F428401

General Info

Members Datasets Scaffolds Average Seq Length
379 241 377 220

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10136844|Ga0307407_101368442
Length 248
Sequence MIYKQRSDLTASQGYWIVQGVLCNDLSRSNGSGNYLAAQLAHYADRDGVLVLALPRGGVPVAFEVAKALRAPLDIFLVRKLGIPGHEELAMDAIATGGVRVLNDEVVEYLRIPSRVIDSVAADELLELERRERAYRGNRPEPEVRAKTVILVDDGLATGSTMRAAAAALRLQDPIRIVVAVPVSAPETCDEYRMGVDEIICAATPKRFQGVGKWYEDFSQTTDEEVRNLLEQARTQHTAMEDHEMAHS

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
3 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
202 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
203 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
204 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
205 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
208 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
212 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
218 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
227 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
228 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 6.07
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 1.32
Rhizosphere 94.99
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_923896 2162886006 Unclassified 1019
2 rootL2_10035964 3300003322 Bacteria 4451
3 Ga0058863_10779178 3300004799 Bacteria 1689
4 Ga0065704_10098548 3300005289 Bacteria 2348
5 Ga0065707_10004415 3300005295 Bacteria 4260
6 Ga0070683_100159033 3300005329 Bacteria 2143
7 Ga0070690_100131547 3300005330 Bacteria 1690
8 Ga0070670_100104054 3300005331 Unclassified 2445
9 Ga0070680_100101572 3300005336 Bacteria 2387
10 Ga0070689_100090183 3300005340 Bacteria 2415
11 Ga0070689_100468422 3300005340 Bacteria 1074
12 Ga0070669_100013568 3300005353 Bacteria 5792
13 Ga0070669_100130676 3300005353 Unclassified 1926
14 Ga0070675_100036437 3300005354 Bacteria 4003
15 Ga0070675_100817993 3300005354 Bacteria 852
16 Ga0070673_100775160 3300005364 Bacteria 884
17 Ga0070659_100335135 3300005366 Bacteria 1267
18 Ga0070659_100454389 3300005366 Bacteria 1087
19 Ga0070709_10138752 3300005434 Bacteria 1668
20 Ga0070709_10154068 3300005434 Bacteria 1591
21 Ga0070710_10139037 3300005437 Bacteria 1487
22 Ga0070701_10036245 3300005438 Unclassified 2484
23 Ga0070701_10146628 3300005438 Bacteria 1355
24 Ga0070711_100029555 3300005439 Bacteria 3618
25 Ga0070711_100348332 3300005439 Bacteria 1190
26 Ga0070694_100003244 3300005444 Bacteria 9712
27 Ga0070694_100018871 3300005444 Bacteria 4382
28 Ga0070678_100189761 3300005456 Bacteria 1689
29 Ga0070662_100040318 3300005457 Bacteria 3324
30 Ga0070681_10013537 3300005458 Bacteria 8111
31 Ga0070681_10518284 3300005458 Bacteria 1105
32 Ga0070706_100183879 3300005467 Bacteria 1952
33 Ga0070707_100392984 3300005468 Unclassified 1347
34 Ga0070707_100802767 3300005468 Bacteria 905
35 Ga0070698_100005504 3300005471 Bacteria 13828
36 Ga0070698_100019178 3300005471 Bacteria 7188
37 Ga0070698_100111747 3300005471 Bacteria 2697
38 Ga0070699_100048915 3300005518 Unclassified 3659
39 Ga0070699_100213989 3300005518 Bacteria 1716
40 Ga0070679_100100302 3300005530 Unclassified 2882
41 Ga0070679_100202841 3300005530 Bacteria 1948
42 Ga0070684_100771780 3300005535 Unclassified 898
43 Ga0070697_100030075 3300005536 Bacteria 4360
44 Ga0070697_100050808 3300005536 Unclassified 3366
45 Ga0070672_100958606 3300005543 Bacteria 757
46 Ga0070696_100190972 3300005546 Bacteria 1524
47 Ga0070696_100402221 3300005546 Bacteria 1071
48 Ga0070704_100099174 3300005549 Bacteria 2190
49 Ga0070664_100034224 3300005564 Bacteria 4261
50 Ga0068857_100014900 3300005577 Bacteria 6781
51 Ga0068856_100000405 3300005614 Bacteria 47341
52 Ga0070702_100052350 3300005615 Bacteria 2341
53 Ga0068859_100025351 3300005617 Bacteria 5949
54 Ga0068859_100076525 3300005617 Bacteria 3387
55 Ga0068859_100086766 3300005617 Bacteria 3177
56 Ga0068859_100576971 3300005617 Bacteria 1218
57 Ga0068863_100333413 3300005841 Bacteria 1475
58 Ga0068858_100000230 3300005842 Bacteria 60483
59 Ga0068858_100040184 3300005842 Bacteria 4337
60 Ga0068858_100059959 3300005842 Unclassified 3517
61 Ga0068858_100101435 3300005842 Bacteria 2684
62 Ga0068858_100253395 3300005842 Bacteria 1672
63 Ga0068858_100297637 3300005842 Bacteria 1539
64 Ga0068860_100027462 3300005843 Bacteria 5481
65 Ga0068860_100035083 3300005843 Bacteria 4813
66 Ga0068862_100005232 3300005844 Bacteria 10890
67 Ga0068862_100116237 3300005844 Unclassified 2353
68 Ga0081539_10006371 3300005985 Bacteria 11357
69 Ga0081539_10008543 3300005985 Bacteria 8867
70 Ga0070717_10576488 3300006028 Unclassified 1020
71 Ga0075363_100087668 3300006048 Bacteria 1710
72 Ga0075367_10033283 3300006178 Bacteria 2970
73 Ga0097621_100150535 3300006237 Unclassified 1995
74 Ga0068871_100067937 3300006358 Bacteria 2925
75 Ga0068871_100082764 3300006358 Bacteria 2661
