F428746

General Info

Members Datasets Scaffolds Average Seq Length
380 254 352 240

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0062604|Ga0451577_0062604_1778_2581
Length 267
Sequence LIPQSGASSFARIIARQFQTCSGTIFVTNTTNHTPDERAAWVDAAITSRMSARAFTAKPVPRETIVHLLQVASRAPSGTNTQPWKVYVLQGTSRDDLVTKVCAAHDALRSDPALAAEYSEEYDYYPEKWISPYIDRRRENGWSLYGLLGIGKGDKEKMHLQHQQNFRFFDAPIGLMFTVDRVLGRGSLLDYGMFMQNLMISARAHGLHTCAQAAWNGFSKIILPHIGAGADEMLVCGMALGYAEDDNIVNTLSTPRVSVDDFTHWLD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
9 2643221617 Nocardioides sp. Root79 Isolate Unclassified
10 2643221620 Nocardioides sp. Root240 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
13 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
14 2738541297 Duganella sp. GV083 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543026 Duganella sp. GV089 Isolate Unclassified
18 2738543029 Duganella sp. GV039 Isolate Unclassified
19 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
20 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
21 2831864461 Roseateles noduli HZ7 Isolate Nodule
22 2857564685 Duganella sp. R-74599 Isolate Unclassified
23 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
26 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
27 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
28 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
29 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
30 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
166 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
167 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
246 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
254 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 0
Isolates 7.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.11
Nodule 1.58
Rhizoplane 1.32
Rhizosphere 60.26
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4122172 2162886012 Unclassified 1745
2 JGI25156J39149_1000090 3300002705 Bacteria 67361
3 JGI25154J39366_1000061 3300002738 Bacteria 105781
4 JGI25157J39369_1000006 3300002741 Bacteria 226861
5 JGI25159J45721_1000203 3300002987 Bacteria 27623
6 JGI25159J45721_1015619 3300002987 Bacteria 1655
7 JGI25151J46595_10003629 3300003187 Bacteria 8428
8 JGI25151J46595_10003967 3300003187 Bacteria 7965
9 JGI25151J46595_10009860 3300003187 Bacteria 4487
10 JGI25151J46595_10019935 3300003187 Bacteria 2836
11 rootL2_10128302 3300003322 Bacteria 1008
12 rootH1_10008862 3300003316 Bacteria 3054
13 rootH1_10008862 3300003323 Bacteria 6650
14 rootH1_10018385 3300003323 Bacteria 22419
15 JGI25160J50197_1000071 3300003354 Bacteria 108301
16 JGI25161J50226_1000030 3300003374 Bacteria 142870
17 Ga0055529_1001652 3300003763 Bacteria 5876
18 Ga0055526_1002278 3300003771 Bacteria 13105
19 Ga0055526_1005245 3300003771 Bacteria 7517
20 Ga0055537_1000391 3300003773 Bacteria 29427
21 Ga0055537_1006473 3300003773 Bacteria 2966
22 Ga0055524_1000006 3300003775 Bacteria 324702
23 Ga0055524_1000540 3300003775 Bacteria 28639
24 Ga0055536_1048449 3300003781 Bacteria 950
25 Ga0055534_1001940 3300003784 Bacteria 7596
26 Ga0055534_1003083 3300003784 Bacteria 5432
27 Ga0055530_10000446 3300003791 Bacteria 36695
28 Ga0055540_1000005 3300003792 Bacteria 378126
29 Ga0055531_10000254 3300003794 Bacteria 57349
30 Ga0055531_10000636 3300003794 Bacteria 30247
31 Ga0055531_10003592 3300003794 Bacteria 9815
32 Ga0055543_1000566 3300004625 Bacteria 20553
33 Ga0065165_1006626 3300005262 Bacteria 5994
34 Ga0065165_1009677 3300005262 Bacteria 4277
35 Ga0065165_1034474 3300005262 Bacteria 1565
36 Ga0065704_10027734 3300005289 Bacteria 2815
37 Ga0065715_10154122 3300005293 Bacteria 1696
38 Ga0070683_100044973 3300005329 Bacteria 4074
39 Ga0070680_100340593 3300005336 Bacteria 1274
40 Ga0070661_100040296 3300005344 Unclassified 3407
41 Ga0070669_100007637 3300005353 Bacteria 7730
42 Ga0070681_10263899 3300005458 Bacteria 1634
43 Ga0070679_100218218 3300005530 Bacteria 1869
44 Ga0070684_100103989 3300005535 Bacteria 2540
45 Ga0070665_100084877 3300005548 Bacteria 3172
46 Ga0068855_100216871 3300005563 Bacteria 2148
47 Ga0070664_100519985 3300005564 Unclassified 1098
48 Ga0068857_100111400 3300005577 Bacteria 2460
49 Ga0075365_10036635 3300006038 Bacteria 3179
50 Ga0075365_10128922 3300006038 Bacteria 1749
51 Ga0075364_10237162 3300006051 Bacteria 1239
52 Ga0075432_10002582 3300006058 Bacteria 6045
53 Ga0075362_10021579 3300006177 Bacteria 2705
54 Ga0075367_10167827 3300006178 Bacteria 1366
55 Ga0075369_10069766 3300006186 Bacteria 1546
56 Ga0075366_10204959 3300006195 Bacteria 1200
57 Ga0075366_10425232 3300006195 Bacteria 818
58 Ga0075370_10088325 3300006353 Bacteria 1787
59 Ga0075370_10116634 3300006353 Bacteria 1552
60 Ga0075370_10201512 3300006353 Bacteria 1174
61 Ga0075429_100043098 3300006880 Bacteria 3926
62 Ga0099826_10070922 3300006948 Bacteria 2213
63 Ga0105251_10073996 3300009011 Bacteria 1582
64 Ga0105244_10040940 3300009036 Bacteria 2403
65 Ga0105244_10064099 3300009036 Bacteria 1844
66 Ga0105240_10008766 3300009093 Bacteria 14414
67 Ga0105240_10008954 3300009093 Bacteria 14231
68 Ga0105247_10027944 3300009101 Bacteria 3412
69 Ga0105247_10521328 3300009101 Bacteria 869
70 Ga0105243_10000617 3300009148 Bacteria 35435
71 Ga0105248_10747028 3300009177 Bacteria 1104
72 Ga0157373_10000665 3300013100 Bacteria 26863
73 Ga0157373_10157260 3300013100 Bacteria 1599
74 Ga0157371_10152184 3300013102 Bacteria 1650
