metagRoot

F428702

General Info

Members	Datasets	Scaffolds	Average Seq Length
380	238	377	108

Family's Representative Sequence

Representative Sequence	3300028381\|Ga0268264_11370779\|Ga0268264_113707792
Length	129
Sequence	MRRIVGWFDDRLGAARFARSSLDKVFEALASGPRRQILAYLAEAELSTSQLAERFSMSAPAISRHLSVLENAGLVSSERQGQFVLYRLNRDHLVNHLTGYAFELCPVGRPLKRESRALAKRRKTGASNA

Samples

	Sample ID	Description	Type	Environment
1	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
2	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
3	2818991436	Collimonas arenae 515	Isolate	Unclassified
4	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
5	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
6	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
7	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
8	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
9	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
10	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
11	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
12	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
13	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
14	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
15	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
16	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
17	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
18	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
19	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
20	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
21	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
22	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
23	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
24	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
25	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
26	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
27	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
28	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
31	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
32	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
33	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
34	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
35	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
36	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
40	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
41	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
42	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
43	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
44	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
45	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
46	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
47	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
48	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
49	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
50	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
51	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
54	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
55	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
56	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
57	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
62	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
63	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
64	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
65	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
66	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
67	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
68	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
69	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
70	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
71	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
72	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
73	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
76	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
79	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
80	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
81	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
82	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
83	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
84	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
85	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
86	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
87	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
88	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
89	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
90	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
91	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
93	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
96	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
98	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
137	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
138	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
139	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
140	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
141	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
142	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
143	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
144	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
145	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
146	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
147	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
148	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
149	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
150	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
151	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
152	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
153	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
154	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
155	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
156	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
157	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
158	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
159	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
160	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
161	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
162	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
163	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
164	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
165	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
166	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
167	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
168	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
169	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
170	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
171	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
172	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
173	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
174	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
175	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
176	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
177	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
178	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
179	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
180	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
181	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
182	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
183	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
184	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
185	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
186	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
187	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
188	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
189	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
190	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
191	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
192	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
193	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
194	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
195	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
196	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
197	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
198	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
199	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
200	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
201	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
202	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
203	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
204	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
205	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
206	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
207	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
208	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
209	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
210	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
211	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
212	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
219	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
221	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
222	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
223	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
224	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
225	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
226	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
227	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
228	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
229	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
230	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
231	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
232	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
233	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
234	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
235	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
236	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
237	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
238	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.21
Metatranscriptomes	0
Isolates	0.79

