049744 Bacteria 945
355 Ga0501265_072928 3300049762 Bacteria 583
356 Ga0501035_0040552 3300049822 Bacteria 4206
357 Ga0501035_0459195 3300049822 Bacteria 1053
358 Ga0501045_0284622 3300049824 Bacteria 1230
359 Ga0501212_105429 3300049851 Bacteria 533
360 nmdc:mga0yw44_45909_c1 3300050492 Bacteria 2621
361 nmdc:mga07m45_242812_c1 3300050496 Bacteria 1048
362 nmdc:mga0qj67_28423_c1 3300050509 Bacteria 4340
363 nmdc:mga06r32_263_c3 3300050510 Bacteria 11424
364 nmdc:mga08y16_604628_c1 3300050511 Bacteria 1105
365 nmdc:mga08y16_67317_c1 3300050511 Bacteria 3736
366 nmdc:mga0rr50_144793_c1 3300050513 Bacteria 1915
367 Ga0495655_0371807 3300053083 Bacteria 503
368 Ga0500593_000080 3300053117 Bacteria 35767
369 Ga0501084_0061891 3300054114 Bacteria 3134
370 Ga0501084_0159365 3300054114 Bacteria 1904
371 Ga0587073_0212897 3300059492 Bacteria 586
372 Ga0587122_033610 3300059628 Bacteria 613
373 Ga0587128_076533 3300059630 Bacteria 662
374 Ga0501082_0019268 3300060353 Bacteria 5882
375 Ga0466962_0731591 3300061719 Bacteria 508
376 Ga0530510_0368037 3300061734 Bacteria 1081
377 2623585824 2622736626 Bacteria 7181580
378 2880497870 2880495981 Bacteria 7340502
379 2996225878 2996221748 Bacteria 6799777
380 8003836239 8003830390 Bacteria 6541657
381 Ga0501069_0499074
382 JGI24746J21847_1010286
383 JGI24738J21930_10010194
384 JGI24742J22300_10055487
385 JGI25406J46586_10025544
386 Ga0007416J51690_1018505
387 Ga0070658_10085843
388 Ga0070658_10277596
389 Ga0070676_10461342
390 Ga0070683_100016808
391 Ga0070683_100021090
392 Ga0070683_100023394
393 Ga0070683_100286167
394 Ga0070683_101287417
395 Ga0070670_100536255
396 Ga0068869_100699677
397 Ga0070682_100050828
398 Ga0070682_100291965
399 Ga0068868_100265566
400 Ga0070660_100007778
401 Ga0070689_100078590
402 Ga0070691_10452718
403 Ga0070687_100108145
404 Ga0070661_100309943
405 Ga0070692_11182944
406 Ga0070668_102129039
407 Ga0070675_100324148
408 Ga0070671_100474046
409 Ga0070671_101439739
410 Ga0070674_100099639
411 Ga0070674_100497518
412 Ga0070674_101674418
413 Ga0070673_100030305
414 Ga0070659_100061185
415 Ga0070659_100152613
416 Ga0070667_100512768
417 Ga0070701_10039387
418 Ga0070700_100042664
419 Ga0070700_100167326
420 Ga0070700_100706752
421 Ga0070694_100582495
422 Ga0070663_100019992
423 Ga0070678_100347135
424 Ga0068867_100101727
425 Ga0068867_100824456
426 Ga0068867_100986632
427 Ga0070685_10055607
428 Ga0070684_100039716
429 Ga0070684_100114303
430 Ga0068853_100011393
431 Ga0068853_100020245
432 Ga0070672_100031136
433 Ga0070672_100272429
434 Ga0070686_100261902
435 Ga0070693_100241546
436 Ga0070693_100591096
437 Ga0070704_100059118
438 Ga0070704_100177367
439 Ga0070664_100344564
440 Ga0068857_101115196
441 Ga0068854_100048838
442 Ga0068854_100086098
443 Ga0070702_100249715
444 Ga0070702_100613987
445 Ga0068852_100017316
446 Ga0068852_100034956
447 Ga0068852_100076382
448 Ga0068859_100657725
449 Ga0068864_100422814
450 Ga0068866_10003998
451 Ga0068866_11263153
452 Ga0068861_100051043
453 Ga0068861_100891820
454 Ga0068851_10065140
455 Ga0068851_10228618
456 Ga0068870_10079123
457 Ga0068858_100068043
458 Ga0068860_100601322
459 Ga0068862_100898310
460 Ga0081455_10026781
461 Ga0081539_10001973
462 Ga0075365_10010630
463 Ga0075363_100000942
464 Ga0075364_10455552
465 Ga0075364_10640267
466 Ga0075364_10752551
467 Ga0075370_10057310