75 Ga0157370_10166591 3300013104 Bacteria 2049
76 Ga0157378_10317588 3300013297 Bacteria 1512
77 Ga0163162_10037099 3300013306 Bacteria 4861
78 Ga0157375_10323379 3300013308 Bacteria 1707
79 Ga0182007_10130502 3300015262 Bacteria 845
80 Ga0163161_10122203 3300017792 Bacteria 1958
81 Ga0213872_10000139 3300021361 Bacteria 65459
82 Ga0213872_10014773 3300021361 Bacteria 3638
83 Ga0209435_100001 3300025206 Bacteria 1424171
84 Ga0209436_111669 3300025208 Bacteria 1531
85 Ga0207425_1001575 3300025245 Bacteria 9253
86 Ga0207425_1002894 3300025245 Bacteria 5758
87 Ga0207425_1004848 3300025245 Bacteria 3946
88 Ga0209646_1000001 3300025246 Bacteria 3092932
89 Ga0209026_1000003 3300025250 Bacteria 1060571
90 Ga0209759_1000001 3300025256 Bacteria 2799452
91 Ga0209129_1016249 3300025258 Bacteria 1500
92 Ga0209565_1000004 3300025263 Bacteria 983150
93 Ga0209565_1000626 3300025263 Bacteria 23268
94 Ga0209565_1032310 3300025263 Bacteria 1013
95 Ga0209455_1001139 3300025272 Bacteria 12895
96 Ga0209673_1000043 3300025273 Bacteria 291503
97 Ga0209673_1002619 3300025273 Bacteria 12083
98 Ga0209673_1009509 3300025273 Bacteria 4196
99 Ga0209130_1000060 3300025284 Bacteria 201501
100 Ga0209130_1000114 3300025284 Bacteria 130381
101 Ga0209675_1000269 3300025291 Bacteria 49713
102 Ga0209675_1007517 3300025291 Bacteria 4164
103 Ga0209676_1000007 3300025292 Bacteria 1029371
104 Ga0209025_1004090 3300025294 Bacteria 13010
105 Ga0209025_1004637 3300025294 Bacteria 11758
106 Ga0209025_1006877 3300025294 Bacteria 8675
107 Ga0209025_1017339 3300025294 Bacteria 4164
108 Ga0209025_1036865 3300025294 Bacteria 2181
109 Ga0209564_1000051 3300025295 Bacteria 357748
110 Ga0209564_1000495 3300025295 Bacteria 65018
111 Ga0209564_1002516 3300025295 Bacteria 14189
112 Ga0209564_1017096 3300025295 Bacteria 2848
113 Ga0209758_1000149 3300025297 Bacteria 163504
114 Ga0209758_1025535 3300025297 Bacteria 2589
115 Ga0209050_1000003 3300025298 Bacteria 1609245
116 Ga0209050_1002291 3300025298 Bacteria 16903
117 Ga0209050_1008720 3300025298 Bacteria 5345
118 Ga0209050_1017708 3300025298 Bacteria 2818
119 Ga0209256_1000001 3300025299 Bacteria 2166974
120 Ga0209256_1001389 3300025299 Bacteria 25252
121 Ga0207426_1000308 3300025302 Bacteria 96061
122 Ga0207426_1001608 3300025302 Bacteria 17943
123 Ga0209051_1000003 3300025303 Bacteria 1609245
124 Ga0209051_1000055 3300025303 Bacteria 277194
125 Ga0209051_1002565 3300025303 Bacteria 12824
126 Ga0209257_1000020 3300025304 Bacteria 773356
127 Ga0209257_1000101 3300025304 Bacteria 251553
128 Ga0209257_1001666 3300025304 Bacteria 25163
129 Ga0207696_1007253 3300025711 Bacteria 4357
130 Ga0207655_1001951 3300025728 Bacteria 17616
131 Ga0207655_1002089 3300025728 Bacteria 16747
132 Ga0207713_1001999 3300025735 Bacteria 15327
133 Ga0207710_10000041 3300025900 Bacteria 228027
134 Ga0207710_10201374 3300025900 Bacteria 983
135 Ga0207705_10251274 3300025909 Bacteria 1349
136 Ga0207695_10037126 3300025913 Bacteria 5258
137 Ga0207695_10044866 3300025913 Bacteria 4698
138 Ga0207660_10107341 3300025917 Bacteria 2095
139 Ga0207652_10020271 3300025921 Bacteria 5474
140 Ga0207652_10415990 3300025921 Bacteria 1213
141 Ga0207681_10006310 3300025923 Bacteria 7279
142 Ga0207709_10000068 3300025935 Bacteria 188511
143 Ga0207691_10162735 3300025940 Bacteria 1957
144 Ga0207679_10196640 3300025945 Bacteria 1681
145 Ga0207667_10136264 3300025949 Bacteria 2528
146 Ga0207667_10159898 3300025949 Bacteria 2317
147 Ga0207639_10159714 3300026041 Bacteria 1898
148 Ga0207674_10041005 3300026116 Bacteria 4791
149 Ga0209371_1000051 3300027312 Bacteria 276935
150 Ga0209970_1000154 3300027614 Bacteria 10658
151 Ga0209974_10001479 3300027876 Bacteria 8534
152 Ga0268266_10063473 3300028379 Bacteria 3188
153 Ga0307515_10002402 3300028794 Bacteria 40839
154 Ga0307515_10018319 3300028794 Bacteria 12686
155 Ga0268256_1000052 3300030500 Bacteria 276525
156 Ga0307512_10024590 3300030522 Bacteria 5356
157 Ga0307512_10159274 3300030522 Bacteria 1327
158 Ga0265332_10000003 3300031238 Bacteria 482849
159 Ga0265325_10070401 3300031241 Bacteria 1758
160 Ga0307513_10000006 3300031456 Bacteria 470848
161 Ga0307513_10000094 3300031456 Bacteria 127685
162 Ga0307513_10007352 3300031456 Bacteria 14292
163 Ga0307513_10525568 3300031456 Bacteria 898
164 Ga0307408_100000406 3300031548 Bacteria 38727
165 Ga0307408_100104589 3300031548 Bacteria 2163
166 Ga0307408_100194865 3300031548 Bacteria 1635
167 Ga0307408_100235268 3300031548 Bacteria 1502
168 Ga0307408_100275821 3300031548 Bacteria 1398
169 Ga0307408_100351893 3300031548 Bacteria 1250
170 Ga0307516_10002085 3300031730 Bacteria 27206
171 Ga0307405_10170368 3300031731 Bacteria 1552
172 Ga0307406_10101645 3300031901 Bacteria 1960
173 Ga0307412_10007932 3300031911 Bacteria 6050
174 Ga0307412_10044256 3300031911 Bacteria 2904
175 Ga0307412_10568552 3300031911 Bacteria 955
176 Ga0307416_100117977 3300032002 Bacteria 2357
177 Ga0307414_10027403 3300032004 Bacteria 3682
178 Ga0307411_10000086 3300032005 Bacteria 28813
179 Ga0307411_10784610 3300032005 Bacteria 838
180 Ga0395899_0020808 3300037312 Bacteria 4975
181 Ga0395899_0026643 3300037312 Bacteria 4361
182 Ga0395900_0004479 3300037418 Bacteria 14790
183 Ga0395900_0018233 3300037418 Bacteria 7161
184 Ga0395900_0143323 3300037418 Bacteria 2445
185 Ga0395900_0842299 3300037418 Bacteria 843
186 Ga0395898_0004394 3300037466 Bacteria 15422
187 Ga0395898_0009292 3300037466 Bacteria 10339