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	22.63
Nodule	0.26
Rhizoplane	0.79
Rhizosphere	71.32
Stem	0
Stem Tuber	0
Unclassified	5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25159J45721_1000148	3300002987	Bacteria	32592
2	JGI25159J45721_1003614	3300002987	Bacteria	5398
3	JGI25151J46595_10014788	3300003187	Bacteria	3464
4	rootH1_10118329	3300003316	Bacteria	1958
5	rootL2_10322494	3300003322	Bacteria	1453
6	rootH1_10061288	3300003323	Bacteria	1233
7	JGI25160J50197_1000123	3300003354	Bacteria	70031
8	JGI25161J50226_1000032	3300003374	Bacteria	138440
9	Ga0055526_1000187	3300003771	Bacteria	54124
10	Ga0055524_1000094	3300003775	Bacteria	110394
11	Ga0055524_1091744	3300003775	Unclassified	525
12	Ga0055536_1016528	3300003781	Bacteria	2462
13	Ga0055534_1009778	3300003784	Bacteria	2055
14	Ga0055530_10000793	3300003791	Bacteria	26295
15	Ga0055530_10011533	3300003791	Bacteria	3165
16	Ga0055530_10048367	3300003791	Bacteria	999
17	Ga0055540_1000012	3300003792	Bacteria	262667
18	Ga0055540_1078309	3300003792	Bacteria	637
19	Ga0055540_1108990	3300003792	Unclassified	512
20	Ga0055531_10000002	3300003794	Bacteria	421971
21	Ga0055531_10001541	3300003794	Bacteria	16875
22	Ga0055543_1000294	3300004625	Bacteria	35881
23	Ga0065165_1003813	3300005262	Bacteria	10056
24	Ga0065165_1018183	3300005262	Bacteria	2556
25	Ga0065715_10842628	3300005293	Bacteria	594
26	Ga0070676_10688852	3300005328	Bacteria	745
27	Ga0070670_100091477	3300005331	Bacteria	2616
28	Ga0070670_100479444	3300005331	Bacteria	1105
29	Ga0070670_101457549	3300005331	Unclassified	628
30	Ga0068869_100292238	3300005334	Bacteria	1313
31	Ga0070666_11230843	3300005335	Bacteria	558
32	Ga0070682_100953145	3300005337	Unclassified	709
33	Ga0068868_101804710	3300005338	Bacteria	578
34	Ga0070689_101793042	3300005340	Unclassified	559
35	Ga0070671_100577413	3300005355	Bacteria	971
36	Ga0070674_100390176	3300005356	Bacteria	1135
37	Ga0070673_100057428	3300005364	Bacteria	3074
38	Ga0070688_100814239	3300005365	Bacteria	731
39	Ga0070659_100500520	3300005366	Bacteria	1036
40	Ga0070667_100052431	3300005367	Bacteria	3442
41	Ga0070667_100672418	3300005367	Bacteria	957
42	Ga0070663_100034295	3300005455	Bacteria	3514
43	Ga0070663_101779184	3300005455	Bacteria	552
44	Ga0070678_100181226	3300005456	Bacteria	1724
45	Ga0070662_100048805	3300005457	Bacteria	3051
46	Ga0068853_100099608	3300005539	Bacteria	2568
47	Ga0068853_100250504	3300005539	Bacteria	1625
48	Ga0070672_100153736	3300005543	Bacteria	1905
49	Ga0070672_100653130	3300005543	Bacteria	919
50	Ga0070693_100387694	3300005547	Unclassified	965
51	Ga0070665_100394291	3300005548	Bacteria	1392
52	Ga0070665_100471293	3300005548	Bacteria	1266
53	Ga0070665_101490221	3300005548	Bacteria	685
54	Ga0070664_100586503	3300005564	Bacteria	1033
55	Ga0068857_100056593	3300005577	Bacteria	3480
56	Ga0068854_100009140	3300005578	Bacteria	6390
57	Ga0068854_100370097	3300005578	Bacteria	1178
58	Ga0068854_100606920	3300005578	Unclassified	935
59	Ga0070702_100347066	3300005615	Bacteria	1044
60	Ga0068852_100192344	3300005616	Bacteria	1926
61	Ga0068852_100265182	3300005616	Bacteria	1650
62	Ga0068852_100301559	3300005616	Unclassified	1551
63	Ga0068852_100322886	3300005616	Bacteria	1500
64	Ga0068852_100385410	3300005616	Bacteria	1376
65	Ga0068859_100543338	3300005617	Unclassified	1257
66	Ga0068859_102346161	3300005617	Bacteria	588
67	Ga0068864_100310810	3300005618	Bacteria	1477
68	Ga0068864_100823570	3300005618	Bacteria	913
69	Ga0068864_101327305	3300005618	Unclassified	720
70	Ga0068864_101755581	3300005618	Bacteria	625
71	Ga0068870_10457802	3300005840	Unclassified	842
72	Ga0068863_100004019	3300005841	Bacteria	14525
73	Ga0068863_100297770	3300005841	Bacteria	1564
74	Ga0068860_100000510	3300005843	Bacteria	48057
75	Ga0068860_100449460	3300005843	Bacteria	1281
76	Ga0081455_10002595	3300005937	Bacteria	21431
77	Ga0081455_10574538	3300005937	Bacteria	740
78	Ga0075365_10338684	3300006038	Bacteria	1060
79	Ga0075364_10179567	3300006051	Bacteria	1432
80	Ga0075362_10300140	3300006177	Bacteria	797
81	Ga0075367_10647464	3300006178	Bacteria	672
82	Ga0075366_10077396	3300006195	Bacteria	1985
83	Ga0075366_10129060	3300006195	Bacteria	1525
84	Ga0097621_100462450	3300006237	Bacteria	1144
85	Ga0097621_100731944	3300006237	Bacteria	912
86	Ga0075370_10086053	3300006353	Bacteria	1810
87	Ga0075370_10666429	3300006353	Bacteria	632
88	Ga0075370_10868812	3300006353	Bacteria	551
89	Ga0068865_100625030	3300006881	Bacteria	913
90	Ga0097620_100543316	3300006931	Unclassified	1257
91	Ga0097620_102346377	3300006931	Bacteria	588
92	Ga0079104_1038915	3300006946	Bacteria	1124
93	Ga0105250_10409688	3300009092	Unclassified	602
94	Ga0105240_10009929	3300009093	Bacteria	13423
95	Ga0105240_10112867	3300009093	Bacteria	3284
96	Ga0105240_10209964	3300009093	Unclassified	2276
97	Ga0105240_11456977	3300009093	Unclassified	719
98	Ga0105240_12113840	3300009093	Unclassified	584
99	Ga0105245_10409484	3300009098	Bacteria	1357
100	Ga0105245_12254301	3300009098	Bacteria	598
101	Ga0105243_11861191	3300009148	Bacteria	634
102	Ga0105241_10284779	3300009174	Bacteria	1413
103	Ga0105242_10029318	3300009176	Bacteria	4389
104	Ga0105242_10082222	3300009176	Unclassified	2695
105	Ga0105242_12944060	3300009176	Bacteria	527
106	Ga0105248_10628596	3300009177	Bacteria	1211
107	Ga0105237_10397881	3300009545	Unclassified	1382
108	Ga0105238_10003393	3300009551	Bacteria	15900
109	Ga0105249_10193970	3300009553	Bacteria	1984
110	Ga0105239_10009282	3300010375	Bacteria	11120
111	Ga0105239_10110020	3300010375	Bacteria	3054
112	Ga0105246_10258271	3300011119	Bacteria	1386
113	Ga0105246_10467768	3300011119	Unclassified	1064
114	Ga0157374_10000757	3300013296	Bacteria	28225
115	Ga0157374_10875205	3300013296	Bacteria	916
116	Ga0157378_11250577	3300013297	Bacteria	783
117	Ga0157378_11280101	3300013297	Bacteria	774
118	Ga0157378_11967698	3300013297	Bacteria	634
119	Ga0163162_10008818	3300013306	Bacteria	9806
120	Ga0163162_10036971	3300013306	Bacteria	4870
121	Ga0163162_10481988	3300013306	Bacteria	1372
122	Ga0157375_10108508	3300013308	Bacteria	2871
123	Ga0157375_10471410	3300013308	Bacteria	1421
124	Ga0157375_10952132	3300013308	Bacteria	1000
125	Ga0157375_12244261	3300013308	Bacteria	650
126	Ga0163163_10647927	3300014325	Bacteria	1120
127	Ga0163163_10877989	3300014325	Bacteria	960
128	Ga0163163_11055042	3300014325	Unclassified	876
129	Ga0163163_12878905	3300014325	Bacteria	537
130	Ga0157380_10660205	3300014326	Bacteria	1045
131	Ga0157380_12344441	3300014326	Bacteria	599
132	Ga0182008_10023506	3300014497	Bacteria	3147
133	Ga0157379_10345689	3300014968	Bacteria	1361
134	Ga0157379_11878765	3300014968	Bacteria	590
135	Ga0157376_10649877	3300014969	Bacteria	1055
136	Ga0182006_1007199	3300015261	Bacteria	5111
137	Ga0182007_10005358	3300015262	Bacteria	5651
138	Ga0182005_1004111	3300015265	Bacteria	4760
139	Ga0163161_10096758	3300017792	Bacteria	2192