468 Ga0075428_100498249
469 Ga0075428_101730632
470 Ga0075430_100148629
471 Ga0075433_10003000
472 Ga0068865_100092651
473 Ga0068865_101057129
474 Ga0075436_100022854
475 Ga0097620_100657737
476 Ga0075435_100000409
477 Ga0111539_10056680
478 Ga0111539_10150358
479 Ga0111539_10276312
480 Ga0105245_10011914
481 Ga0105245_10018523
482 Ga0105245_10148660
483 Ga0105245_10531190
484 Ga0105243_10242860
485 Ga0105243_10250469
486 Ga0105243_10692303
487 Ga0105242_10091232
488 Ga0105242_10306678
489 Ga0105248_10022992
490 Ga0105248_10740532
491 Ga0105237_10119139
492 Ga0105238_10596803
493 Ga0105249_10061768
494 Ga0105239_10064452
495 Ga0105246_10058617
496 Ga0157371_10294905
497 Ga0157374_10519679
498 Ga0157374_11595656
499 Ga0157372_10031341
500 Ga0157372_10264435
501 Ga0157372_12106448
502 Ga0157372_12641461
503 Ga0157375_11512972
504 Ga0157375_11897519
505 Ga0163163_11274853
506 Ga0157380_10019243
507 Ga0157380_10274260
508 Ga0157380_11889449
509 Ga0157380_11898330
510 Ga0157377_10010107
511 Ga0157377_10634923
512 Ga0157379_10106297
513 Ga0197907_10481511
514 Ga0197907_11301561
515 Ga0206356_11251539
516 Ga0206349_1484499
517 Ga0206349_1563232
518 Ga0206349_1747054
519 Ga0206352_10958898
520 Ga0206350_11031720
521 Ga0206354_10154495
522 Ga0206354_10263196
523 Ga0206354_11478461
524 Ga0206354_11599383
525 Ga0206353_10315984
526 Ga0154015_1310272
527 Ga0224712_10067502
528 Ga0224712_10557868
529 Ga0224712_10663473
530 Ga0207656_10123498
531 Ga0207656_10167883
532 Ga0207642_10100257
533 Ga0207642_10938350
534 Ga0207710_10378890
535 Ga0207688_10002868
536 Ga0207688_10626130
537 Ga0207647_10023009
538 Ga0207645_10295925
539 Ga0207643_10001963
540 Ga0207643_10066409
541 Ga0207705_10032669
542 Ga0207705_10229261
543 Ga0207705_10413794
544 Ga0207662_10022565
545 Ga0207662_10153145
546 Ga0207657_10002646
547 Ga0207649_10364193
548 Ga0207649_10385433
549 Ga0207649_10641248
550 Ga0207681_10325879
551 Ga0207694_10481373
552 Ga0207659_10247197
553 Ga0207687_10889772
554 Ga0207690_10039796
555 Ga0207690_10056378
556 Ga0207690_10081815
557 Ga0207706_10035924
558 Ga0207686_10157237
559 Ga0207709_11201098
560 Ga0207709_11345293
561 Ga0207670_10260838
562 Ga0207670_11185556
563 Ga0207669_10054201
564 Ga0207669_10078498
565 Ga0207704_10024926
566 Ga0207691_10012640
567 Ga0207691_10095595
568 Ga0207711_10239744
569 Ga0207689_10457043
570 Ga0207689_11010506
571 Ga0207661_10094184
572 Ga0207661_10110418
573 Ga0207661_10279223
574 Ga0207661_10281035
575 Ga0207661_10465686
576 Ga0207661_10813773
577 Ga0207661_11064517
578 Ga0207679_10043640
579 Ga0207679_11418753
580 Ga0207651_10189896
581 Ga0207712_10097433
582 Ga0207712_11691217
583 Ga0207668_11152652
584 Ga0207640_10081007
585 Ga0207658_10268194
586 Ga0207703_10499145
587 Ga0207639_10104847
588 Ga0207678_10031214
589 Ga0207678_10439929
590 Ga0207708_10024084
591 Ga0207708_10062177
592 Ga0207708_11272204
593 Ga0207641_10228133
594 Ga0207648_10007808
595 Ga0207648_10035129
596 Ga0207648_10490072
597 Ga0207676_10132307
598 Ga0207674_10246668
599 Ga0207675_100004690
600 Ga0207675_100133476
601 Ga0207675_100833167
602 Ga0207683_10549212
603 Ga0207698_10086429
604 Ga0207698_10327645
605 Ga0207428_10116921
606 Ga0268265_10256190
607 Ga0268265_10857881
608 Ga0268264_10216529
609 Ga0307408_100087904
610 Ga0307408_100201735
611 Ga0307405_10078156
612 Ga0307405_10105617