188 Ga0395898_0274946 3300037466 Bacteria 1606
189 Ga0395905_0000138 3300037471 Bacteria 120373
190 Ga0395905_0035038 3300037471 Bacteria 4712
191 Ga0395905_0088177 3300037471 Bacteria 2908
192 Ga0395905_0101720 3300037471 Bacteria 2697
193 Ga0395905_0157775 3300037471 Bacteria 2133
194 Ga0395901_0094447 3300038443 Bacteria 3133
195 Ga0395901_0094900 3300038443 Bacteria 3125
196 Ga0395901_0157406 3300038443 Bacteria 2386
197 Ga0395901_0604793 3300038443 Bacteria 1105
198 Ga0395901_0774733 3300038443 Bacteria 950
199 Ga0436361_0543024 3300039447 Bacteria 2595
200 Ga0436361_0734234 3300039447 Bacteria 30887
201 Ga0439436_0041015 3300041404 Bacteria 1325
202 Ga0439453_0012907 3300041408 Bacteria 1414
203 Ga0439466_0050849 3300041411 Bacteria 1358
204 Ga0451787_766310 3300041441 Bacteria 2011
205 Ga0451793_0727986 3300041452 Bacteria 1683
206 Ga0451804_0303828 3300041463 Bacteria 1349
207 Ga0451807_2339355 3300041486 Bacteria 1227
208 Ga0451807_2609590 3300041486 Bacteria 1033
209 Ga0451843_1572084 3300041509 Bacteria 1683
210 Ga0439441_058927 3300042001 Bacteria 805
211 Ga0439442_031770 3300042002 Bacteria 1103
212 Ga0439449_0010230 3300042007 Bacteria 3543
213 Ga0439449_0024754 3300042007 Bacteria 2243
214 Ga0439452_012596 3300042010 Bacteria 2399
215 Ga0439457_020914 3300042014 Bacteria 1451
216 Ga0439462_0001416 3300042015 Bacteria 5332
217 Ga0450890_003881 3300042127 Bacteria 1968
218 Ga0450898_002957 3300042134 Bacteria 2400
219 Ga0450904_004813 3300042139 Bacteria 1389
220 Ga0450906_004716 3300042145 Bacteria 2841
221 Ga0450910_006681 3300042147 Bacteria 1598
222 Ga0439458_0023192 3300042157 Bacteria 1446
223 Ga0450909_013847 3300042185 Bacteria 1187
224 Ga0439434_0077402 3300042435 Bacteria 1053
225 Ga0439434_0125666 3300042435 Bacteria 839
226 Ga0439464_0008232 3300042439 Bacteria 2733
227 Ga0439460_0040363 3300042461 Bacteria 1367
228 Ga0450893_0003650 3300042532 Bacteria 2431
229 Ga0451577_0000728 3300042876 Bacteria 51004
230 Ga0451577_0062604 3300042876 Bacteria 3318
231 Ga0451577_0496674 3300042876 Bacteria 1108
232 Ga0466969_0008545 3300044656 Bacteria 5433
233 Ga0453683_0002817 3300044673 Bacteria 13218
234 Ga0453683_0034567 3300044673 Bacteria 3186
235 Ga0466966_0004213 3300044684 Bacteria 9490
236 Ga0466966_0331976 3300044684 Bacteria 914
237 Ga0466961_0008774 3300044693 Bacteria 6448
238 Ga0453684_0000121 3300044712 Bacteria 341067
239 Ga0453684_0032394 3300044712 Bacteria 7316
240 Ga0453684_0291818 3300044712 Bacteria 1857
241 Ga0466968_0122300 3300044735 Bacteria 1178
242 Ga0466957_0093844 3300044842 Bacteria 1884
243 Ga0466959_0021272 3300045049 Bacteria 4783
244 Ga0451576_0001747 3300045051 Bacteria 35699
245 Ga0451576_0004297 3300045051 Bacteria 18640
246 Ga0451576_0018179 3300045051 Bacteria 7711
247 Ga0451576_0022770 3300045051 Bacteria 6787
248 Ga0451576_0214480 3300045051 Bacteria 2010
249 Ga0451576_0475907 3300045051 Bacteria 1312
250 Ga0466958_0298067 3300045836 Bacteria 1035
251 Ga0495617_000006 3300046452 Bacteria 398279
252 Ga0495590_0005154 3300046457 Bacteria 5199
253 Ga0495590_0101928 3300046457 Bacteria 1020
254 Ga0495638_0005708 3300046460 Bacteria 9167
255 Ga0495650_0000506 3300046471 Bacteria 58187
256 Ga0495650_0000567 3300046471 Bacteria 51961
257 Ga0495650_0029861 3300046471 Bacteria 2478
258 Ga0495584_0062011 3300046491 Unclassified 1879
259 Ga0495585_0003985 3300046492 Bacteria 9734
260 Ga0495607_0013805 3300046501 Bacteria 5278
261 Ga0495583_0007121 3300046506 Bacteria 7127
262 Ga0495583_0011075 3300046506 Bacteria 5197
263 Ga0495610_0000004 3300046512 Bacteria 1006135
264 Ga0495616_0008690 3300046513 Bacteria 5993
265 Ga0495632_0000406 3300046519 Bacteria 40685
266 Ga0495632_0015985 3300046519 Bacteria 4187
267 Ga0495643_0000141 3300046522 Bacteria 115660
268 Ga0495643_0222280 3300046522 Bacteria 895
269 Ga0495648_0008428 3300046524 Bacteria 8112
270 Ga0495648_0039972 3300046524 Bacteria 2979
271 Ga0495663_0017991 3300046525 Bacteria 2010
272 Ga0495642_0004359 3300046528 Bacteria 5494
273 Ga0495654_0003672 3300046530 Bacteria 9313
274 Ga0495654_0072605 3300046530 Bacteria 1628
275 Ga0495587_0045403 3300046536 Bacteria 2611
276 Ga0495609_0002674 3300046538 Bacteria 10792
277 Ga0495597_0074771 3300046542 Bacteria 1454
278 Ga0495633_0004300 3300046558 Bacteria 9097
279 Ga0495633_0025704 3300046558 Bacteria 2898
280 Ga0495656_0128793 3300046615 Bacteria 1202
281 Ga0495668_0004065 3300046616 Bacteria 10620
282 Ga0495668_0005256 3300046616 Bacteria 8865
283 Ga0495668_0025185 3300046616 Bacteria 3383
284 Ga0495668_0098006 3300046616 Bacteria 1604
285 Ga0495625_0001549 3300046660 Bacteria 27422
286 Ga0495625_0002773 3300046660 Bacteria 18494
287 Ga0495625_0017329 3300046660 Bacteria 5641
288 Ga0495625_0145806 3300046660 Bacteria 1594
289 Ga0495659_0001849 3300046664 Bacteria 6993
290 Ga0495661_0007489 3300046665 Bacteria 7613
291 Ga0495661_0105484 3300046665 Bacteria 1578
292 Ga0495661_0109309 3300046665 Bacteria 1543
293 Ga0495669_0001326 3300046684 Bacteria 10238
294 Ga0495669_0062027 3300046684 Bacteria 1693
295 Ga0495670_0095770 3300046691 Bacteria 1523
296 Ga0495671_0000001 3300046692 Bacteria 1169494
297 Ga0495649_0005109 3300046694 Bacteria 8422
298 Ga0495589_0034084 3300046794 Bacteria 2556
299 Ga0495589_0075318 3300046794 Bacteria 1646
300 Ga0495660_0004375 3300046810 Bacteria 8557
301 Ga0495660_0020388 3300046810 Bacteria 3800
302 Ga0495604_0007114 3300047317 Bacteria 8874