76 Ga0075428_100040862 3300006844 Bacteria 5101
77 Ga0075430_100021891 3300006846 Bacteria 5432
78 Ga0075430_100188816 3300006846 Bacteria 1713
79 Ga0075430_100791640 3300006846 Bacteria 781
80 Ga0075431_100035497 3300006847 Bacteria 5133
81 Ga0075431_100286369 3300006847 Bacteria 1668
82 Ga0075433_10039007 3300006852 Bacteria 4105
83 Ga0075433_10042585 3300006852 Bacteria 3940
84 Ga0075433_10095053 3300006852 Bacteria 2637
85 Ga0075433_10271186 3300006852 Bacteria 1504
86 Ga0075433_10382710 3300006852 Bacteria 1242
87 Ga0075434_100150920 3300006871 Bacteria 2344
88 Ga0075429_100005766 3300006880 Bacteria 10692
89 Ga0097620_100025352 3300006931 Bacteria 5949
90 Ga0097620_100076524 3300006931 Bacteria 3387
91 Ga0097620_100086766 3300006931 Bacteria 3177
92 Ga0097620_100576957 3300006931 Bacteria 1218
93 Ga0099794_10037340 3300007265 Bacteria 2299
94 Ga0105240_11044142 3300009093 Unclassified 872
95 Ga0111539_10188632 3300009094 Bacteria 2406
96 Ga0111539_10290055 3300009094 Bacteria 1904
97 Ga0105247_10000697 3300009101 Bacteria 26376
98 Ga0114129_10011331 3300009147 Bacteria 12701
99 Ga0114129_10020671 3300009147 Bacteria 9358
100 Ga0114129_10089979 3300009147 Unclassified 4255
101 Ga0114129_10094788 3300009147 Bacteria 4134
102 Ga0114129_10190689 3300009147 Bacteria 2784
103 Ga0114129_10217328 3300009147 Bacteria 2581
104 Ga0114129_10641458 3300009147 Unclassified 1372
105 Ga0114129_10676045 3300009147 Unclassified 1330
106 Ga0114129_11082664 3300009147 Unclassified 1004
107 Ga0105242_10162514 3300009176 Unclassified 1956
108 Ga0105248_10009151 3300009177 Bacteria 10894
109 Ga0105248_10033545 3300009177 Bacteria 5736
110 Ga0105248_10149774 3300009177 Bacteria 2633
111 Ga0105248_10216479 3300009177 Bacteria 2157
112 Ga0105248_10240820 3300009177 Bacteria 2036
113 Ga0105237_10004434 3300009545 Bacteria 16266
114 Ga0105237_10643785 3300009545 Unclassified 1067
115 Ga0105238_10003415 3300009551 Bacteria 15831
116 Ga0105238_10043027 3300009551 Bacteria 4571
117 Ga0105249_10050620 3300009553 Bacteria 3787
118 Ga0105239_11033450 3300010375 Bacteria 945
119 Ga0105246_10024247 3300011119 Bacteria 3939
120 Ga0157373_10234560 3300013100 Bacteria 1296
121 Ga0157369_10774950 3300013105 Unclassified 986
122 Ga0157374_10129375 3300013296 Bacteria 2442
123 Ga0163162_10009656 3300013306 Bacteria 9382
124 Ga0157375_10053593 3300013308 Bacteria 3970
125 Ga0163163_10306105 3300014325 Bacteria 1642
126 Ga0157380_10329022 3300014326 Bacteria 1420
127 Ga0157377_10059509 3300014745 Bacteria 2178
128 Ga0157379_10004176 3300014968 Bacteria 12337
129 Ga0197907_10092348 3300020069 Bacteria 2068
130 Ga0197907_11248989 3300020069 Bacteria 1138
131 Ga0206349_1132621 3300020075 Bacteria 2626
132 Ga0206351_10024221 3300020077 Bacteria 1135
133 Ga0206351_10363393 3300020077 Bacteria 879
134 Ga0206351_10663954 3300020077 Unclassified 726
135 Ga0206350_10685405 3300020080 Bacteria 1157
136 Ga0206350_11199836 3300020080 Bacteria 1386
137 Ga0206350_11245833 3300020080 Bacteria 1482
138 Ga0206350_11434512 3300020080 Bacteria 3373
139 Ga0206354_11329041 3300020081 Bacteria 1632
140 Ga0206354_11495242 3300020081 Bacteria 1328
141 Ga0206353_11048894 3300020082 Bacteria 1020
142 Ga0206353_11791449 3300020082 Bacteria 1018
143 Ga0213876_10087317 3300021384 Bacteria 1651
144 Ga0213875_10000005 3300021388 Bacteria 595146
145 Ga0224712_10012729 3300022467 Bacteria 2657
146 Ga0224712_10018280 3300022467 Bacteria 2340
147 Ga0224712_10062447 3300022467 Bacteria 1488
148 Ga0224712_10070910 3300022467 Bacteria 1414
149 Ga0224712_10083335 3300022467 Unclassified 1325
150 Ga0224712_10097459 3300022467 Bacteria 1242
151 Ga0224712_10104203 3300022467 Bacteria 1208
152 Ga0207710_10000037 3300025900 Bacteria 243545
153 Ga0207699_10107436 3300025906 Bacteria 1783
154 Ga0207684_10046168 3300025910 Bacteria 3696
155 Ga0207684_10211772 3300025910 Bacteria 1672
156 Ga0207707_10010175 3300025912 Bacteria 8163
157 Ga0207707_10011065 3300025912 Bacteria 7847
158 Ga0207671_10007177 3300025914 Bacteria 9713
159 Ga0207693_10068578 3300025915 Bacteria 2776
160 Ga0207663_10106793 3300025916 Bacteria 1893
161 Ga0207660_10152991 3300025917 Bacteria 1774
162 Ga0207649_10315830 3300025920 Bacteria 1146
163 Ga0207652_10600074 3300025921 Bacteria 987
164 Ga0207646_10335998 3300025922 Bacteria 1365
165 Ga0207694_10002767 3300025924 Bacteria 14161
166 Ga0207659_10000651 3300025926 Bacteria 20674
167 Ga0207690_10305591 3300025932 Bacteria 1246
168 Ga0207706_10000470 3300025933 Bacteria 43085
169 Ga0207686_10389660 3300025934 Unclassified 1059
170 Ga0207670_10192187 3300025936 Bacteria 1545
171 Ga0207691_10017053 3300025940 Bacteria 6892
172 Ga0207691_10304721 3300025940 Bacteria 1368
173 Ga0207711_10481317 3300025941 Bacteria 1156
174 Ga0207679_10010271 3300025945 Bacteria 6024