613 Ga0307405_10329216
614 Ga0307413_10259601
615 Ga0307413_10551556
616 Ga0307410_10000161
617 Ga0307410_10946451
618 Ga0307410_10989642
619 Ga0307406_10077882
620 Ga0307406_10193715
621 Ga0307406_10316666
622 Ga0307407_10011050
623 Ga0307407_10267737
624 Ga0307412_10074283
625 Ga0307412_10984847
626 Ga0307409_100004330
627 Ga0307409_100219367
628 Ga0307409_100236300
629 Ga0307409_100247416
630 Ga0307409_100898932
631 Ga0307409_101987022
632 Ga0307416_100000094
633 Ga0307416_100025657
634 Ga0307416_100252803
635 Ga0307416_101147337
636 Ga0307416_103519983
637 Ga0307414_10101951
638 Ga0307414_10104169
639 Ga0307411_10014827
640 Ga0307411_10079854
641 Ga0307411_10157279
642 Ga0307411_10423183
643 Ga0307415_100002165
644 Ga0307415_100254079
645 Ga0307415_100270336
646 Ga0307415_100957509
647 Ga0307415_101238487
648 Ga0373925_1539849
649 Ga0395899_0251969
650 Ga0395899_0800585
651 Ga0395900_0290933
652 Ga0395900_0458796
653 Ga0395898_0408495
654 Ga0395905_0178437
655 Ga0395905_0257841
656 Ga0395901_0052557
657 Ga0395901_0137957
658 Ga0439465_0184880
659 Ga0451791_1701894
660 Ga0451793_1292107
661 Ga0451802_1128159
662 Ga0451807_2398805
663 Ga0451849_0736314
664 Ga0451853_1855989
665 Ga0451853_2251444
666 Ga0439431_0009270
667 Ga0439442_010427
668 Ga0450915_008485
669 Ga0450888_003825
670 Ga0439446_0074992
671 Ga0439434_0024247
672 Ga0439435_0168312
673 Ga0439444_0020009
674 Ga0439440_0011541
675 Ga0466960_0706706
676 Ga0495596_0361008
677 Ga0495620_0157050
678 Ga0495631_0188299
679 Ga0495644_0119743
680 Ga0495598_0071831
681 Ga0495597_0229097
682 Ga0495660_0406848
683 Ga0495677_0236857
684 Ga0496100_1092106
685 Ga0496102_0458237
686 Ga0496106_0402217
687 Ga0496107_0181092
688 Ga0496107_0609519
689 Ga0496108_0018568
690 Ga0496108_0284184
691 Ga0496108_0642603
692 Ga0496109_0040602
693 Ga0496109_0093809
694 Ga0496109_0362286
695 Ga0496110_0335954
696 Ga0496113_0587686
697 Ga0496114_0267798
698 Ga0496119_0001137
699 Ga0501311_024959
700 Ga0501031_0061823
701 Ga0501032_0254239
702 Ga0501033_1025014
703 Ga0501036_0048001
704 Ga0501037_0767373
705 Ga0501038_0282342
706 Ga0501039_0194259
707 Ga0501040_0246601
708 Ga0501040_0389292
709 Ga0501041_0055820
710 Ga0501041_0680418
711 Ga0501043_0205360
712 Ga0501046_0409125
713 Ga0501068_0301855
714 Ga0501070_0996197
715 Ga0501070_1084723
716 Ga0501071_0053461
717 Ga0501071_0165647
718 Ga0501072_0020727
719 Ga0501072_0061236
720 Ga0501074_0298675
721 Ga0501075_0015399
722 Ga0501075_0559711
723 Ga0501076_0066259
724 Ga0501076_0094567
725 Ga0501208_090494
726 Ga0501211_043513
727 Ga0501227_196561
728 Ga0501256_025302
729 Ga0501079_0007854
730 Ga0501079_0140014
731 Ga0501080_1112942
732 Ga0501081_0148008
733 Ga0501081_0360210
734 Ga0501083_0360782
735 Ga0501265_072928
736 Ga0501035_0040552
737 Ga0501035_0459195
738 Ga0501045_0284622
739 Ga0501212_105429
740 nmdc:mga0yw44_45909_c1
741 nmdc:mga07m45_242812_c1
742 nmdc:mga0qj67_28423_c1
743 nmdc:mga06r32_263_c3
744 nmdc:mga08y16_604628_c1
745 nmdc:mga08y16_67317_c1
746 nmdc:mga0rr50_144793_c1
747 Ga0495655_0371807
748 Ga0500593_000080
749 Ga0501084_0061891
750 Ga0501084_0159365
751 Ga0587073_0212897
752 Ga0587122_033610
753 Ga0587128_076533
754 Ga0501082_0019268
755 Ga0466962_0731591
756 Ga0530510_0368037
757 2623585824
758 2880497870
759 2996225878
760 8003836239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