303 Ga0495636_0006284 3300047318 Bacteria 4664
304 Ga0495636_0183162 3300047318 Bacteria 951
305 Ga0495672_0000116 3300047320 Bacteria 127119
306 Ga0495683_0022151 3300047323 Bacteria 3269
307 Ga0495687_082791 3300047443 Bacteria 1251
308 Ga0495679_005239 3300047446 Bacteria 5788
309 Ga0495685_014705 3300047447 Bacteria 2661
310 Ga0495685_056287 3300047447 Bacteria 1329
311 Ga0495673_0000430 3300047469 Bacteria 47639
312 Ga0495686_0039187 3300047472 Bacteria 3028
313 Ga0496116_0001436 3300048919 Bacteria 26765
314 Ga0495678_024340 3300049459 Bacteria 2615
315 Ga0501031_0178904 3300049568 Bacteria 1386
316 Ga0501034_0073688 3300049571 Bacteria 3423
317 Ga0501037_0090777 3300049573 Bacteria 2209
318 Ga0501038_0055986 3300049574 Bacteria 3387
319 Ga0501038_0345020 3300049574 Bacteria 1161
320 Ga0501039_0237956 3300049575 Bacteria 1432
321 Ga0501043_0019422 3300049579 Bacteria 5334
322 Ga0501046_0015962 3300049580 Bacteria 6299
323 Ga0501047_0335881 3300049581 Bacteria 1349
324 Ga0501047_0364483 3300049581 Bacteria 1280
325 Ga0501048_0374198 3300049582 Bacteria 1017
326 Ga0501080_0810060 3300049742 Bacteria 821
327 Ga0501035_0036279 3300049822 Bacteria 4469
328 Ga0501044_0098922 3300049823 Bacteria 2936
329 nmdc:mga0yw44_40477_c1 3300050492 Bacteria 2769
330 nmdc:mga0k408_115084_c1 3300050493 Bacteria 1591
331 nmdc:mga0k408_121003_c1 3300050493 Bacteria 1550
332 nmdc:mga0k408_147518_c1 3300050493 Bacteria 1400
333 nmdc:mga0k408_243630_c1 3300050493 Bacteria 1074
334 nmdc:mga0k408_286180_c1 3300050493 Bacteria 984
335 nmdc:mga07m45_101150_c1 3300050496 Bacteria 1655
336 nmdc:mga07m45_87091_c1 3300050496 Bacteria 1787
337 nmdc:mga0sz30_86704_c1 3300050516 Bacteria 1359
338 Ga0500644_0006086 3300053088 Bacteria 3076
339 Ga0500651_0020904 3300053093 Bacteria 4078
340 Ga0500651_0086118 3300053093 Bacteria 1941
341 Ga0500650_0038262 3300053098 Bacteria 2207
342 Ga0500592_004002 3300053116 Bacteria 2354
343 Ga0500658_0017529 3300053134 Bacteria 2676
344 Ga0500586_000520 3300053145 Bacteria 7724
345 Ga0500586_015911 3300053145 Bacteria 2270
346 Ga0500604_0063890 3300053151 Bacteria 1162
347 Ga0500627_0000596 3300053158 Bacteria 9652
348 Ga0500611_005908 3300053727 Bacteria 1751
349 Ga0500645_000489 3300053730 Bacteria 26784
350 Ga0500645_000936 3300053730 Bacteria 16651
351 Ga0500587_001855 3300053739 Bacteria 3009
352 Ga0590075_017905 3300059424 Bacteria 1749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0222280 Ga0495643_0222280_227_871 209
2 3300050493 nmdc:mga0k408_115084_c1 nmdc:mga0k408_115084_c1_634_1362 213
3 3300045836 Ga0466958_0298067 Ga0466958_0298067_260_982 214
4 3300021361 Ga0213872_10014773 Ga0213872_100147732 216
5 3300039447 Ga0436361_0543024 Ga0436361_0543024_88_801 216
6 3300025263 Ga0209565_1032310 Ga0209565_10323101 217
7 iso_pu_bacteria 2643221672 2644401291 217
8 3300013297 Ga0157378_10317588 Ga0157378_103175882 221
9 3300013308 Ga0157375_10323379 Ga0157375_103233792 221
10 3300025245 Ga0207425_1001575 Ga0207425_10015759 221
11 3300025294 Ga0209025_1006877 Ga0209025_10068773 221
12 3300025297 Ga0209758_1000149 Ga0209758_1000149116 221
13 3300025940 Ga0207691_10162735 Ga0207691_101627353 221
14 3300046530 Ga0495654_0003672 Ga0495654_0003672_1555_2232 221
15 3300046616 Ga0495668_0005256 Ga0495668_0005256_1665_2342 221
16 3300046616 Ga0495668_0025185 Ga0495668_0025185_1751_2428 221
17 3300046794 Ga0495589_0034084 Ga0495589_0034084_1447_2124 221
18 3300049459 Ga0495678_024340 Ga0495678_024340_1394_2071 221
19 3300053116 Ga0500592_004002 Ga0500592_004002_495_1172 221
20 3300053158 Ga0500627_0000596 Ga0500627_0000596_1667_2344 221
21 3300053727 Ga0500611_005908 Ga0500611_005908_215_892 221
22 3300003771 Ga0055526_1005245 Ga0055526_10052455 223
23 3300021361 Ga0213872_10000139 Ga0213872_1000013910 223
24 3300025295 Ga0209564_1000051 Ga0209564_1000051144 223
25 3300027614 Ga0209970_1000154 Ga0209970_100015410 223
26 3300039447 Ga0436361_0734234 Ga0436361_0734234_11758_12471 223
27 iso_pu_bacteria 2510065045 2510248405 225
28 iso_pu_bacteria 2512047030 2512349642 225
29 iso_pu_bacteria 2515154122 2515683111 225
30 iso_pu_bacteria 2718217991 2719643166 225
31 iso_pu_bacteria 2885270888 2885273455 225
32 iso_pu_bacteria 2902682994 2902686537 225
33 iso_pu_bacteria 2551306352 2552746819 226
34 3300031238 Ga0265332_10000003 Ga0265332_10000003133 227
35 3300042876 Ga0451577_0496674 Ga0451577_0496674_265_960 227
36 3300044712 Ga0453684_0291818 Ga0453684_0291818_211_906 227
37 3300045051 Ga0451576_0475907 Ga0451576_0475907_374_1069 227
38 iso_pu_bacteria 2639762793 2640735509 227
39 iso_pu_bacteria 2675903507 2678232365 227
40 iso_pu_bacteria 2738541297 2738825138 227
41 iso_pu_bacteria 2738541357 2739148935 227
42 iso_pu_bacteria 2738543003 2739190854 227
43 iso_pu_bacteria 2738543026 2739317331 227
44 iso_pu_bacteria 2738543029 2739335572 227
45 iso_pu_bacteria 2773857761 2774390953 227
46 iso_pu_bacteria 2773857770 2774439010 227
47 iso_pu_bacteria 2857564685 2857565528 227
48 iso_pu_bacteria 2919182534 2919185737 227
49 iso_pu_bacteria 2585428062 2587755780 228
50 3300006058 Ga0075432_10002582 Ga0075432_100025826 229
51 3300009101 Ga0105247_10027944 Ga0105247_100279443 229
52 3300025900 Ga0207710_10000041 Ga0207710_1000004169 229
53 3300031456 Ga0307513_10000006 Ga0307513_10000006210 229
54 3300031730 Ga0307516_10002085 Ga0307516_1000208514 229
55 3300037418 Ga0395900_0842299 Ga0395900_0842299_23_724 229