140	Ga0209436_103392	3300025208	Bacteria	4259
141	Ga0207425_1011876	3300025245	Bacteria	2061
142	Ga0209129_1005872	3300025258	Bacteria	4170
143	Ga0209565_1008490	3300025263	Bacteria	2682
144	Ga0209565_1014566	3300025263	Bacteria	1801
145	Ga0209130_1000050	3300025284	Bacteria	222092
146	Ga0209130_1000082	3300025284	Bacteria	164441
147	Ga0209675_1009291	3300025291	Bacteria	3489
148	Ga0209675_1009831	3300025291	Bacteria	3335
149	Ga0209675_1011229	3300025291	Bacteria	2985
150	Ga0209676_1000029	3300025292	Bacteria	520536
151	Ga0209676_1004456	3300025292	Bacteria	7787
152	Ga0209025_1005031	3300025294	Bacteria	11033
153	Ga0209564_1000028	3300025295	Bacteria	510986
154	Ga0209564_1000154	3300025295	Bacteria	166849
155	Ga0209564_1085091	3300025295	Bacteria	602
156	Ga0209050_1000003	3300025298	Bacteria	1609245
157	Ga0209050_1002246	3300025298	Bacteria	17232
158	Ga0209050_1003209	3300025298	Bacteria	12372
159	Ga0209050_1009468	3300025298	Bacteria	4981
160	Ga0209050_1011834	3300025298	Bacteria	4080
161	Ga0209256_1000071	3300025299	Bacteria	242618
162	Ga0209256_1016934	3300025299	Bacteria	2453
163	Ga0207426_1000071	3300025302	Bacteria	329539
164	Ga0207426_1001744	3300025302	Bacteria	16547
165	Ga0209051_1000003	3300025303	Bacteria	1609245
166	Ga0209051_1016209	3300025303	Bacteria	3387
167	Ga0209051_1078032	3300025303	Bacteria	967
168	Ga0209257_1000018	3300025304	Bacteria	836016
169	Ga0209257_1000049	3300025304	Bacteria	441224
170	Ga0209257_1044925	3300025304	Bacteria	1286
171	Ga0209257_1053255	3300025304	Bacteria	1133
172	Ga0209257_1055562	3300025304	Bacteria	1097
173	Ga0207680_10132936	3300025903	Bacteria	1641
174	Ga0207680_10223266	3300025903	Bacteria	1292
175	Ga0207680_10830079	3300025903	Bacteria	663
176	Ga0207647_10092345	3300025904	Bacteria	1805
177	Ga0207654_10151908	3300025911	Bacteria	1487
178	Ga0207707_11114344	3300025912	Unclassified	643
179	Ga0207695_10008170	3300025913	Bacteria	13149
180	Ga0207695_10223665	3300025913	Unclassified	1789
181	Ga0207695_11593577	3300025913	Unclassified	533
182	Ga0207671_10212414	3300025914	Bacteria	1514
183	Ga0207694_10791674	3300025924	Bacteria	801
184	Ga0207694_11315297	3300025924	Bacteria	611
185	Ga0207694_11853370	3300025924	Bacteria	506
186	Ga0207650_10116729	3300025925	Bacteria	2073
187	Ga0207650_10896161	3300025925	Bacteria	753
188	Ga0207687_10483108	3300025927	Bacteria	1032
189	Ga0207687_11190311	3300025927	Bacteria	655
190	Ga0207644_10102714	3300025931	Bacteria	2151
191	Ga0207706_10008972	3300025933	Bacteria	9203
192	Ga0207686_10016213	3300025934	Bacteria	4178
193	Ga0207709_10904478	3300025935	Bacteria	717
194	Ga0207669_10076399	3300025937	Bacteria	2126
195	Ga0207704_10135170	3300025938	Bacteria	1715
196	Ga0207691_10024718	3300025940	Bacteria	5648
197	Ga0207711_10879066	3300025941	Bacteria	834
198	Ga0207689_10450665	3300025942	Bacteria	1075
199	Ga0207679_10213246	3300025945	Bacteria	1620
200	Ga0207679_10470135	3300025945	Bacteria	1118
201	Ga0207679_10521860	3300025945	Bacteria	1062
202	Ga0207640_10012061	3300025981	Bacteria	4913
203	Ga0207640_10431668	3300025981	Bacteria	1081
204	Ga0207640_11149083	3300025981	Bacteria	689
205	Ga0207658_10014258	3300025986	Bacteria	5442
206	Ga0207658_10984814	3300025986	Bacteria	769
207	Ga0207677_10576156	3300026023	Bacteria	984
208	Ga0207703_10361853	3300026035	Bacteria	1338
209	Ga0207639_10235657	3300026041	Bacteria	1589
210	Ga0207639_10271652	3300026041	Bacteria	1487
211	Ga0207639_11266569	3300026041	Bacteria	692
212	Ga0207639_11645040	3300026041	Unclassified	602
213	Ga0207678_10019199	3300026067	Bacteria	6002
214	Ga0207678_11546722	3300026067	Bacteria	585
215	Ga0207702_11806978	3300026078	Unclassified	603
216	Ga0207641_10000821	3300026088	Bacteria	33006
217	Ga0207641_10231906	3300026088	Bacteria	1716
218	Ga0207641_11051921	3300026088	Unclassified	812
219	Ga0207648_10088207	3300026089	Bacteria	2709
220	Ga0207676_10326576	3300026095	Bacteria	1410
221	Ga0207676_11247902	3300026095	Bacteria	737
222	Ga0207676_11909606	3300026095	Bacteria	592
223	Ga0207674_10081062	3300026116	Bacteria	3247
224	Ga0207675_102689467	3300026118	Bacteria	506
225	Ga0207683_10246543	3300026121	Bacteria	1630
226	Ga0207683_10403699	3300026121	Bacteria	1257
227	Ga0207698_10048538	3300026142	Bacteria	3224
228	Ga0207698_10210116	3300026142	Bacteria	1750
229	Ga0207698_10220351	3300026142	Bacteria	1714
230	Ga0207698_12225929	3300026142	Bacteria	561
231	Ga0268266_10095614	3300028379	Bacteria	2610
232	Ga0268266_10459241	3300028379	Unclassified	1212
233	Ga0268264_10000025	3300028381	Bacteria	468619
234	Ga0268264_11370779	3300028381	Bacteria	718
235	Ga0268264_12427569	3300028381	Bacteria	530
236	Ga0265336_10001533	3300028666	Bacteria	10390
237	Ga0307517_10166079	3300028786	Bacteria	1466
238	Ga0265324_10001433	3300029957	Bacteria	13672
239	Ga0265324_10023732	3300029957	Unclassified	2183
240	Ga0307513_10000486	3300031456	Bacteria	57184
241	Ga0307509_10292096	3300031507	Bacteria	1384
242	Ga0307408_100098583	3300031548	Bacteria	2222
243	Ga0307408_102520118	3300031548	Unclassified	500
244	Ga0307516_10752166	3300031730	Bacteria	634
245	Ga0307405_10510364	3300031731	Bacteria	965
246	Ga0307410_10024929	3300031852	Bacteria	3744
247	Ga0307406_10018095	3300031901	Bacteria	4111
248	Ga0307409_100031520	3300031995	Bacteria	3828
249	Ga0307409_102147627	3300031995	Bacteria	588
250	Ga0307414_10102795	3300032004	Bacteria	2154
251	Ga0307414_11317195	3300032004	Bacteria	670
252	Ga0307411_10024387	3300032005	Bacteria	3605
253	Ga0307411_10536562	3300032005	Bacteria	996
254	Ga0307411_11110109	3300032005	Unclassified	713
255	Ga0307510_10094571	3300033180	Bacteria	2813
256	Ga0395898_0049187	3300037466	Bacteria	4132
257	Ga0395905_0128984	3300037471	Bacteria	2378
258	Ga0395905_1017653	3300037471	Bacteria	732
259	Ga0436365_1153183	3300039437	Bacteria	620
260	Ga0436361_1160070	3300039447	Bacteria	1262
261	Ga0439465_0148980	3300041413	Bacteria	835
262	Ga0451798_0354479	3300041458	Bacteria	904
263	Ga0451800_0099571	3300041459	Bacteria	1273
264	Ga0451851_0959056	3300041507	Unclassified	841
265	Ga0451853_1981532	3300041512	Unclassified	1029
266	Ga0451853_2872608	3300041512	Unclassified	923
267	Ga0450898_023079	3300042134	Bacteria	1104
268	Ga0450898_103623	3300042134	Bacteria	596
269	Ga0439464_0142042	3300042439	Bacteria	748
270	Ga0466969_0000157	3300044656	Bacteria	36880
271	Ga0466972_0068477	3300044658	Bacteria	1695
272	Ga0466965_0214583	3300044683	Bacteria	1024
273	Ga0466966_0004340	3300044684	Bacteria	9348
274	Ga0466966_0014314	3300044684	Bacteria	5252
275	Ga0466966_0064659	3300044684	Bacteria	2302
276	Ga0466961_0014705	3300044693	Bacteria	5029
277	Ga0466961_0113866	3300044693	Bacteria	1700
278	Ga0466970_0029772	3300044765	Bacteria	2877
279	Ga0466970_0088699	3300044765	Bacteria	1677
280	Ga0466970_0096593	3300044765	Bacteria	1607
281	Ga0466959_0049957	3300045049	Bacteria	3072
282	Ga0466967_0229329	3300045976	Bacteria	1768