175 Ga0207679_10063331 3300025945 Bacteria 2760
176 Ga0207651_10138493 3300025960 Bacteria 1876
177 Ga0207712_10388502 3300025961 Bacteria 1170
178 Ga0207668_10194840 3300025972 Bacteria 1609
179 Ga0207703_10000010 3300026035 Bacteria 343466
180 Ga0207703_10086235 3300026035 Bacteria 2629
181 Ga0207703_10123136 3300026035 Unclassified 2229
182 Ga0207703_10174789 3300026035 Bacteria 1892
183 Ga0207703_10183334 3300026035 Bacteria 1849
184 Ga0207708_10089836 3300026075 Bacteria 2368
185 Ga0207702_10011097 3300026078 Bacteria 7520
186 Ga0207641_10416798 3300026088 Bacteria 1292
187 Ga0207676_10327558 3300026095 Bacteria 1408
188 Ga0207674_10002442 3300026116 Bacteria 23469
189 Ga0207683_10092775 3300026121 Bacteria 2690
190 Ga0207683_10594917 3300026121 Bacteria 1024
191 Ga0209588_1028378 3300027671 Bacteria 1781
192 Ga0207428_10396966 3300027907 Unclassified 1010
193 Ga0268265_10031196 3300028380 Bacteria 3847
194 Ga0268264_10021088 3300028381 Bacteria 5324
195 Ga0268264_10044288 3300028381 Bacteria 3691
196 Ga0265339_10096305 3300031249 Unclassified 1545
197 Ga0265331_10125352 3300031250 Unclassified 1173
198 Ga0265316_10259024 3300031344 Unclassified 1276
199 Ga0307408_100187807 3300031548 Bacteria 1662
200 Ga0307408_100288474 3300031548 Bacteria 1369
201 Ga0265313_10003069 3300031595 Bacteria 13853
202 Ga0316576_10002357 3300031727 Bacteria 10747
203 Ga0307405_10007140 3300031731 Bacteria 5555
204 Ga0307405_10119229 3300031731 Bacteria 1803
205 Ga0307405_10136992 3300031731 Unclassified 1701
206 Ga0307405_10381821 3300031731 Bacteria 1097
207 Ga0307413_10014703 3300031824 Bacteria 3986
208 Ga0307413_10034344 3300031824 Bacteria 2898
209 Ga0307413_10079949 3300031824 Bacteria 2091
210 Ga0307413_10094534 3300031824 Bacteria 1957
211 Ga0307413_10266082 3300031824 Unclassified 1281
212 Ga0307410_10016073 3300031852 Unclassified 4453
213 Ga0307406_10050199 3300031901 Bacteria 2643
214 Ga0307407_10136844 3300031903 Bacteria 1575
215 Ga0307407_10199102 3300031903 Bacteria 1341
216 Ga0307407_10372549 3300031903 Bacteria 1017
217 Ga0307412_10013390 3300031911 Bacteria 4809
218 Ga0307412_10145291 3300031911 Bacteria 1742
219 Ga0307409_100036531 3300031995 Bacteria 3612
220 Ga0307416_100005887 3300032002 Bacteria 7610
221 Ga0307416_100494452 3300032002 Bacteria 1286
222 Ga0307416_101839705 3300032002 Bacteria 709
223 Ga0307414_10000992 3300032004 Bacteria 14504
224 Ga0307414_10011841 3300032004 Bacteria 5135
225 Ga0307414_10019663 3300032004 Bacteria 4191
226 Ga0307414_10042071 3300032004 Bacteria 3101
227 Ga0307414_10152622 3300032004 Bacteria 1824
228 Ga0307411_10102383 3300032005 Bacteria 2029
229 Ga0307411_10279587 3300032005 Bacteria 1328
230 Ga0307415_100007446 3300032126 Bacteria 5988
231 Ga0307415_100030676 3300032126 Bacteria 3454
232 Ga0307415_100056274 3300032126 Bacteria 2695
233 Ga0307415_100232625 3300032126 Bacteria 1485
234 Ga0373928_0062507 3300035084 Bacteria 904
235 Ga0373934_0028391 3300035086 Bacteria 2180
236 Ga0373954_0011200 3300035118 Bacteria 3970
237 Ga0373956_0004741 3300035119 Bacteria 5441
238 Ga0373956_0008552 3300035119 Bacteria 4144
239 Ga0316574_0000413 3300035398 Bacteria 16888
240 Ga0316574_0040909 3300035398 Bacteria 2855
241 Ga0373924_0128272 3300035410 Bacteria 1103
242 Ga0373935_0629440 3300035692 Bacteria 786
243 Ga0373933_0000093 3300035724 Bacteria 56013
244 Ga0373937_0000020 3300036401 Bacteria 131263
245 Ga0373937_0027288 3300036401 Bacteria 5164
246 Ga0395905_0108025 3300037471 Bacteria 2612
247 Ga0395905_0239429 3300037471 Unclassified 1696
248 Ga0395905_0527024 3300037471 Unclassified 1082
249 Ga0436364_0080170 3300037853 Bacteria 70161
250 Ga0395901_0573363 3300038443 Bacteria 1141
251 Ga0395901_1054315 3300038443 Bacteria 786
252 Ga0436365_0052778 3300039437 Bacteria 5394
253 Ga0436365_0926743 3300039437 Bacteria 678
254 Ga0436360_0278187 3300039438 Bacteria 1845
255 Ga0453683_0009739 3300044673 Bacteria 6405
256 Ga0451576_0339457 3300045051 Bacteria 1573
257 Ga0451576_0550292 3300045051 Bacteria 1212
258 Ga0451576_0611090 3300045051 Bacteria 1146
259 Ga0495651_0001243 3300046462 Bacteria 19728
260 Ga0495653_0185182 3300046463 Bacteria 1425
261 Ga0495580_0309602 3300046472 Bacteria 1075
262 Ga0495644_0196115 3300046523 Unclassified 778
263 Ga0495652_0006914 3300046529 Bacteria 10500
264 Ga0495587_0000578 3300046536 Bacteria 25197
265 Ga0495621_0015224 3300046539 Bacteria 2450
266 Ga0495667_0339139 3300046559 Bacteria 950
267 Ga0495656_0122859 3300046615 Bacteria 1227
268 Ga0495656_0581009 3300046615 Bacteria 599
269 Ga0495659_0064952 3300046664 Bacteria 1356
270 Ga0495659_0123841 3300046664 Bacteria 1020
271 Ga0495646_0309037 3300046680 Bacteria 835
272 Ga0495669_0010995 3300046684 Bacteria 3832
273 Ga0495670_0159116 3300046691 Bacteria 1186