56 3300045051 Ga0451576_0214480 Ga0451576_0214480_51_740 229
57 3300049742 Ga0501080_0810060 Ga0501080_0810060_101_805 229
58 3300031548 Ga0307408_100235268 Ga0307408_1002352682 230
59 3300031731 Ga0307405_10170368 Ga0307405_101703682 230
60 3300031911 Ga0307412_10007932 Ga0307412_100079326 230
61 3300005289 Ga0065704_10027734 Ga0065704_100277343 231
62 3300005353 Ga0070669_100007637 Ga0070669_1000076376 231
63 3300005548 Ga0070665_100084877 Ga0070665_1000848772 231
64 3300006177 Ga0075362_10021579 Ga0075362_100215793 231
65 3300009011 Ga0105251_10073996 Ga0105251_100739962 231
66 3300009036 Ga0105244_10040940 Ga0105244_100409402 231
67 3300009036 Ga0105244_10064099 Ga0105244_100640991 231
68 3300009093 Ga0105240_10008766 Ga0105240_100087666 231
69 3300009101 Ga0105247_10521328 Ga0105247_105213282 231
70 3300009148 Ga0105243_10000617 Ga0105243_100006172 231
71 3300013100 Ga0157373_10157260 Ga0157373_101572602 231
72 3300013102 Ga0157371_10152184 Ga0157371_101521841 231
73 3300013104 Ga0157370_10166591 Ga0157370_101665911 231
74 3300017792 Ga0163161_10122203 Ga0163161_101222032 231
75 3300025711 Ga0207696_1007253 Ga0207696_10072532 231
76 3300025728 Ga0207655_1001951 Ga0207655_10019513 231
77 3300025728 Ga0207655_1002089 Ga0207655_10020893 231
78 3300025735 Ga0207713_1001999 Ga0207713_100199910 231
79 3300025900 Ga0207710_10201374 Ga0207710_102013742 231
80 3300025913 Ga0207695_10037126 Ga0207695_100371264 231
81 3300025923 Ga0207681_10006310 Ga0207681_100063105 231
82 3300025935 Ga0207709_10000068 Ga0207709_10000068147 231
83 3300027312 Ga0209371_1000051 Ga0209371_1000051150 231
84 3300028379 Ga0268266_10063473 Ga0268266_100634734 231
85 3300030500 Ga0268256_1000052 Ga0268256_1000052116 231
86 3300031241 Ga0265325_10070401 Ga0265325_100704012 231
87 3300041404 Ga0439436_0041015 Ga0439436_0041015_328_1068 231
88 3300041411 Ga0439466_0050849 Ga0439466_0050849_50_790 231
89 3300042002 Ga0439442_031770 Ga0439442_031770_210_950 231
90 3300042007 Ga0439449_0010230 Ga0439449_0010230_792_1532 231
91 3300042010 Ga0439452_012596 Ga0439452_012596_1030_1770 231
92 3300042014 Ga0439457_020914 Ga0439457_020914_246_986 231
93 3300042015 Ga0439462_0001416 Ga0439462_0001416_3641_4381 231
94 3300042145 Ga0450906_004716 Ga0450906_004716_441_1181 231
95 3300042147 Ga0450910_006681 Ga0450910_006681_265_1032 231
96 3300042435 Ga0439434_0125666 Ga0439434_0125666_85_825 231
97 3300042876 Ga0451577_0000728 Ga0451577_0000728_20544_21251 231
98 3300044712 Ga0453684_0000121 Ga0453684_0000121_277225_277932 231
99 3300045051 Ga0451576_0004297 Ga0451576_0004297_9664_10371 231
100 3300046452 Ga0495617_000006 Ga0495617_000006_370346_371041 231
101 3300046471 Ga0495650_0000506 Ga0495650_0000506_8374_9069 231
102 3300046471 Ga0495650_0000567 Ga0495650_0000567_41156_41851 231
103 3300046471 Ga0495650_0029861 Ga0495650_0029861_1230_1925 231
104 3300046492 Ga0495585_0003985 Ga0495585_0003985_1922_2617 231
105 3300046512 Ga0495610_0000004 Ga0495610_0000004_371123_371818 231
106 3300046524 Ga0495648_0008428 Ga0495648_0008428_6239_6934 231
107 3300046524 Ga0495648_0039972 Ga0495648_0039972_2032_2727 231
108 3300046530 Ga0495654_0072605 Ga0495654_0072605_347_1042 231
109 3300046558 Ga0495633_0004300 Ga0495633_0004300_1352_2047 231
110 3300046558 Ga0495633_0025704 Ga0495633_0025704_872_1567 231
111 3300046616 Ga0495668_0004065 Ga0495668_0004065_1866_2561 231
112 3300046660 Ga0495625_0002773 Ga0495625_0002773_9351_10046 231
113 3300046660 Ga0495625_0145806 Ga0495625_0145806_556_1251 231
114 3300046665 Ga0495661_0109309 Ga0495661_0109309_780_1475 231
115 3300046692 Ga0495671_0000001 Ga0495671_0000001_1018853_1019548 231
116 3300046810 Ga0495660_0020388 Ga0495660_0020388_787_1482 231
117 3300047323 Ga0495683_0022151 Ga0495683_0022151_659_1354 231
118 3300047469 Ga0495673_0000430 Ga0495673_0000430_37901_38596 231
119 3300047472 Ga0495686_0039187 Ga0495686_0039187_780_1475 231
120 3300053145 Ga0500586_000520 Ga0500586_000520_720_1415 231
121 3300053145 Ga0500586_015911 Ga0500586_015911_426_1121 231
122 iso_pu_bacteria 2857740372 2857742704 231
123 iso_pu_bacteria 2939631187 2939631546 231
124 3300006178 Ga0075367_10167827 Ga0075367_101678272 232
125 3300006195 Ga0075366_10425232 Ga0075366_104252322 232
126 3300009177 Ga0105248_10747028 Ga0105248_107470282 232
127 3300027876 Ga0209974_10001479 Ga0209974_100014796 232
128 3300028794 Ga0307515_10002402 Ga0307515_1000240213 232
129 3300028794 Ga0307515_10018319 Ga0307515_100183196 232
130 3300030522 Ga0307512_10024590 Ga0307512_100245903 232
131 3300030522 Ga0307512_10159274 Ga0307512_101592742 232
132 3300031456 Ga0307513_10007352 Ga0307513_100073528 232
133 3300041441 Ga0451787_766310 Ga0451787_766310_360_1058 232
134 3300041452 Ga0451793_0727986 Ga0451793_0727986_126_824 232
135 3300041463 Ga0451804_0303828 Ga0451804_0303828_480_1178 232
136 3300041486 Ga0451807_2609590 Ga0451807_2609590_78_776 232
137 3300041509 Ga0451843_1572084 Ga0451843_1572084_543_1241 232
138 3300046457 Ga0495590_0005154 Ga0495590_0005154_2274_2972 232
139 3300046519 Ga0495632_0015985 Ga0495632_0015985_1985_2683 232
140 3300046536 Ga0495587_0045403 Ga0495587_0045403_875_1573 232
141 3300046660 Ga0495625_0001549 Ga0495625_0001549_15089_15787 232
142 3300049568 Ga0501031_0178904 Ga0501031_0178904_663_1373 232
143 3300050493 nmdc:mga0k408_243630_c1 nmdc:mga0k408_243630_c1_345_1043 232
144 3300053134 Ga0500658_0017529 Ga0500658_0017529_416_1114 232