283	Ga0495617_000011	3300046452	Bacteria	301936
284	Ga0495627_056083	3300046453	Bacteria	1175
285	Ga0495590_0002586	3300046457	Bacteria	7478
286	Ga0495638_0000099	3300046460	Bacteria	139325
287	Ga0495638_0061753	3300046460	Bacteria	2315
288	Ga0495638_0212087	3300046460	Bacteria	1087
289	Ga0495650_0001477	3300046471	Bacteria	22549
290	Ga0495650_0012050	3300046471	Bacteria	4678
291	Ga0495639_0046741	3300046475	Bacteria	1960
292	Ga0495584_0084031	3300046491	Bacteria	1603
293	Ga0495585_0001778	3300046492	Bacteria	16374
294	Ga0495607_0008465	3300046501	Bacteria	7029
295	Ga0495607_0236350	3300046501	Bacteria	886
296	Ga0495583_0000220	3300046506	Bacteria	96267
297	Ga0495583_0003920	3300046506	Bacteria	11007
298	Ga0495606_0008326	3300046507	Bacteria	9035
299	Ga0495606_0409322	3300046507	Unclassified	704
300	Ga0495610_0000007	3300046512	Bacteria	820919
301	Ga0495620_0258164	3300046515	Unclassified	664
302	Ga0495632_0053136	3300046519	Unclassified	1990
303	Ga0495632_0447602	3300046519	Unclassified	561
304	Ga0495643_0196394	3300046522	Bacteria	971
305	Ga0495648_0000004	3300046524	Bacteria	373639
306	Ga0495648_0013967	3300046524	Bacteria	5908
307	Ga0495642_0009931	3300046528	Bacteria	3646
308	Ga0495654_0004713	3300046530	Bacteria	8035
309	Ga0495622_0000157	3300046557	Bacteria	57030
310	Ga0495633_0000327	3300046558	Bacteria	53707
311	Ga0495633_0001416	3300046558	Bacteria	18679
312	Ga0495633_0051464	3300046558	Bacteria	1940
313	Ga0495668_0012207	3300046616	Bacteria	5105
314	Ga0495668_0050387	3300046616	Bacteria	2308
315	Ga0495625_0000412	3300046660	Bacteria	64883
316	Ga0495661_0002829	3300046665	Bacteria	13143
317	Ga0495661_0069339	3300046665	Bacteria	2066
318	Ga0495670_0330556	3300046691	Unclassified	819
319	Ga0495670_0673576	3300046691	Unclassified	564
320	Ga0495671_0113317	3300046692	Bacteria	1324
321	Ga0495649_0012587	3300046694	Bacteria	4911
322	Ga0495589_0014996	3300046794	Bacteria	3988
323	Ga0495589_0129310	3300046794	Bacteria	1213
324	Ga0495660_0086040	3300046810	Bacteria	1641
325	Ga0495636_0024567	3300047318	Bacteria	2445
326	Ga0495683_0006778	3300047323	Bacteria	6227
327	Ga0495687_001413	3300047443	Bacteria	22111
328	Ga0495687_147922	3300047443	Unclassified	807
329	Ga0495677_0030918	3300047445	Bacteria	1949
330	Ga0495679_013734	3300047446	Bacteria	3025
331	Ga0495679_028169	3300047446	Bacteria	1844
332	Ga0495673_0000173	3300047469	Bacteria	106086
333	Ga0495686_0335218	3300047472	Bacteria	826
334	Ga0495686_0700860	3300047472	Bacteria	516
335	Ga0495615_0048026	3300048090	Bacteria	1089
336	Ga0495626_0162890	3300048091	Bacteria	934
337	Ga0496114_0001921	3300048917	Bacteria	15826
338	Ga0496116_0156621	3300048919	Bacteria	1256
339	Ga0496119_0006641	3300048922	Bacteria	10642
340	Ga0496120_0000018	3300048923	Bacteria	263952
341	Ga0496126_0927120	3300048929	Unclassified	658
342	Ga0495678_012163	3300049459	Bacteria	4087
343	Ga0501041_0375299	3300049577	Bacteria	900
344	Ga0501042_0238382	3300049578	Bacteria	1312
345	Ga0501042_0474901	3300049578	Bacteria	907
346	Ga0501048_0253502	3300049582	Bacteria	1250
347	Ga0501069_0556718	3300049585	Bacteria	686
348	Ga0501070_0395851	3300049586	Bacteria	1118
349	Ga0501071_0403439	3300049587	Bacteria	1044
350	Ga0501071_1409928	3300049587	Bacteria	538
351	Ga0501076_1000846	3300049592	Bacteria	689
352	Ga0501076_1044368	3300049592	Bacteria	673
353	Ga0501044_0486272	3300049823	Bacteria	1137
354	Ga0501044_1106543	3300049823	Bacteria	661
355	nmdc:mga03683_110003_c1	3300050489	Bacteria	1217
356	nmdc:mga0yw44_272356_c1	3300050492	Bacteria	1130
357	nmdc:mga0k408_177357_c1	3300050493	Bacteria	1270
358	nmdc:mga0k408_236494_c1	3300050493	Bacteria	1091
359	nmdc:mga07m45_105485_c1	3300050496	Bacteria	1621
360	Ga0500578_0018847	3300053086	Bacteria	4433
361	Ga0500578_0217507	3300053086	Bacteria	1163
362	Ga0500644_0058335	3300053088	Bacteria	1350
363	Ga0500651_0008892	3300053093	Bacteria	5940
364	Ga0500566_0214699	3300053094	Bacteria	961
365	Ga0500650_0206793	3300053098	Unclassified	892
366	Ga0500650_0251780	3300053098	Bacteria	792
367	Ga0500555_016457	3300053103	Bacteria	2130
368	Ga0500595_003100	3300053119	Bacteria	7870
369	Ga0500652_123560	3300053131	Bacteria	1081
370	Ga0500568_0013147	3300053139	Unclassified	3780
371	Ga0500577_0234159	3300053142	Bacteria	796
372	Ga0500586_020279	3300053145	Bacteria	2080
373	Ga0500616_0017218	3300053153	Bacteria	4103
374	Ga0500616_0202964	3300053153	Unclassified	877
375	Ga0500622_0064380	3300053156	Unclassified	1865
376	Ga0500576_231389	3300053725	Bacteria	595
377	Ga0500645_003416	3300053730	Bacteria	6456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025981	Ga0207640_11149083	Ga0207640_111490831	99
2	3300046460	Ga0495638_0212087	Ga0495638_0212087_88_504	101
3	3300031548	Ga0307408_102520118	Ga0307408_1025201181	102
4	3300032005	Ga0307411_11110109	Ga0307411_111101092	102
5	3300041458	Ga0451798_0354479	Ga0451798_0354479_43_360	103
6	3300042439	Ga0439464_0142042	Ga0439464_0142042_341_655	103
7	3300046665	Ga0495661_0002829	Ga0495661_0002829_6935_7252	103
8	iso_pu_bacteria	2818991436	2819541926	103
9	3300005366	Ga0070659_100500520	Ga0070659_1005005202	104
10	3300017792	Ga0163161_10096758	Ga0163161_100967584	104
11	3300032004	Ga0307414_10102795	Ga0307414_101027952	104
12	3300003316	rootH1_10118329	rootH1_101183292	105
13	3300003323	rootH1_10061288	rootH1_100612882	105
14	3300003771	Ga0055526_1000187	Ga0055526_100018718	105
15	3300003775	Ga0055524_1000094	Ga0055524_10000946	105
16	3300005293	Ga0065715_10842628	Ga0065715_108426282	105
17	3300005331	Ga0070670_100091477	Ga0070670_1000914773	105
18	3300005331	Ga0070670_101457549	Ga0070670_1014575491	105
19	3300005334	Ga0068869_100292238	Ga0068869_1002922382	105
20	3300005337	Ga0070682_100953145	Ga0070682_1009531451	105
21	3300005340	Ga0070689_101793042	Ga0070689_1017930421	105
22	3300005367	Ga0070667_100052431	Ga0070667_1000524312	105
23	3300005455	Ga0070663_100034295	Ga0070663_1000342953	105
24	3300005456	Ga0070678_100181226	Ga0070678_1001812262	105
25	3300005539	Ga0068853_100099608	Ga0068853_1000996083	105
26	3300005547	Ga0070693_100387694	Ga0070693_1003876942	105
27	3300005548	Ga0070665_100394291	Ga0070665_1003942912	105
28	3300005548	Ga0070665_100471293	Ga0070665_1004712931	105
29	3300005548	Ga0070665_101490221	Ga0070665_1014902211	105
30	3300005578	Ga0068854_100606920	Ga0068854_1006069202	105
31	3300005616	Ga0068852_100301559	Ga0068852_1003015593	105
32	3300005616	Ga0068852_100385410	Ga0068852_1003854101	105
33	3300005617	Ga0068859_100543338	Ga0068859_1005433382	105
34	3300005618	Ga0068864_100823570	Ga0068864_1008235702	105
35	3300005618	Ga0068864_101327305	Ga0068864_1013273052	105
36	3300005840	Ga0068870_10457802	Ga0068870_104578022	105
37	3300005841	Ga0068863_100004019	Ga0068863_10000401913	105
38	3300005843	Ga0068860_100000510	Ga0068860_1000005108	105
39	3300005843	Ga0068860_100449460	Ga0068860_1004494602	105