274 Ga0495600_0264132 3300046809 Bacteria 1093
275 Ga0495636_0108170 3300047318 Bacteria 1221
276 Ga0495680_0369121 3300047322 Bacteria 996
277 Ga0495675_0016270 3300047444 Bacteria 4704
278 Ga0495602_0000037 3300048088 Bacteria 132280
279 Ga0496104_0364286 3300048907 Bacteria 1358
280 Ga0496106_0050317 3300048909 Bacteria 3141
281 Ga0496106_0811172 3300048909 Bacteria 742
282 Ga0496107_0195875 3300048910 Bacteria 1502
283 Ga0496112_0199130 3300048915 Bacteria 1963
284 Ga0496116_0000044 3300048919 Bacteria 327709
285 Ga0496121_0000049 3300048924 Bacteria 324451
286 Ga0496121_0041210 3300048924 Bacteria 4039
287 Ga0501292_022805 3300049515 Bacteria 1020
288 Ga0501299_014534 3300049522 Unclassified 1371
289 Ga0501318_021808 3300049534 Bacteria 817
290 Ga0501031_0244750 3300049568 Bacteria 1165
291 Ga0501033_0045176 3300049570 Bacteria 3279
292 Ga0501034_0728832 3300049571 Bacteria 888
293 Ga0501034_0917658 3300049571 Bacteria 763
294 Ga0501036_0006662 3300049572 Bacteria 9392
295 Ga0501037_0365707 3300049573 Bacteria 993
296 Ga0501039_0851922 3300049575 Bacteria 710
297 Ga0501040_0005723 3300049576 Bacteria 8039
298 Ga0501041_0004893 3300049577 Bacteria 7784
299 Ga0501042_0008729 3300049578 Bacteria 6722
300 Ga0501043_0171608 3300049579 Bacteria 1692
301 Ga0501046_0161557 3300049580 Bacteria 1684
302 Ga0501047_0568495 3300049581 Bacteria 957
303 Ga0501048_0062261 3300049582 Bacteria 2641
304 Ga0501068_0069356 3300049584 Bacteria 2150
305 Ga0501068_0220678 3300049584 Bacteria 1205
306 Ga0501070_0355666 3300049586 Bacteria 1188
307 Ga0501073_0301781 3300049589 Bacteria 1105
308 Ga0501073_0412236 3300049589 Bacteria 933
309 Ga0501074_0058412 3300049590 Bacteria 2779
310 Ga0501074_0077131 3300049590 Bacteria 2392
311 Ga0501075_0013226 3300049591 Bacteria 5887
312 Ga0501075_0213049 3300049591 Bacteria 1473
313 Ga0501076_0002423 3300049592 Bacteria 12791
314 Ga0501077_0010675 3300049593 Bacteria 5719
315 Ga0501198_002858 3300049649 Bacteria 2346
316 Ga0501198_010279 3300049649 Bacteria 1382
317 Ga0501207_000050 3300049654 Bacteria 8606
318 Ga0501209_061533 3300049656 Bacteria 1049
319 Ga0501214_008875 3300049659 Bacteria 1066
320 Ga0501216_001093 3300049660 Unclassified 3537
321 Ga0501217_004441 3300049661 Bacteria 2884
322 Ga0501217_032761 3300049661 Bacteria 1287
323 Ga0501223_002730 3300049663 Bacteria 3881
324 Ga0501223_005459 3300049663 Bacteria 2670
325 Ga0501223_011532 3300049663 Bacteria 1774
326 Ga0501224_000371 3300049664 Bacteria 5286
327 Ga0501224_000949 3300049664 Bacteria 3735
328 Ga0501227_000008 3300049665 Bacteria 36003
329 Ga0501227_000231 3300049665 Bacteria 11284
330 Ga0501227_001519 3300049665 Bacteria 5182
331 Ga0501233_006634 3300049668 Bacteria 2180
332 Ga0501236_003770 3300049670 Bacteria 1779
333 Ga0501243_003369 3300049675 Bacteria 2364
334 Ga0501243_014861 3300049675 Unclassified 1246
335 Ga0501257_005707 3300049686 Unclassified 2749
336 Ga0501259_016964 3300049688 Unclassified 1257
337 Ga0501221_002655 3300049704 Bacteria 2946
338 Ga0501225_0000543 3300049705 Bacteria 11823
339 Ga0501225_0010264 3300049705 Bacteria 2656
340 Ga0501225_0046605 3300049705 Bacteria 1202
341 Ga0501229_013540 3300049706 Bacteria 1048
342 Ga0501234_000259 3300049707 Bacteria 7705
343 Ga0501234_001108 3300049707 Bacteria 4256
344 Ga0501079_0122479 3300049741 Bacteria 2022
345 Ga0501080_0113435 3300049742 Bacteria 2513
346 Ga0501081_0006872 3300049743 Bacteria 7400
347 Ga0501081_0028261 3300049743 Bacteria 3784
348 Ga0501083_0021730 3300049744 Bacteria 4457
349 Ga0501083_0328938 3300049744 Bacteria 994
350 Ga0501241_010975 3300049758 Bacteria 1645
351 Ga0501044_0006232 3300049823 Bacteria 13186
352 Ga0501045_0002990 3300049824 Bacteria 11565
353 Ga0501045_0071644 3300049824 Bacteria 2551
354 Ga0501204_001077 3300049850 Bacteria 2587
355 Ga0501212_014326 3300049851 Bacteria 1172
356 Ga0501226_000214 3300049853 Bacteria 9165
357 nmdc:mga00v17_126265_c1 3300050491 Bacteria 1632
358 nmdc:mga0k408_611401_c1 3300050493 Bacteria 642
359 nmdc:mga05p37_146639_c1 3300050507 Bacteria 2889
360 nmdc:mga05p37_148438_c1 3300050507 Unclassified 2869
361 nmdc:mga05p37_159444_c1 3300050507 Bacteria 1251
362 nmdc:mga05p37_513768_c1 3300050507 Unclassified 1372
363 nmdc:mga05p37_72406_c1 3300050507 Bacteria 4240
364 nmdc:mga09592_4398_c1 3300050508 Bacteria 11400
365 nmdc:mga0qj67_194044_c1 3300050509 Bacteria 1650
366 nmdc:mga0qj67_2453_c1 3300050509 Bacteria 13203
367 nmdc:mga06r32_234725_c1 3300050510 Bacteria 1822
368 nmdc:mga08y16_209775_c1 3300050511 Bacteria 2017
369 nmdc:mga08y16_364463_c1 3300050511 Bacteria 1483
370 nmdc:mga08y16_722542_c1 3300050511 Unclassified 994
371 nmdc:mga0a205_110714_c1 3300050515 Bacteria 2645
372 nmdc:mga0a205_283203_c1 3300050515 Bacteria 1533
373 Ga0495619_0226462 3300053085 Bacteria 1295