145 3300053739 Ga0500587_001855 Ga0500587_001855_1659_2357 232
146 iso_pu_bacteria 2643221617 2644100843 232
147 iso_pu_bacteria 2643221620 2644117252 232
148 iso_pu_bacteria 2881101125 2881103933 233
149 iso_pu_bacteria 2919704043 2919705288 233
150 3300003763 Ga0055529_1001652 Ga0055529_10016524 234
151 3300031548 Ga0307408_100000406 Ga0307408_10000040638 234
152 3300032004 Ga0307414_10027403 Ga0307414_100274033 234
153 3300045051 Ga0451576_0001747 Ga0451576_0001747_6787_7494 234
154 3300031901 Ga0307406_10101645 Ga0307406_101016451 235
155 3300006353 Ga0075370_10088325 Ga0075370_100883252 236
156 3300025272 Ga0209455_1001139 Ga0209455_100113911 236
157 3300032005 Ga0307411_10000086 Ga0307411_1000008610 236
158 3300038443 Ga0395901_0604793 Ga0395901_0604793_236_958 236
159 3300047317 Ga0495604_0007114 Ga0495604_0007114_3262_3987 236
160 3300048919 Ga0496116_0001436 Ga0496116_0001436_269_994 236
161 3300053093 Ga0500651_0020904 Ga0500651_0020904_2743_3462 236
162 iso_pu_bacteria 2885192300 2885194069 236
163 3300003794 Ga0055531_10000254 Ga0055531_1000025436 237
164 3300005329 Ga0070683_100044973 Ga0070683_1000449733 237
165 3300005336 Ga0070680_100340593 Ga0070680_1003405931 237
166 3300005344 Ga0070661_100040296 Ga0070661_1000402963 237
167 3300005458 Ga0070681_10263899 Ga0070681_102638992 237
168 3300005530 Ga0070679_100218218 Ga0070679_1002182183 237
169 3300005535 Ga0070684_100103989 Ga0070684_1001039891 237
170 3300005563 Ga0068855_100216871 Ga0068855_1002168711 237
171 3300005564 Ga0070664_100519985 Ga0070664_1005199852 237
172 3300005577 Ga0068857_100111400 Ga0068857_1001114003 237
173 3300006038 Ga0075365_10036635 Ga0075365_100366352 237
174 3300006038 Ga0075365_10128922 Ga0075365_101289223 237
175 3300006186 Ga0075369_10069766 Ga0075369_100697662 237
176 3300006353 Ga0075370_10116634 Ga0075370_101166342 237
177 3300006353 Ga0075370_10201512 Ga0075370_102015122 237
178 3300009093 Ga0105240_10008954 Ga0105240_100089549 237
179 3300015262 Ga0182007_10130502 Ga0182007_101305021 237
180 3300025273 Ga0209673_1009509 Ga0209673_10095095 237
181 3300025303 Ga0209051_1000055 Ga0209051_100005568 237
182 3300025304 Ga0209257_1000101 Ga0209257_100010142 237
183 3300025909 Ga0207705_10251274 Ga0207705_102512742 237
184 3300025913 Ga0207695_10044866 Ga0207695_100448666 237
185 3300025917 Ga0207660_10107341 Ga0207660_101073413 237
186 3300025921 Ga0207652_10020271 Ga0207652_100202716 237
187 3300025921 Ga0207652_10415990 Ga0207652_104159901 237
188 3300025945 Ga0207679_10196640 Ga0207679_101966402 237
189 3300025949 Ga0207667_10136264 Ga0207667_101362642 237
190 3300025949 Ga0207667_10159898 Ga0207667_101598983 237
191 3300026041 Ga0207639_10159714 Ga0207639_101597142 237
192 3300026116 Ga0207674_10041005 Ga0207674_100410052 237
193 3300031548 Ga0307408_100194865 Ga0307408_1001948652 237
194 3300031548 Ga0307408_100275821 Ga0307408_1002758212 237
195 3300031911 Ga0307412_10044256 Ga0307412_100442563 237
196 3300031911 Ga0307412_10568552 Ga0307412_105685522 237
197 3300032002 Ga0307416_100117977 Ga0307416_1001179773 237
198 3300037418 Ga0395900_0004479 Ga0395900_0004479_6658_7386 237
199 3300037466 Ga0395898_0004394 Ga0395898_0004394_5537_6265 237
200 3300037471 Ga0395905_0000138 Ga0395905_0000138_103976_104704 237
201 3300037471 Ga0395905_0035038 Ga0395905_0035038_1187_1915 237
202 3300037471 Ga0395905_0088177 Ga0395905_0088177_1756_2484 237
203 3300037471 Ga0395905_0101720 Ga0395905_0101720_835_1563 237
204 3300038443 Ga0395901_0094447 Ga0395901_0094447_1666_2394 237
205 3300038443 Ga0395901_0157406 Ga0395901_0157406_1222_1947 237
206 3300038443 Ga0395901_0774733 Ga0395901_0774733_93_818 237
207 3300041408 Ga0439453_0012907 Ga0439453_0012907_262_990 237
208 3300041486 Ga0451807_2339355 Ga0451807_2339355_11_736 237
209 3300042001 Ga0439441_058927 Ga0439441_058927_14_742 237
210 3300042007 Ga0439449_0024754 Ga0439449_0024754_287_1015 237
211 3300042127 Ga0450890_003881 Ga0450890_003881_997_1725 237
212 3300042134 Ga0450898_002957 Ga0450898_002957_1049_1777 237
213 3300042139 Ga0450904_004813 Ga0450904_004813_212_940 237
214 3300042157 Ga0439458_0023192 Ga0439458_0023192_458_1186 237
215 3300042185 Ga0450909_013847 Ga0450909_013847_274_1002 237
216 3300042435 Ga0439434_0077402 Ga0439434_0077402_101_829 237
217 3300042439 Ga0439464_0008232 Ga0439464_0008232_873_1601 237
218 3300042532 Ga0450893_0003650 Ga0450893_0003650_1640_2368 237
219 3300044656 Ga0466969_0008545 Ga0466969_0008545_1184_1909 237
220 3300044673 Ga0453683_0002817 Ga0453683_0002817_3817_4545 237
221 3300044684 Ga0466966_0004213 Ga0466966_0004213_4341_5066 237
222 3300044684 Ga0466966_0331976 Ga0466966_0331976_65_790 237
223 3300044693 Ga0466961_0008774 Ga0466961_0008774_32_757 237
224 3300044735 Ga0466968_0122300 Ga0466968_0122300_218_943 237
225 3300045049 Ga0466959_0021272 Ga0466959_0021272_1091_1816 237
226 3300045051 Ga0451576_0018179 Ga0451576_0018179_4512_5240 237
227 3300046525 Ga0495663_0017991 Ga0495663_0017991_840_1565 237
228 3300046615 Ga0495656_0128793 Ga0495656_0128793_22_747 237
229 3300046684 Ga0495669_0062027 Ga0495669_0062027_44_769 237
230 3300047318 Ga0495636_0006284 Ga0495636_0006284_3820_4533 237
231 3300047318 Ga0495636_0183162 Ga0495636_0183162_160_885 237
232 3300047447 Ga0495685_056287 Ga0495685_056287_384_1109 237
233 3300049571 Ga0501034_0073688 Ga0501034_0073688_281_1006 237