40	3300005937	Ga0081455_10002595	Ga0081455_100025953	105
41	3300005937	Ga0081455_10574538	Ga0081455_105745381	105
42	3300006038	Ga0075365_10338684	Ga0075365_103386842	105
43	3300006051	Ga0075364_10179567	Ga0075364_101795672	105
44	3300006178	Ga0075367_10647464	Ga0075367_106474642	105
45	3300006195	Ga0075366_10077396	Ga0075366_100773963	105
46	3300006931	Ga0097620_100543316	Ga0097620_1005433162	105
47	3300009092	Ga0105250_10409688	Ga0105250_104096882	105
48	3300009093	Ga0105240_10009929	Ga0105240_100099294	105
49	3300009093	Ga0105240_10112867	Ga0105240_101128672	105
50	3300009093	Ga0105240_11456977	Ga0105240_114569772	105
51	3300009093	Ga0105240_12113840	Ga0105240_121138402	105
52	3300009098	Ga0105245_10409484	Ga0105245_104094842	105
53	3300009174	Ga0105241_10284779	Ga0105241_102847791	105
54	3300009176	Ga0105242_10082222	Ga0105242_100822222	105
55	3300009177	Ga0105248_10628596	Ga0105248_106285962	105
56	3300009545	Ga0105237_10397881	Ga0105237_103978812	105
57	3300009551	Ga0105238_10003393	Ga0105238_1000339313	105
58	3300009553	Ga0105249_10193970	Ga0105249_101939702	105
59	3300010375	Ga0105239_10009282	Ga0105239_100092823	105
60	3300010375	Ga0105239_10110020	Ga0105239_101100202	105
61	3300011119	Ga0105246_10467768	Ga0105246_104677682	105
62	3300013296	Ga0157374_10000757	Ga0157374_1000075711	105
63	3300013306	Ga0163162_10008818	Ga0163162_100088187	105
64	3300014325	Ga0163163_11055042	Ga0163163_110550422	105
65	3300014326	Ga0157380_10660205	Ga0157380_106602052	105
66	3300014968	Ga0157379_11878765	Ga0157379_118787651	105
67	3300025263	Ga0209565_1014566	Ga0209565_10145663	105
68	3300025295	Ga0209564_1000028	Ga0209564_1000028391	105
69	3300025295	Ga0209564_1000154	Ga0209564_100015464	105
70	3300025298	Ga0209050_1011834	Ga0209050_10118342	105
71	3300025299	Ga0209256_1000071	Ga0209256_1000071174	105
72	3300025304	Ga0209257_1044925	Ga0209257_10449251	105
73	3300025304	Ga0209257_1055562	Ga0209257_10555622	105
74	3300025903	Ga0207680_10132936	Ga0207680_101329362	105
75	3300025903	Ga0207680_10223266	Ga0207680_102232662	105
76	3300025904	Ga0207647_10092345	Ga0207647_100923452	105
77	3300025911	Ga0207654_10151908	Ga0207654_101519082	105
78	3300025912	Ga0207707_11114344	Ga0207707_111143441	105
79	3300025913	Ga0207695_10008170	Ga0207695_1000817013	105
80	3300025913	Ga0207695_10223665	Ga0207695_102236652	105
81	3300025913	Ga0207695_11593577	Ga0207695_115935771	105
82	3300025914	Ga0207671_10212414	Ga0207671_102124141	105
83	3300025924	Ga0207694_11315297	Ga0207694_113152971	105
84	3300025925	Ga0207650_10896161	Ga0207650_108961612	105
85	3300025927	Ga0207687_10483108	Ga0207687_104831081	105
86	3300025931	Ga0207644_10102714	Ga0207644_101027142	105
87	3300025941	Ga0207711_10879066	Ga0207711_108790661	105
88	3300025945	Ga0207679_10213246	Ga0207679_102132463	105
89	3300025945	Ga0207679_10470135	Ga0207679_104701352	105
90	3300025986	Ga0207658_10014258	Ga0207658_100142582	105
91	3300026041	Ga0207639_10271652	Ga0207639_102716523	105
92	3300026041	Ga0207639_11645040	Ga0207639_116450401	105
93	3300026067	Ga0207678_10019199	Ga0207678_100191993	105
94	3300026088	Ga0207641_10000821	Ga0207641_1000082116	105
95	3300026088	Ga0207641_11051921	Ga0207641_110519212	105
96	3300026095	Ga0207676_11247902	Ga0207676_112479021	105
97	3300026121	Ga0207683_10403699	Ga0207683_104036992	105
98	3300026142	Ga0207698_10048538	Ga0207698_100485384	105
99	3300026142	Ga0207698_12225929	Ga0207698_122259291	105
100	3300028379	Ga0268266_10095614	Ga0268266_100956143	105
101	3300028379	Ga0268266_10459241	Ga0268266_104592412	105
102	3300028381	Ga0268264_10000025	Ga0268264_10000025309	105
103	3300028381	Ga0268264_12427569	Ga0268264_124275692	105
104	3300031507	Ga0307509_10292096	Ga0307509_102920961	105
105	3300031548	Ga0307408_100098583	Ga0307408_1000985833	105
106	3300031731	Ga0307405_10510364	Ga0307405_105103642	105
107	3300031852	Ga0307410_10024929	Ga0307410_100249295	105
108	3300031901	Ga0307406_10018095	Ga0307406_100180953	105
109	3300031995	Ga0307409_100031520	Ga0307409_1000315202	105
110	3300031995	Ga0307409_102147627	Ga0307409_1021476271	105
111	3300032004	Ga0307414_11317195	Ga0307414_113171951	105
112	3300032005	Ga0307411_10024387	Ga0307411_100243876	105
113	3300032005	Ga0307411_10536562	Ga0307411_105365621	105
114	3300033180	Ga0307510_10094571	Ga0307510_100945712	105
115	3300037466	Ga0395898_0049187	Ga0395898_0049187_2493_2813	105
116	3300037471	Ga0395905_0128984	Ga0395905_0128984_708_1031	105
117	3300037471	Ga0395905_1017653	Ga0395905_1017653_280_600	105
118	3300041413	Ga0439465_0148980	Ga0439465_0148980_412_738	105
119	3300042134	Ga0450898_023079	Ga0450898_023079_617_937	105
120	3300042134	Ga0450898_103623	Ga0450898_103623_178_519	105
121	3300044684	Ga0466966_0014314	Ga0466966_0014314_4001_4321	105
122	3300044693	Ga0466961_0113866	Ga0466961_0113866_522_842	105
123	3300044765	Ga0466970_0088699	Ga0466970_0088699_768_1088	105
124	3300045049	Ga0466959_0049957	Ga0466959_0049957_1672_1992	105
125	3300046452	Ga0495617_000011	Ga0495617_000011_212207_212527	105
126	3300046453	Ga0495627_056083	Ga0495627_056083_565_885	105
127	3300046457	Ga0495590_0002586	Ga0495590_0002586_2103_2429	105
128	3300046460	Ga0495638_0000099	Ga0495638_0000099_19654_19974	105
129	3300046460	Ga0495638_0061753	Ga0495638_0061753_574_900	105
130	3300046471	Ga0495650_0001477	Ga0495650_0001477_14283_14603	105
131	3300046471	Ga0495650_0012050	Ga0495650_0012050_2496_2816	105
132	3300046475	Ga0495639_0046741	Ga0495639_0046741_576_896	105
133	3300046491	Ga0495584_0084031	Ga0495584_0084031_668_988	105
134	3300046492	Ga0495585_0001778	Ga0495585_0001778_14056_14376	105
135	3300046501	Ga0495607_0008465	Ga0495607_0008465_5993_6313	105
136	3300046501	Ga0495607_0236350	Ga0495607_0236350_30_350	105
137	3300046506	Ga0495583_0000220	Ga0495583_0000220_51122_51442	105
138	3300046507	Ga0495606_0008326	Ga0495606_0008326_6241_6561	105
139	3300046512	Ga0495610_0000007	Ga0495610_0000007_729148_729468	105
140	3300046515	Ga0495620_0258164	Ga0495620_0258164_173_496	105
141	3300046519	Ga0495632_0053136	Ga0495632_0053136_355_678	105
142	3300046519	Ga0495632_0447602	Ga0495632_0447602_116_442	105
143	3300046522	Ga0495643_0196394	Ga0495643_0196394_527_847	105
144	3300046524	Ga0495648_0000004	Ga0495648_0000004_288128_288448	105
145	3300046524	Ga0495648_0013967	Ga0495648_0013967_423_743	105
146	3300046528	Ga0495642_0009931	Ga0495642_0009931_1351_1671	105
147	3300046530	Ga0495654_0004713	Ga0495654_0004713_7422_7742	105
148	3300046557	Ga0495622_0000157	Ga0495622_0000157_44969_45289	105
149	3300046558	Ga0495633_0000327	Ga0495633_0000327_19654_19974	105
150	3300046558	Ga0495633_0001416	Ga0495633_0001416_15578_15898	105
151	3300046558	Ga0495633_0051464	Ga0495633_0051464_928_1248	105
152	3300046616	Ga0495668_0012207	Ga0495668_0012207_2418_2738	105
153	3300046616	Ga0495668_0050387	Ga0495668_0050387_714_1040	105
154	3300046660	Ga0495625_0000412	Ga0495625_0000412_19643_19963	105