374 Ga0501084_0001133 3300054114 Bacteria 20773
375 Ga0590075_040165 3300059424 Bacteria 1195
376 Ga0501082_0010713 3300060353 Bacteria 7890
377 Ga0530510_0030079 3300061734 Bacteria 3899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_611401_c1 nmdc:mga0k408_611401_c1_31_585 146
2 3300046615 Ga0495656_0581009 Ga0495656_0581009_32_580 161
3 3300046680 Ga0495646_0309037 Ga0495646_0309037_76_675 177
4 3300049575 Ga0501039_0851922 Ga0501039_0851922_99_698 177
5 3300006048 Ga0075363_100087668 Ga0075363_1000876682 183
6 3300006178 Ga0075367_10033283 Ga0075367_100332832 183
7 3300046472 Ga0495580_0309602 Ga0495580_0309602_425_1063 185
8 3300009177 Ga0105248_10033545 Ga0105248_100335452 186
9 3300021384 Ga0213876_10087317 Ga0213876_100873172 186
10 3300039437 Ga0436365_0926743 Ga0436365_0926743_21_629 186
11 3300049571 Ga0501034_0917658 Ga0501034_0917658_95_703 186
12 3300049584 Ga0501068_0220678 Ga0501068_0220678_15_683 187
13 3300006028 Ga0070717_10576488 Ga0070717_105764881 189
14 3300048907 Ga0496104_0364286 Ga0496104_0364286_133_807 189
15 3300005518 Ga0070699_100213989 Ga0070699_1002139892 190
16 3300005353 Ga0070669_100130676 Ga0070669_1001306762 191
17 3300005467 Ga0070706_100183879 Ga0070706_1001838792 191
18 3300005844 Ga0068862_100116237 Ga0068862_1001162374 191
19 3300006844 Ga0075428_100040862 Ga0075428_1000408623 191
20 3300006846 Ga0075430_100188816 Ga0075430_1001888163 191
21 3300006852 Ga0075433_10039007 Ga0075433_100390073 191
22 3300006880 Ga0075429_100005766 Ga0075429_1000057665 191
23 3300009147 Ga0114129_10190689 Ga0114129_101906892 191
24 3300025910 Ga0207684_10211772 Ga0207684_102117722 191
25 3300035692 Ga0373935_0629440 Ga0373935_0629440_12_635 191
26 3300050507 nmdc:mga05p37_159444_c1 nmdc:mga05p37_159444_c1_410_1033 191
27 3300050508 nmdc:mga09592_4398_c1 nmdc:mga09592_4398_c1_1470_2093 191
28 3300050509 nmdc:mga0qj67_194044_c1 nmdc:mga0qj67_194044_c1_84_707 191
29 3300005471 Ga0070698_100111747 Ga0070698_1001117473 194
30 3300048915 Ga0496112_0199130 Ga0496112_0199130_14_679 194
31 3300005985 Ga0081539_10008543 Ga0081539_100085432 195
32 3300009176 Ga0105242_10162514 Ga0105242_101625142 195
33 3300025934 Ga0207686_10389660 Ga0207686_103896601 195
34 3300031727 Ga0316576_10002357 Ga0316576_100023576 195
35 3300009147 Ga0114129_10089979 Ga0114129_100899794 196
36 3300009551 Ga0105238_10003415 Ga0105238_1000341515 196
37 3300014325 Ga0163163_10306105 Ga0163163_103061052 196
38 3300031731 Ga0307405_10381821 Ga0307405_103818212 196
39 3300049571 Ga0501034_0728832 Ga0501034_0728832_125_763 196
40 3300049589 Ga0501073_0412236 Ga0501073_0412236_254_892 196
41 3300050507 nmdc:mga05p37_148438_c1 nmdc:mga05p37_148438_c1_1182_1826 196
42 3300005444 Ga0070694_100018871 Ga0070694_1000188712 197
43 3300005842 Ga0068858_100253395 Ga0068858_1002533952 197
44 3300006871 Ga0075434_100150920 Ga0075434_1001509203 197
45 3300009147 Ga0114129_10011331 Ga0114129_100113313 197
46 3300013306 Ga0163162_10009656 Ga0163162_100096567 197
47 3300026035 Ga0207703_10174789 Ga0207703_101747892 197
48 3300031548 Ga0307408_100187807 Ga0307408_1001878071 197
49 3300031731 Ga0307405_10136992 Ga0307405_101369922 197
50 3300031824 Ga0307413_10266082 Ga0307413_102660822 197
51 3300031901 Ga0307406_10050199 Ga0307406_100501991 197
52 3300031911 Ga0307412_10145291 Ga0307412_101452913 197
53 3300032002 Ga0307416_101839705 Ga0307416_1018397051 197
54 3300032004 Ga0307414_10042071 Ga0307414_100420712 197
55 3300032126 Ga0307415_100056274 Ga0307415_1000562743 197
56 3300049522 Ga0501299_014534 Ga0501299_014534_51_722 197
57 3300049654 Ga0501207_000050 Ga0501207_000050_3552_4220 197
58 3300049661 Ga0501217_004441 Ga0501217_004441_1663_2334 197
59 3300049663 Ga0501223_005459 Ga0501223_005459_262_933 197
60 3300049664 Ga0501224_000949 Ga0501224_000949_1099_1770 197
61 3300049665 Ga0501227_001519 Ga0501227_001519_2862_3533 197
62 3300049688 Ga0501259_016964 Ga0501259_016964_50_721 197
63 3300049705 Ga0501225_0010264 Ga0501225_0010264_21_692 197
64 3300049850 Ga0501204_001077 Ga0501204_001077_328_999 197
65 3300049851 Ga0501212_014326 Ga0501212_014326_210_878 197
66 3300050507 nmdc:mga05p37_146639_c1 nmdc:mga05p37_146639_c1_2141_2782 197
67 3300005437 Ga0070710_10139037 Ga0070710_101390372 198
68 3300005439 Ga0070711_100348332 Ga0070711_1003483322 198
69 3300025910 Ga0207684_10046168 Ga0207684_100461684 198
70 3300025915 Ga0207693_10068578 Ga0207693_100685781 198
71 3300032126 Ga0307415_100232625 Ga0307415_1002326252 198
72 3300038443 Ga0395901_0573363 Ga0395901_0573363_407_1069 198
73 3300009094 Ga0111539_10290055 Ga0111539_102900552 199
74 3300049744 Ga0501083_0328938 Ga0501083_0328938_72_752 199
75 3300060353 Ga0501082_0010713 Ga0501082_0010713_1364_2044 199
76 iso_pu_bacteria 2524614857 2526061371 199
77 iso_pu_bacteria 2739367875 2740064941 199