234 3300049573 Ga0501037_0090777 Ga0501037_0090777_790_1518 237
235 3300049574 Ga0501038_0055986 Ga0501038_0055986_179_904 237
236 3300049574 Ga0501038_0345020 Ga0501038_0345020_202_930 237
237 3300049575 Ga0501039_0237956 Ga0501039_0237956_51_779 237
238 3300049579 Ga0501043_0019422 Ga0501043_0019422_3487_4212 237
239 3300049580 Ga0501046_0015962 Ga0501046_0015962_2802_3527 237
240 3300049581 Ga0501047_0335881 Ga0501047_0335881_430_1158 237
241 3300049581 Ga0501047_0364483 Ga0501047_0364483_211_936 237
242 3300049582 Ga0501048_0374198 Ga0501048_0374198_258_983 237
243 3300049822 Ga0501035_0036279 Ga0501035_0036279_1278_2003 237
244 3300049823 Ga0501044_0098922 Ga0501044_0098922_703_1428 237
245 3300050492 nmdc:mga0yw44_40477_c1 nmdc:mga0yw44_40477_c1_593_1318 237
246 3300050493 nmdc:mga0k408_121003_c1 nmdc:mga0k408_121003_c1_677_1402 237
247 3300050493 nmdc:mga0k408_147518_c1 nmdc:mga0k408_147518_c1_71_796 237
248 3300050496 nmdc:mga07m45_101150_c1 nmdc:mga07m45_101150_c1_183_908 237
249 3300050496 nmdc:mga07m45_87091_c1 nmdc:mga07m45_87091_c1_707_1450 237
250 3300050516 nmdc:mga0sz30_86704_c1 nmdc:mga0sz30_86704_c1_332_1057 237
251 3300053093 Ga0500651_0086118 Ga0500651_0086118_863_1588 237
252 3300059424 Ga0590075_017905 Ga0590075_017905_497_1225 237
253 iso_pu_bacteria 2511231002 2511244802 237
254 3300031548 Ga0307408_100351893 Ga0307408_1003518932 238
255 3300037312 Ga0395899_0020808 Ga0395899_0020808_2343_3074 238
256 3300037312 Ga0395899_0026643 Ga0395899_0026643_1031_1762 238
257 3300037418 Ga0395900_0018233 Ga0395900_0018233_2263_2994 238
258 3300037418 Ga0395900_0143323 Ga0395900_0143323_107_838 238
259 3300037466 Ga0395898_0009292 Ga0395898_0009292_9384_10115 238
260 3300037466 Ga0395898_0274946 Ga0395898_0274946_334_1065 238
261 3300037471 Ga0395905_0157775 Ga0395905_0157775_87_818 238
262 3300038443 Ga0395901_0094900 Ga0395901_0094900_1853_2584 238
263 3300044842 Ga0466957_0093844 Ga0466957_0093844_864_1595 238
264 3300003322 rootL2_10128302 rootL2_101283021 239
265 3300003323 rootH1_10018385 rootH1_1001838516 239
266 3300003794 Ga0055531_10003592 Ga0055531_100035923 239
267 3300025273 Ga0209673_1002619 Ga0209673_10026198 239
268 3300025298 Ga0209050_1002291 Ga0209050_100229116 239
269 3300025299 Ga0209256_1001389 Ga0209256_100138912 239
270 3300025303 Ga0209051_1002565 Ga0209051_10025658 239
271 3300025304 Ga0209257_1001666 Ga0209257_100166613 239
272 3300046542 Ga0495597_0074771 Ga0495597_0074771_69_788 239
273 iso_pu_bacteria 2831864461 2831866077 239
274 3300002705 JGI25156J39149_1000090 JGI25156J39149_100009052 241
275 3300002738 JGI25154J39366_1000061 JGI25154J39366_100006190 241
276 3300002741 JGI25157J39369_1000006 JGI25157J39369_1000006119 241
277 3300002987 JGI25159J45721_1000203 JGI25159J45721_100020310 241
278 3300002987 JGI25159J45721_1015619 JGI25159J45721_10156192 241
279 3300003187 JGI25151J46595_10003629 JGI25151J46595_100036298 241
280 3300003187 JGI25151J46595_10003967 JGI25151J46595_100039676 241
281 3300003187 JGI25151J46595_10009860 JGI25151J46595_100098602 241
282 3300003187 JGI25151J46595_10019935 JGI25151J46595_100199352 241
283 3300003323 rootH1_10008862 rootH1_100088629 241
284 3300003354 JGI25160J50197_1000071 JGI25160J50197_100007171 241
285 3300003374 JGI25161J50226_1000030 JGI25161J50226_1000030124 241
286 3300003771 Ga0055526_1002278 Ga0055526_10022784 241
287 3300003773 Ga0055537_1000391 Ga0055537_100039114 241
288 3300003773 Ga0055537_1006473 Ga0055537_10064732 241
289 3300003775 Ga0055524_1000006 Ga0055524_1000006176 241
290 3300003775 Ga0055524_1000540 Ga0055524_100054010 241
291 3300003781 Ga0055536_1048449 Ga0055536_10484491 241
292 3300003784 Ga0055534_1001940 Ga0055534_10019406 241
293 3300003784 Ga0055534_1003083 Ga0055534_10030835 241
294 3300003791 Ga0055530_10000446 Ga0055530_1000044622 241
295 3300003792 Ga0055540_1000005 Ga0055540_1000005137 241
296 3300003794 Ga0055531_10000636 Ga0055531_1000063630 241
297 3300004625 Ga0055543_1000566 Ga0055543_100056615 241
298 3300005262 Ga0065165_1006626 Ga0065165_10066263 241
299 3300005262 Ga0065165_1009677 Ga0065165_10096773 241
300 3300005262 Ga0065165_1034474 Ga0065165_10344741 241
301 3300006051 Ga0075364_10237162 Ga0075364_102371622 241
302 3300006195 Ga0075366_10204959 Ga0075366_102049592 241
303 3300006948 Ga0099826_10070922 Ga0099826_100709222 241
304 3300025206 Ga0209435_100001 Ga0209435_100001128 241
305 3300025208 Ga0209436_111669 Ga0209436_1116692 241
306 3300025245 Ga0207425_1002894 Ga0207425_10028946 241
307 3300025245 Ga0207425_1004848 Ga0207425_10048485 241
308 3300025246 Ga0209646_1000001 Ga0209646_1000001497 241
309 3300025250 Ga0209026_1000003 Ga0209026_1000003128 241
310 3300025256 Ga0209759_1000001 Ga0209759_1000001128 241
311 3300025258 Ga0209129_1016249 Ga0209129_10162492 241
312 3300025263 Ga0209565_1000004 Ga0209565_100000413 241
313 3300025263 Ga0209565_1000626 Ga0209565_10006263 241
314 3300025273 Ga0209673_1000043 Ga0209673_1000043264 241
315 3300025284 Ga0209130_1000060 Ga0209130_100006059 241
316 3300025284 Ga0209130_1000114 Ga0209130_100011439 241
317 3300025291 Ga0209675_1000269 Ga0209675_10002698 241
318 3300025291 Ga0209675_1007517 Ga0209675_10075172 241
319 3300025292 Ga0209676_1000007 Ga0209676_1000007559 241
320 3300025294 Ga0209025_1004090 Ga0209025_10040903 241
321 3300025294 Ga0209025_1004637 Ga0209025_10046378 241
322 3300025294 Ga0209025_1017339 Ga0209025_10173392 241
323 3300025294 Ga0209025_1036865 Ga0209025_10368652 241