155	3300046665	Ga0495661_0069339	Ga0495661_0069339_1427_1747	105
156	3300046691	Ga0495670_0330556	Ga0495670_0330556_437_757	105
157	3300046691	Ga0495670_0673576	Ga0495670_0673576_212_532	105
158	3300046692	Ga0495671_0113317	Ga0495671_0113317_881_1201	105
159	3300046794	Ga0495589_0129310	Ga0495589_0129310_337_657	105
160	3300046810	Ga0495660_0086040	Ga0495660_0086040_51_371	105
161	3300047318	Ga0495636_0024567	Ga0495636_0024567_1876_2196	105
162	3300047323	Ga0495683_0006778	Ga0495683_0006778_2218_2538	105
163	3300047443	Ga0495687_001413	Ga0495687_001413_4097_4417	105
164	3300047443	Ga0495687_147922	Ga0495687_147922_86_409	105
165	3300047445	Ga0495677_0030918	Ga0495677_0030918_695_1015	105
166	3300047446	Ga0495679_013734	Ga0495679_013734_325_645	105
167	3300047446	Ga0495679_028169	Ga0495679_028169_1131_1451	105
168	3300047469	Ga0495673_0000173	Ga0495673_0000173_90880_91200	105
169	3300047472	Ga0495686_0335218	Ga0495686_0335218_457_777	105
170	3300047472	Ga0495686_0700860	Ga0495686_0700860_45_371	105
171	3300048090	Ga0495615_0048026	Ga0495615_0048026_686_1006	105
172	3300048091	Ga0495626_0162890	Ga0495626_0162890_467_793	105
173	3300048917	Ga0496114_0001921	Ga0496114_0001921_10668_10991	105
174	3300048919	Ga0496116_0156621	Ga0496116_0156621_491_811	105
175	3300048922	Ga0496119_0006641	Ga0496119_0006641_7326_7658	105
176	3300048923	Ga0496120_0000018	Ga0496120_0000018_64580_64912	105
177	3300048929	Ga0496126_0927120	Ga0496126_0927120_133_453	105
178	3300049459	Ga0495678_012163	Ga0495678_012163_2108_2428	105
179	3300049577	Ga0501041_0375299	Ga0501041_0375299_557_883	105
180	3300049578	Ga0501042_0238382	Ga0501042_0238382_897_1223	105
181	3300049578	Ga0501042_0474901	Ga0501042_0474901_427_753	105
182	3300049582	Ga0501048_0253502	Ga0501048_0253502_273_599	105
183	3300049585	Ga0501069_0556718	Ga0501069_0556718_26_352	105
184	3300049586	Ga0501070_0395851	Ga0501070_0395851_613_939	105
185	3300049587	Ga0501071_0403439	Ga0501071_0403439_409_735	105
186	3300049587	Ga0501071_1409928	Ga0501071_1409928_90_416	105
187	3300049592	Ga0501076_1000846	Ga0501076_1000846_96_422	105
188	3300049592	Ga0501076_1044368	Ga0501076_1044368_219_545	105
189	3300049823	Ga0501044_0486272	Ga0501044_0486272_83_403	105
190	3300049823	Ga0501044_1106543	Ga0501044_1106543_271_612	105
191	3300050492	nmdc:mga0yw44_272356_c1	nmdc:mga0yw44_272356_c1_534_854	105
192	3300050493	nmdc:mga0k408_177357_c1	nmdc:mga0k408_177357_c1_90_410	105
193	3300053086	Ga0500578_0018847	Ga0500578_0018847_3666_4010	105
194	3300053094	Ga0500566_0214699	Ga0500566_0214699_491_823	105
195	3300053103	Ga0500555_016457	Ga0500555_016457_850_1188	105
196	3300053119	Ga0500595_003100	Ga0500595_003100_6578_6910	105
197	3300053145	Ga0500586_020279	Ga0500586_020279_589_909	105
198	3300053153	Ga0500616_0017218	Ga0500616_0017218_1745_2077	105
199	3300053153	Ga0500616_0202964	Ga0500616_0202964_363_683	105
200	3300053725	Ga0500576_231389	Ga0500576_231389_208_531	105
201	3300003322	rootL2_10322494	rootL2_103224942	106
202	3300005328	Ga0070676_10688852	Ga0070676_106888521	106
203	3300005365	Ga0070688_100814239	Ga0070688_1008142391	106
204	3300005367	Ga0070667_100672418	Ga0070667_1006724182	106
205	3300005543	Ga0070672_100653130	Ga0070672_1006531302	106
206	3300005617	Ga0068859_102346161	Ga0068859_1023461612	106
207	3300006931	Ga0097620_102346377	Ga0097620_1023463772	106
208	3300009093	Ga0105240_10209964	Ga0105240_102099642	106
209	3300013297	Ga0157378_11280101	Ga0157378_112801011	106
210	3300013308	Ga0157375_10952132	Ga0157375_109521322	106
211	3300025986	Ga0207658_10984814	Ga0207658_109848142	106
212	3300039447	Ga0436361_1160070	Ga0436361_1160070_182_502	106
213	3300044658	Ga0466972_0068477	Ga0466972_0068477_1035_1358	106
214	3300044683	Ga0466965_0214583	Ga0466965_0214583_402_725	106
215	3300044765	Ga0466970_0096593	Ga0466970_0096593_201_524	106
216	3300045976	Ga0466967_0229329	Ga0466967_0229329_1076_1399	106
217	3300053086	Ga0500578_0217507	Ga0500578_0217507_336_677	106
218	3300053088	Ga0500644_0058335	Ga0500644_0058335_338_679	106
219	3300053093	Ga0500651_0008892	Ga0500651_0008892_2766_3107	106
220	3300053098	Ga0500650_0251780	Ga0500650_0251780_394_735	106
221	3300053131	Ga0500652_123560	Ga0500652_123560_242_583	106
222	3300053142	Ga0500577_0234159	Ga0500577_0234159_421_762	106
223	3300053156	Ga0500622_0064380	Ga0500622_0064380_37_378	106
224	3300002987	JGI25159J45721_1000148	JGI25159J45721_100014818	107
225	3300002987	JGI25159J45721_1003614	JGI25159J45721_10036143	107
226	3300003187	JGI25151J46595_10014788	JGI25151J46595_100147882	107
227	3300003354	JGI25160J50197_1000123	JGI25160J50197_100012351	107
228	3300003374	JGI25161J50226_1000032	JGI25161J50226_100003224	107
229	3300003775	Ga0055524_1091744	Ga0055524_10917441	107
230	3300003781	Ga0055536_1016528	Ga0055536_10165282	107
231	3300003784	Ga0055534_1009778	Ga0055534_10097782	107
232	3300003791	Ga0055530_10000793	Ga0055530_1000079326	107
233	3300003791	Ga0055530_10011533	Ga0055530_100115333	107
234	3300003791	Ga0055530_10048367	Ga0055530_100483671	107
235	3300003792	Ga0055540_1000012	Ga0055540_1000012160	107
236	3300003792	Ga0055540_1078309	Ga0055540_10783091	107
237	3300003792	Ga0055540_1108990	Ga0055540_11089901	107
238	3300003794	Ga0055531_10000002	Ga0055531_10000002252	107
239	3300003794	Ga0055531_10001541	Ga0055531_1000154118	107
240	3300004625	Ga0055543_1000294	Ga0055543_100029418	107
241	3300005262	Ga0065165_1003813	Ga0065165_100381310	107
242	3300005262	Ga0065165_1018183	Ga0065165_10181833	107
243	3300005331	Ga0070670_100479444	Ga0070670_1004794441	107
244	3300005335	Ga0070666_11230843	Ga0070666_112308432	107
245	3300005338	Ga0068868_101804710	Ga0068868_1018047101	107
246	3300005355	Ga0070671_100577413	Ga0070671_1005774132	107
247	3300005356	Ga0070674_100390176	Ga0070674_1003901762	107
248	3300005364	Ga0070673_100057428	Ga0070673_1000574285	107
249	3300005455	Ga0070663_101779184	Ga0070663_1017791842	107
250	3300005457	Ga0070662_100048805	Ga0070662_1000488053	107
251	3300005539	Ga0068853_100250504	Ga0068853_1002505042	107
252	3300005543	Ga0070672_100153736	Ga0070672_1001537362	107
253	3300005564	Ga0070664_100586503	Ga0070664_1005865032	107
254	3300005577	Ga0068857_100056593	Ga0068857_1000565933	107
255	3300005578	Ga0068854_100009140	Ga0068854_1000091409	107
256	3300005578	Ga0068854_100370097	Ga0068854_1003700973	107
257	3300005615	Ga0070702_100347066	Ga0070702_1003470662	107
258	3300005616	Ga0068852_100192344	Ga0068852_1001923442	107
259	3300005616	Ga0068852_100265182	Ga0068852_1002651821	107
260	3300005616	Ga0068852_100322886	Ga0068852_1003228862	107
261	3300005618	Ga0068864_100310810	Ga0068864_1003108102	107
262	3300005618	Ga0068864_101755581	Ga0068864_1017555811	107
263	3300005841	Ga0068863_100297770	Ga0068863_1002977702	107
264	3300006177	Ga0075362_10300140	Ga0075362_103001402	107