78 3300005444 Ga0070694_100003244 Ga0070694_1000032443 200
79 3300005535 Ga0070684_100771780 Ga0070684_1007717801 200
80 3300031824 Ga0307413_10034344 Ga0307413_100343443 200
81 3300031903 Ga0307407_10199102 Ga0307407_101991022 200
82 3300032002 Ga0307416_100494452 Ga0307416_1004944522 200
83 3300035086 Ga0373934_0028391 Ga0373934_0028391_1208_1873 200
84 3300035119 Ga0373956_0004741 Ga0373956_0004741_2508_3173 200
85 3300035410 Ga0373924_0128272 Ga0373924_0128272_226_891 200
86 3300035724 Ga0373933_0000093 Ga0373933_0000093_30495_31160 200
87 3300036401 Ga0373937_0000020 Ga0373937_0000020_73508_74173 200
88 3300036401 Ga0373937_0027288 Ga0373937_0027288_1779_2444 200
89 3300039437 Ga0436365_0052778 Ga0436365_0052778_630_1280 200
90 3300046462 Ga0495651_0001243 Ga0495651_0001243_18371_19036 200
91 3300046463 Ga0495653_0185182 Ga0495653_0185182_415_1080 200
92 3300046529 Ga0495652_0006914 Ga0495652_0006914_3302_3967 200
93 3300046536 Ga0495587_0000578 Ga0495587_0000578_9914_10579 200
94 3300046559 Ga0495667_0339139 Ga0495667_0339139_198_863 200
95 3300046809 Ga0495600_0264132 Ga0495600_0264132_162_827 200
96 3300047322 Ga0495680_0369121 Ga0495680_0369121_95_760 200
97 3300047444 Ga0495675_0016270 Ga0495675_0016270_2040_2705 200
98 3300048088 Ga0495602_0000037 Ga0495602_0000037_97196_97861 200
99 3300005842 Ga0068858_100000230 Ga0068858_1000002306 201
100 3300009177 Ga0105248_10009151 Ga0105248_1000915110 201
101 3300009551 Ga0105238_10043027 Ga0105238_100430273 201
102 3300011119 Ga0105246_10024247 Ga0105246_100242472 201
103 3300014968 Ga0157379_10004176 Ga0157379_100041766 201
104 3300020077 Ga0206351_10663954 Ga0206351_106639541 201
105 3300020080 Ga0206350_11434512 Ga0206350_114345125 201
106 3300020081 Ga0206354_11329041 Ga0206354_113290412 201
107 3300022467 Ga0224712_10097459 Ga0224712_100974592 201
108 3300026035 Ga0207703_10000010 Ga0207703_10000010152 201
109 3300031548 Ga0307408_100288474 Ga0307408_1002884742 201
110 3300031595 Ga0265313_10003069 Ga0265313_1000306912 201
111 3300031852 Ga0307410_10016073 Ga0307410_100160733 201
112 3300032004 Ga0307414_10011841 Ga0307414_100118417 201
113 3300032126 Ga0307415_100007446 Ga0307415_1000074461 201
114 3300037471 Ga0395905_0527024 Ga0395905_0527024_168_821 201
115 3300049581 Ga0501047_0568495 Ga0501047_0568495_226_897 201
116 3300049590 Ga0501074_0077131 Ga0501074_0077131_1381_2034 201
117 3300049649 Ga0501198_010279 Ga0501198_010279_399_1067 201
118 3300049659 Ga0501214_008875 Ga0501214_008875_17_685 201
119 3300049660 Ga0501216_001093 Ga0501216_001093_1685_2374 201
120 3300049661 Ga0501217_032761 Ga0501217_032761_327_995 201
121 3300049665 Ga0501227_000231 Ga0501227_000231_201_869 201
122 3300049668 Ga0501233_006634 Ga0501233_006634_951_1640 201
123 3300049670 Ga0501236_003770 Ga0501236_003770_552_1220 201
124 3300049675 Ga0501243_014861 Ga0501243_014861_55_723 201
125 3300049705 Ga0501225_0000543 Ga0501225_0000543_10958_11626 201
126 3300049706 Ga0501229_013540 Ga0501229_013540_349_1017 201
127 3300049707 Ga0501234_000259 Ga0501234_000259_842_1510 201
128 3300049707 Ga0501234_001108 Ga0501234_001108_1868_2551 201
129 3300049743 Ga0501081_0028261 Ga0501081_0028261_3064_3717 201
130 3300049758 Ga0501241_010975 Ga0501241_010975_341_1009 201
131 3300049823 Ga0501044_0006232 Ga0501044_0006232_2738_3409 201
132 3300049824 Ga0501045_0071644 Ga0501045_0071644_1279_1932 201
133 3300005329 Ga0070683_100159033 Ga0070683_1001590332 202
134 3300005331 Ga0070670_100104054 Ga0070670_1001040544 202
135 3300005364 Ga0070673_100775160 Ga0070673_1007751602 202
136 3300005468 Ga0070707_100392984 Ga0070707_1003929842 202
137 3300005468 Ga0070707_100802767 Ga0070707_1008027672 202
138 3300005471 Ga0070698_100005504 Ga0070698_1000055046 202
139 3300005518 Ga0070699_100048915 Ga0070699_1000489152 202
140 3300005536 Ga0070697_100030075 Ga0070697_1000300753 202
141 3300005546 Ga0070696_100190972 Ga0070696_1001909721 202
142 3300005614 Ga0068856_100000405 Ga0068856_1000004055 202
143 3300005985 Ga0081539_10006371 Ga0081539_1000637111 202
144 3300006358 Ga0068871_100067937 Ga0068871_1000679373 202
145 3300006852 Ga0075433_10042585 Ga0075433_100425853 202
146 3300006852 Ga0075433_10095053 Ga0075433_100950532 202
147 3300006852 Ga0075433_10271186 Ga0075433_102711862 202
148 3300009093 Ga0105240_11044142 Ga0105240_110441421 202
149 3300009094 Ga0111539_10188632 Ga0111539_101886322 202
150 3300009147 Ga0114129_10217328 Ga0114129_102173284 202
151 3300009147 Ga0114129_10641458 Ga0114129_106414582 202
152 3300009147 Ga0114129_10676045 Ga0114129_106760452 202
153 3300009545 Ga0105237_10643785 Ga0105237_106437852 202
154 3300013105 Ga0157369_10774950 Ga0157369_107749502 202
155 3300020077 Ga0206351_10363393 Ga0206351_103633932 202
156 3300020080 Ga0206350_11199836 Ga0206350_111998362 202