28

82

0.96

PF00571

CBS

CBS domain

94

149

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xkf-assembly2.cif.gz_A crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions 0.9445 2 124
1xkf-assembly2.cif.gz_A crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions 0.9371 2 124
1xkf-assembly1.cif.gz_B-2 crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions 0.9061 1 123
2o16-assembly2.cif.gz_B crystal structure of a putative acetoin utilization protein (acub) from vibrio cholerae 0.9038 1 122
1vr9-assembly2.cif.gz_B crystal structure of a cbs domain pair/act domain protein (tm0892) from thermotoga maritima at 1.70 a resolution 0.9012 2 122
ID Description Score Start End Superfamily
1y5hB00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9212 2 123 3.10.580.10
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9151 2 122 3.10.580.10
1y5hB00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9139 2 123 3.10.580.10
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9095 1 121 3.10.580.10
af_Q2FXM2_188_307_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9087 2 122 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A6N7EK84-F1-model_v4 CBS domain-containing protein 0.9685 1 122
AF-A0A4U6QJY1-F1-model_v4 CBS domain-containing protein 0.9538 2 122
AF-A0A852Z2J2-F1-model_v4 CBS domain-containing protein 0.9515 3 138
AF-A0A7W1V3N4-F1-model_v4 CBS domain-containing protein 0.9505 1 122
AF-A0A0Q7K9B6-F1-model_v4 CBS domain-containing protein 0.9471 2 136

Map