265	3300006195	Ga0075366_10129060	Ga0075366_101290602	107
266	3300006237	Ga0097621_100462450	Ga0097621_1004624502	107
267	3300006237	Ga0097621_100731944	Ga0097621_1007319441	107
268	3300006353	Ga0075370_10086053	Ga0075370_100860532	107
269	3300006353	Ga0075370_10666429	Ga0075370_106664291	107
270	3300006353	Ga0075370_10868812	Ga0075370_108688121	107
271	3300006881	Ga0068865_100625030	Ga0068865_1006250301	107
272	3300006946	Ga0079104_1038915	Ga0079104_10389152	107
273	3300009098	Ga0105245_12254301	Ga0105245_122543012	107
274	3300009148	Ga0105243_11861191	Ga0105243_118611912	107
275	3300009176	Ga0105242_10029318	Ga0105242_100293182	107
276	3300009176	Ga0105242_12944060	Ga0105242_129440601	107
277	3300011119	Ga0105246_10258271	Ga0105246_102582711	107
278	3300013296	Ga0157374_10875205	Ga0157374_108752052	107
279	3300013297	Ga0157378_11250577	Ga0157378_112505772	107
280	3300013297	Ga0157378_11967698	Ga0157378_119676982	107
281	3300013306	Ga0163162_10036971	Ga0163162_100369716	107
282	3300013306	Ga0163162_10481988	Ga0163162_104819882	107
283	3300013308	Ga0157375_10108508	Ga0157375_101085083	107
284	3300013308	Ga0157375_10471410	Ga0157375_104714102	107
285	3300013308	Ga0157375_12244261	Ga0157375_122442611	107
286	3300014325	Ga0163163_10647927	Ga0163163_106479272	107
287	3300014325	Ga0163163_10877989	Ga0163163_108779892	107
288	3300014325	Ga0163163_12878905	Ga0163163_128789052	107
289	3300014326	Ga0157380_12344441	Ga0157380_123444412	107
290	3300014497	Ga0182008_10023506	Ga0182008_100235065	107
291	3300014968	Ga0157379_10345689	Ga0157379_103456892	107
292	3300014969	Ga0157376_10649877	Ga0157376_106498772	107
293	3300015261	Ga0182006_1007199	Ga0182006_10071995	107
294	3300015262	Ga0182007_10005358	Ga0182007_100053585	107
295	3300015265	Ga0182005_1004111	Ga0182005_10041113	107
296	3300025208	Ga0209436_103392	Ga0209436_1033925	107
297	3300025245	Ga0207425_1011876	Ga0207425_10118762	107
298	3300025258	Ga0209129_1005872	Ga0209129_10058723	107
299	3300025263	Ga0209565_1008490	Ga0209565_10084902	107
300	3300025284	Ga0209130_1000050	Ga0209130_1000050204	107
301	3300025284	Ga0209130_1000082	Ga0209130_1000082124	107
302	3300025291	Ga0209675_1009291	Ga0209675_10092914	107
303	3300025291	Ga0209675_1009831	Ga0209675_10098313	107
304	3300025291	Ga0209675_1011229	Ga0209675_10112292	107
305	3300025292	Ga0209676_1000029	Ga0209676_1000029309	107
306	3300025292	Ga0209676_1004456	Ga0209676_100445610	107
307	3300025294	Ga0209025_1005031	Ga0209025_100503115	107
308	3300025295	Ga0209564_1085091	Ga0209564_10850912	107
309	3300025298	Ga0209050_1000003	Ga0209050_1000003371	107
310	3300025298	Ga0209050_1002246	Ga0209050_100224613	107
311	3300025298	Ga0209050_1003209	Ga0209050_10032095	107
312	3300025298	Ga0209050_1009468	Ga0209050_10094682	107
313	3300025299	Ga0209256_1016934	Ga0209256_10169342	107
314	3300025302	Ga0207426_1000071	Ga0207426_100007152	107
315	3300025302	Ga0207426_1001744	Ga0207426_10017446	107
316	3300025303	Ga0209051_1000003	Ga0209051_1000003371	107
317	3300025303	Ga0209051_1016209	Ga0209051_10162093	107
318	3300025303	Ga0209051_1078032	Ga0209051_10780322	107
319	3300025304	Ga0209257_1000018	Ga0209257_1000018371	107
320	3300025304	Ga0209257_1000049	Ga0209257_1000049287	107
321	3300025304	Ga0209257_1053255	Ga0209257_10532552	107
322	3300025903	Ga0207680_10830079	Ga0207680_108300791	107
323	3300025924	Ga0207694_10791674	Ga0207694_107916742	107
324	3300025924	Ga0207694_11853370	Ga0207694_118533702	107
325	3300025925	Ga0207650_10116729	Ga0207650_101167293	107
326	3300025927	Ga0207687_11190311	Ga0207687_111903111	107
327	3300025933	Ga0207706_10008972	Ga0207706_100089723	107
328	3300025934	Ga0207686_10016213	Ga0207686_100162132	107
329	3300025935	Ga0207709_10904478	Ga0207709_109044782	107
330	3300025937	Ga0207669_10076399	Ga0207669_100763992	107
331	3300025938	Ga0207704_10135170	Ga0207704_101351701	107
332	3300025940	Ga0207691_10024718	Ga0207691_100247182	107
333	3300025942	Ga0207689_10450665	Ga0207689_104506652	107
334	3300025945	Ga0207679_10521860	Ga0207679_105218601	107
335	3300025981	Ga0207640_10012061	Ga0207640_100120612	107
336	3300025981	Ga0207640_10431668	Ga0207640_104316682	107
337	3300026023	Ga0207677_10576156	Ga0207677_105761562	107
338	3300026035	Ga0207703_10361853	Ga0207703_103618532	107
339	3300026041	Ga0207639_10235657	Ga0207639_102356572	107
340	3300026041	Ga0207639_11266569	Ga0207639_112665692	107
341	3300026067	Ga0207678_11546722	Ga0207678_115467221	107
342	3300026078	Ga0207702_11806978	Ga0207702_118069781	107
343	3300026088	Ga0207641_10231906	Ga0207641_102319062	107
344	3300026089	Ga0207648_10088207	Ga0207648_100882073	107
345	3300026095	Ga0207676_10326576	Ga0207676_103265762	107
346	3300026095	Ga0207676_11909606	Ga0207676_119096061	107
347	3300026116	Ga0207674_10081062	Ga0207674_100810623	107
348	3300026118	Ga0207675_102689467	Ga0207675_1026894672	107
349	3300026121	Ga0207683_10246543	Ga0207683_102465432	107
350	3300026142	Ga0207698_10210116	Ga0207698_102101162	107
351	3300026142	Ga0207698_10220351	Ga0207698_102203512	107
352	3300028381	Ga0268264_11370779	Ga0268264_113707792	107
353	3300028666	Ga0265336_10001533	Ga0265336_100015337	107
354	3300028786	Ga0307517_10166079	Ga0307517_101660791	107
355	3300029957	Ga0265324_10001433	Ga0265324_100014337	107
356	3300029957	Ga0265324_10023732	Ga0265324_100237325	107
357	3300031456	Ga0307513_10000486	Ga0307513_100004862	107
358	3300031730	Ga0307516_10752166	Ga0307516_107521662	107
359	3300039437	Ga0436365_1153183	Ga0436365_1153183_171_500	107
360	3300041459	Ga0451800_0099571	Ga0451800_0099571_937_1260	107
361	3300041507	Ga0451851_0959056	Ga0451851_0959056_220_543	107
362	3300041512	Ga0451853_1981532	Ga0451853_1981532_331_657	107
363	3300041512	Ga0451853_2872608	Ga0451853_2872608_169_492	107
364	3300044656	Ga0466969_0000157	Ga0466969_0000157_7764_8114	107
365	3300044684	Ga0466966_0004340	Ga0466966_0004340_3563_3913	107
366	3300044684	Ga0466966_0064659	Ga0466966_0064659_476_826	107
367	3300044693	Ga0466961_0014705	Ga0466961_0014705_1418_1777	107
368	3300044765	Ga0466970_0029772	Ga0466970_0029772_305_655	107
369	3300046506	Ga0495583_0003920	Ga0495583_0003920_4146_4472	107
370	3300046507	Ga0495606_0409322	Ga0495606_0409322_86_424	107
371	3300046694	Ga0495649_0012587	Ga0495649_0012587_2924_3250	107
372	3300046794	Ga0495589_0014996	Ga0495589_0014996_2840_3166	107
373	3300050489	nmdc:mga03683_110003_c1	nmdc:mga03683_110003_c1_863_1189	107
374	3300050493	nmdc:mga0k408_236494_c1	nmdc:mga0k408_236494_c1_599_925	107
375	3300050496	nmdc:mga07m45_105485_c1	nmdc:mga07m45_105485_c1_729_1055	107
376	3300053098	Ga0500650_0206793	Ga0500650_0206793_480_803	107
377	3300053139	Ga0500568_0013147	Ga0500568_0013147_2061_2387	107
378	3300053730	Ga0500645_003416	Ga0500645_003416_1376_1699	107
379	iso_pu_bacteria	2643221585	2643932321	107
380	iso_pu_bacteria	2643221656	2644313572	107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