157 3300022467 Ga0224712_10062447 Ga0224712_100624471 202
158 3300025924 Ga0207694_10002767 Ga0207694_1000276716 202
159 3300025945 Ga0207679_10063331 Ga0207679_100633313 202
160 3300026078 Ga0207702_10011097 Ga0207702_100110974 202
161 3300026121 Ga0207683_10594917 Ga0207683_105949171 202
162 3300031731 Ga0307405_10007140 Ga0307405_100071404 202
163 3300031824 Ga0307413_10079949 Ga0307413_100799492 202
164 3300031903 Ga0307407_10136844 Ga0307407_101368442 202
165 3300031911 Ga0307412_10013390 Ga0307412_100133907 202
166 3300032002 Ga0307416_100005887 Ga0307416_1000058876 202
167 3300032004 Ga0307414_10000992 Ga0307414_100009926 202
168 3300032004 Ga0307414_10152622 Ga0307414_101526222 202
169 3300032005 Ga0307411_10279587 Ga0307411_102795872 202
170 3300032126 Ga0307415_100030676 Ga0307415_1000306763 202
171 3300044673 Ga0453683_0009739 Ga0453683_0009739_2717_3385 202
172 3300045051 Ga0451576_0611090 Ga0451576_0611090_326_988 202
173 3300046615 Ga0495656_0122859 Ga0495656_0122859_271_939 202
174 3300047318 Ga0495636_0108170 Ga0495636_0108170_206_874 202
175 3300048919 Ga0496116_0000044 Ga0496116_0000044_94929_95585 202
176 3300048924 Ga0496121_0000049 Ga0496121_0000049_93573_94229 202
177 3300049649 Ga0501198_002858 Ga0501198_002858_1549_2226 202
178 3300049663 Ga0501223_002730 Ga0501223_002730_1788_2465 202
179 3300049664 Ga0501224_000371 Ga0501224_000371_3820_4497 202
180 3300049665 Ga0501227_000008 Ga0501227_000008_27158_27904 202
181 3300049675 Ga0501243_003369 Ga0501243_003369_1303_1980 202
182 3300049686 Ga0501257_005707 Ga0501257_005707_1940_2608 202
183 3300049704 Ga0501221_002655 Ga0501221_002655_296_973 202
184 3300049853 Ga0501226_000214 Ga0501226_000214_5578_6246 202
185 3300050507 nmdc:mga05p37_513768_c1 nmdc:mga05p37_513768_c1_460_1131 202
186 3300050511 nmdc:mga08y16_209775_c1 nmdc:mga08y16_209775_c1_339_1028 202
187 3300050515 nmdc:mga0a205_110714_c1 nmdc:mga0a205_110714_c1_1305_1985 202
188 3300053085 Ga0495619_0226462 Ga0495619_0226462_453_1127 202
189 3300059424 Ga0590075_040165 Ga0590075_040165_463_1125 202
190 3300003322 rootL2_10035964 rootL2_100359642 203
191 3300005336 Ga0070680_100101572 Ga0070680_1001015722 203
192 3300005340 Ga0070689_100468422 Ga0070689_1004684221 203
193 3300005353 Ga0070669_100013568 Ga0070669_1000135684 203
194 3300005366 Ga0070659_100335135 Ga0070659_1003351352 203
195 3300005434 Ga0070709_10154068 Ga0070709_101540682 203
196 3300005457 Ga0070662_100040318 Ga0070662_1000403183 203
197 3300005458 Ga0070681_10518284 Ga0070681_105182841 203
198 3300005530 Ga0070679_100202841 Ga0070679_1002028413 203
199 3300005543 Ga0070672_100958606 Ga0070672_1009586061 203
200 3300005546 Ga0070696_100402221 Ga0070696_1004022211 203
201 3300005564 Ga0070664_100034224 Ga0070664_1000342242 203
202 3300005577 Ga0068857_100014900 Ga0068857_1000149004 203
203 3300005617 Ga0068859_100076525 Ga0068859_1000765252 203
204 3300005617 Ga0068859_100086766 Ga0068859_1000867663 203
205 3300005841 Ga0068863_100333413 Ga0068863_1003334132 203
206 3300005842 Ga0068858_100040184 Ga0068858_1000401844 203
207 3300005842 Ga0068858_100101435 Ga0068858_1001014352 203
208 3300005843 Ga0068860_100035083 Ga0068860_1000350832 203
209 3300005844 Ga0068862_100005232 Ga0068862_1000052328 203
210 3300006846 Ga0075430_100021891 Ga0075430_1000218913 203
211 3300006931 Ga0097620_100076524 Ga0097620_1000765242 203
212 3300006931 Ga0097620_100086766 Ga0097620_1000867663 203
213 3300009101 Ga0105247_10000697 Ga0105247_1000069719 203
214 3300009177 Ga0105248_10240820 Ga0105248_102408202 203
215 3300009545 Ga0105237_10004434 Ga0105237_100044349 203
216 3300009553 Ga0105249_10050620 Ga0105249_100506204 203
217 3300010375 Ga0105239_11033450 Ga0105239_110334502 203
218 3300020077 Ga0206351_10024221 Ga0206351_100242211 203
219 3300020080 Ga0206350_11245833 Ga0206350_112458331 203
220 3300021388 Ga0213875_10000005 Ga0213875_1000000512 203
221 3300025900 Ga0207710_10000037 Ga0207710_1000003765 203
222 3300025912 Ga0207707_10010175 Ga0207707_100101758 203
223 3300025914 Ga0207671_10007177 Ga0207671_100071774 203
224 3300025917 Ga0207660_10152991 Ga0207660_101529912 203
225 3300025920 Ga0207649_10315830 Ga0207649_103158302 203
226 3300025932 Ga0207690_10305591 Ga0207690_103055912 203
227 3300025933 Ga0207706_10000470 Ga0207706_1000047027 203
228 3300025936 Ga0207670_10192187 Ga0207670_101921871 203
229 3300025940 Ga0207691_10304721 Ga0207691_103047211 203
230 3300025945 Ga0207679_10010271 Ga0207679_100102713 203
231 3300025961 Ga0207712_10388502 Ga0207712_103885021 203
232 3300025972 Ga0207668_10194840 Ga0207668_101948402 203
233 3300026035 Ga0207703_10086235 Ga0207703_100862352 203
234 3300026088 Ga0207641_10416798 Ga0207641_104167982 203
235 3300026116 Ga0207674_10002442 Ga0207674_100024424 203