324 3300025295 Ga0209564_1000495 Ga0209564_10004954 241
325 3300025295 Ga0209564_1002516 Ga0209564_10025164 241
326 3300025295 Ga0209564_1017096 Ga0209564_10170964 241
327 3300025297 Ga0209758_1025535 Ga0209758_10255352 241
328 3300025298 Ga0209050_1000003 Ga0209050_1000003949 241
329 3300025298 Ga0209050_1008720 Ga0209050_10087202 241
330 3300025298 Ga0209050_1017708 Ga0209050_10177082 241
331 3300025299 Ga0209256_1000001 Ga0209256_1000001955 241
332 3300025302 Ga0207426_1000308 Ga0207426_100030822 241
333 3300025302 Ga0207426_1001608 Ga0207426_10016086 241
334 3300025303 Ga0209051_1000003 Ga0209051_1000003949 241
335 3300025304 Ga0209257_1000020 Ga0209257_1000020559 241
336 3300031456 Ga0307513_10000094 Ga0307513_1000009452 241
337 3300031456 Ga0307513_10525568 Ga0307513_105255681 241
338 3300031548 Ga0307408_100104589 Ga0307408_1001045893 241
339 3300032005 Ga0307411_10784610 Ga0307411_107846101 241
340 3300046519 Ga0495632_0000406 Ga0495632_0000406_8082_8807 241
341 3300046665 Ga0495661_0105484 Ga0495661_0105484_54_779 241
342 3300050493 nmdc:mga0k408_286180_c1 nmdc:mga0k408_286180_c1_25_771 241
343 3300053088 Ga0500644_0006086 Ga0500644_0006086_2172_2918 241
344 3300053098 Ga0500650_0038262 Ga0500650_0038262_357_1103 241
345 3300053151 Ga0500604_0063890 Ga0500604_0063890_298_1044 241
346 3300053730 Ga0500645_000489 Ga0500645_000489_20839_21585 241
347 3300053730 Ga0500645_000936 Ga0500645_000936_3783_4529 241
348 3300006880 Ga0075429_100043098 Ga0075429_1000430984 242
349 3300042461 Ga0439460_0040363 Ga0439460_0040363_609_1352 242
350 3300042876 Ga0451577_0062604 Ga0451577_0062604_1778_2581 242
351 3300044673 Ga0453683_0034567 Ga0453683_0034567_744_1547 242
352 3300044712 Ga0453684_0032394 Ga0453684_0032394_2799_3602 242
353 3300045051 Ga0451576_0022770 Ga0451576_0022770_5247_6050 242
354 3300013100 Ga0157373_10000665 Ga0157373_100006657 245
355 3300013306 Ga0163162_10037099 Ga0163162_100370992 245
356 3300005293 Ga0065715_10154122 Ga0065715_101541222 246
357 3300046522 Ga0495643_0000141 Ga0495643_0000141_22929_23675 246
358 3300047320 Ga0495672_0000116 Ga0495672_0000116_115280_116020 246
359 2162886012 MBSR1b_contig_4122172 MBSR1b_0800.00000010 247
360 3300046457 Ga0495590_0101928 Ga0495590_0101928_25_783 247
361 3300046460 Ga0495638_0005708 Ga0495638_0005708_711_1469 247
362 3300046491 Ga0495584_0062011 Ga0495584_0062011_789_1547 247
363 3300046501 Ga0495607_0013805 Ga0495607_0013805_943_1701 247
364 3300046506 Ga0495583_0007121 Ga0495583_0007121_3234_3977 247
365 3300046506 Ga0495583_0011075 Ga0495583_0011075_3861_4619 247
366 3300046513 Ga0495616_0008690 Ga0495616_0008690_1530_2288 247
367 3300046528 Ga0495642_0004359 Ga0495642_0004359_803_1561 247
368 3300046538 Ga0495609_0002674 Ga0495609_0002674_3566_4324 247
369 3300046616 Ga0495668_0098006 Ga0495668_0098006_489_1247 247
370 3300046660 Ga0495625_0017329 Ga0495625_0017329_963_1721 247
371 3300046664 Ga0495659_0001849 Ga0495659_0001849_2516_3274 247
372 3300046665 Ga0495661_0007489 Ga0495661_0007489_2074_2832 247
373 3300046684 Ga0495669_0001326 Ga0495669_0001326_6969_7727 247
374 3300046691 Ga0495670_0095770 Ga0495670_0095770_159_917 247
375 3300046694 Ga0495649_0005109 Ga0495649_0005109_5364_6122 247
376 3300046794 Ga0495589_0075318 Ga0495589_0075318_59_817 247
377 3300046810 Ga0495660_0004375 Ga0495660_0004375_2371_3129 247
378 3300047443 Ga0495687_082791 Ga0495687_082791_205_963 247
379 3300047446 Ga0495679_005239 Ga0495679_005239_4409_5167 247
380 3300047447 Ga0495685_014705 Ga0495685_014705_1827_2585 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

46

242

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gr3-assembly1.cif.gz_B crystal structure of a nitroreductase-like family protein (pnba, bh06130) from bartonella henselae str. houston-1 at 1.45 a resolution 0.9671 21 240
7dp1-assembly1.cif.gz_A crystal structure of fmn and nadph-dependent nitroreductase nfnb mutant y88a derived from sphigopyxis sp. strain hmh 0.9622 21 241
7dp2-assembly1.cif.gz_A crystal structure of fmn and nadph-dependent nitroreductase nfnb mutant y88f derived from sphigopyxis sp. strain hmh 0.959 21 242
7dp2-assembly1.cif.gz_B crystal structure of fmn and nadph-dependent nitroreductase nfnb mutant y88f derived from sphigopyxis sp. strain hmh 0.9589 21 241
7dp0-assembly1.cif.gz_B crystal structure of fmn and nadph-dependent nitroreductase nfnb from sphigopyxis sp. strain hmh 0.9578 21 242
ID Description Score Start End Superfamily
3gr3B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.961 21 240 3.40.109.10
2wzwA01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9449 17 238 3.40.109.10
2wzwA01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9363 17 238 3.40.109.10
3gr3B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9181 21 240 3.40.109.10
3m5kB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8192 21 239 3.40.109.10
ID Description Score Start End GO Terms
AF-Q88GR1-F1-model_v4 p-nitrobenzoate reductase NfnB 0.9908 21 242 GO:0016491
AF-A0A0Q8SJG3-F1-model_v4 Nitrobenzoate reductase 0.987 22 242 GO:0016491
AF-A0A839LFU9-F1-model_v4 Nitroreductase 0.9867 31 242 GO:0016491
AF-A0A0H3WZI2-F1-model_v4 Nitrobenzoate reductase 0.9866 17 242 GO:0016491
AF-A0A1W9M1F2-F1-model_v4 Nitrobenzoate reductase 0.9857 31 242 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.46 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map