31

77

0.97 PF13412

HTH_24

Winged helix-turn-helix DNA-binding

33

76

0.96 PF12840

HTH_20

Helix-turn-helix domain

29

78

0.93 PF17782

DprA_WH

DprA winged helix domain

22

81

0.93 PF12802

MarR_2

MarR family

31

82

0.91 PF09339

HTH_IclR

IclR helix-turn-helix domain

24

79

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7p6f-assembly1.cif.gz_BBB	1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus	0.9242	2	89
5j6x-assembly2.cif.gz_B	crystal structure of the apo-zalpha of zebrafish pkz	0.9124	17	71
4lb5-assembly1.cif.gz_A-2	crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)	0.9122	17	71
3cuq-assembly1.cif.gz_B	integrated structural and functional model of the human escrt-ii complex	0.9058	17	72
2zme-assembly1.cif.gz_B	integrated structural and functional model of the human escrt-ii complex	0.9022	17	72

ID	Description	Score	Start	End	Superfamily
af_Q57824_147_206_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.957	14	70	1.10.10.10
af_Q57682_5_95_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.95	7	72	1.10.10.10
af_I6Y1A7_25_116_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.949	2	82	1.10.10.10
af_P76066_81_136_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9365	19	71	1.10.10.10
2oqgC00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9346	2	90	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0P6XVP7-F1-model_v4	ArsR family transcriptional regulator	0.9967	3	81	GO:0003677 GO:0003700
AF-A0A1Z5HTH1-F1-model_v4	ArsR family transcriptional regulator	0.9892	2	87	GO:0003700
AF-X0YLD0-F1-model_v4	HTH arsR-type domain-containing protein	0.9804	3	87	GO:0003700
AF-A0A7W5D2Z2-F1-model_v4	DNA-binding transcriptional ArsR family regulator	0.9797	3	87	GO:0003677 GO:0003700
AF-A0A0M3R905-F1-model_v4	ArsR family transcriptional regulator	0.9795	3	85	GO:0003677 GO:0003700

Feature Viewer

pLDDT	pTM	Quality
87.53	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428702

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01022

HTH_5

Bacterial regulatory protein, arsR family

31

77

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

33

76

0.96

PF12840

HTH_20

Helix-turn-helix domain

29

78

0.93

PF17782

DprA_WH

DprA winged helix domain

22

81

0.93

PF12802

MarR_2

MarR family

31

82

0.91

PF09339

HTH_IclR

IclR helix-turn-helix domain

24

79

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map