236 3300028380 Ga0268265_10031196 Ga0268265_100311961 203
237 3300028381 Ga0268264_10044288 Ga0268264_100442882 203
238 3300035118 Ga0373954_0011200 Ga0373954_0011200_1606_2265 203
239 3300035119 Ga0373956_0008552 Ga0373956_0008552_1552_2211 203
240 3300037471 Ga0395905_0239429 Ga0395905_0239429_628_1287 203
241 3300037853 Ga0436364_0080170 Ga0436364_0080170_8236_8946 203
242 3300046523 Ga0495644_0196115 Ga0495644_0196115_47_715 203
243 3300046539 Ga0495621_0015224 Ga0495621_0015224_1536_2204 203
244 3300046664 Ga0495659_0064952 Ga0495659_0064952_86_754 203
245 3300046684 Ga0495669_0010995 Ga0495669_0010995_938_1606 203
246 3300046691 Ga0495670_0159116 Ga0495670_0159116_109_777 203
247 3300048909 Ga0496106_0050317 Ga0496106_0050317_2383_3072 203
248 3300048910 Ga0496107_0195875 Ga0496107_0195875_665_1354 203
249 3300048924 Ga0496121_0041210 Ga0496121_0041210_1710_2399 203
250 3300049568 Ga0501031_0244750 Ga0501031_0244750_254_946 203
251 3300049570 Ga0501033_0045176 Ga0501033_0045176_2065_2757 203
252 3300049572 Ga0501036_0006662 Ga0501036_0006662_2169_2861 203
253 3300049573 Ga0501037_0365707 Ga0501037_0365707_254_946 203
254 3300049576 Ga0501040_0005723 Ga0501040_0005723_6032_6724 203
255 3300049577 Ga0501041_0004893 Ga0501041_0004893_563_1255 203
256 3300049578 Ga0501042_0008729 Ga0501042_0008729_1397_2089 203
257 3300049579 Ga0501043_0171608 Ga0501043_0171608_700_1392 203
258 3300049580 Ga0501046_0161557 Ga0501046_0161557_780_1472 203
259 3300049582 Ga0501048_0062261 Ga0501048_0062261_786_1478 203
260 3300049584 Ga0501068_0069356 Ga0501068_0069356_201_893 203
261 3300049586 Ga0501070_0355666 Ga0501070_0355666_413_1105 203
262 3300049589 Ga0501073_0301781 Ga0501073_0301781_33_725 203
263 3300049590 Ga0501074_0058412 Ga0501074_0058412_1725_2417 203
264 3300049591 Ga0501075_0013226 Ga0501075_0013226_4077_4769 203
265 3300049592 Ga0501076_0002423 Ga0501076_0002423_7679_8371 203
266 3300049593 Ga0501077_0010675 Ga0501077_0010675_452_1144 203
267 3300049741 Ga0501079_0122479 Ga0501079_0122479_631_1323 203
268 3300049742 Ga0501080_0113435 Ga0501080_0113435_345_1037 203
269 3300049743 Ga0501081_0006872 Ga0501081_0006872_1771_2463 203
270 3300049744 Ga0501083_0021730 Ga0501083_0021730_1237_1929 203
271 3300049824 Ga0501045_0002990 Ga0501045_0002990_6364_7056 203
272 3300050509 nmdc:mga0qj67_2453_c1 nmdc:mga0qj67_2453_c1_1914_2585 203
273 3300054114 Ga0501084_0001133 Ga0501084_0001133_14064_14756 203
274 3300061734 Ga0530510_0030079 Ga0530510_0030079_1115_1807 203
275 3300004799 Ga0058863_10779178 Ga0058863_107791781 204
276 3300005438 Ga0070701_10036245 Ga0070701_100362452 204
277 3300005471 Ga0070698_100019178 Ga0070698_1000191789 204
278 3300005530 Ga0070679_100100302 Ga0070679_1001003023 204
279 3300005536 Ga0070697_100050808 Ga0070697_1000508084 204
280 3300006847 Ga0075431_100035497 Ga0075431_1000354974 204
281 3300006847 Ga0075431_100286369 Ga0075431_1002863692 204
282 3300006852 Ga0075433_10382710 Ga0075433_103827102 204
283 3300007265 Ga0099794_10037340 Ga0099794_100373402 204
284 3300009147 Ga0114129_10020671 Ga0114129_1002067111 204
285 3300009147 Ga0114129_10094788 Ga0114129_100947885 204
286 3300020069 Ga0197907_11248989 Ga0197907_112489891 204
287 3300020075 Ga0206349_1132621 Ga0206349_11326214 204
288 3300020080 Ga0206350_10685405 Ga0206350_106854052 204
289 3300020081 Ga0206354_11495242 Ga0206354_114952422 204
290 3300020082 Ga0206353_11048894 Ga0206353_110488941 204
291 3300022467 Ga0224712_10012729 Ga0224712_100127292 204
292 3300022467 Ga0224712_10083335 Ga0224712_100833351 204
293 3300022467 Ga0224712_10104203 Ga0224712_101042031 204
294 3300025921 Ga0207652_10600074 Ga0207652_106000742 204
295 3300025922 Ga0207646_10335998 Ga0207646_103359982 204
296 3300027671 Ga0209588_1028378 Ga0209588_10283782 204
297 3300027907 Ga0207428_10396966 Ga0207428_103969661 204
298 3300037471 Ga0395905_0108025 Ga0395905_0108025_1394_2062 204
299 3300038443 Ga0395901_1054315 Ga0395901_1054315_65_733 204
300 3300039438 Ga0436360_0278187 Ga0436360_0278187_120_782 204
301 3300045051 Ga0451576_0339457 Ga0451576_0339457_290_961 204
302 3300050507 nmdc:mga05p37_72406_c1 nmdc:mga05p37_72406_c1_308_988 204
303 3300050510 nmdc:mga06r32_234725_c1 nmdc:mga06r32_234725_c1_704_1384 204
304 3300050511 nmdc:mga08y16_364463_c1 nmdc:mga08y16_364463_c1_377_1039 204
305 3300005330 Ga0070690_100131547 Ga0070690_1001315472 205
306 3300005340 Ga0070689_100090183 Ga0070689_1000901832 205
307 3300005354 Ga0070675_100817993 Ga0070675_1008179931 205
308 3300005617 Ga0068859_100576971 Ga0068859_1005769712 205
309 3300005842 Ga0068858_100059959 Ga0068858_1000599592 205
310 3300006931 Ga0097620_100576957 Ga0097620_1005769572 205
311 3300009147 Ga0114129_11082664 Ga0114129_110826641 205
312 3300009177 Ga0105248_10149774 Ga0105248_101497742 205
313 3300022467 Ga0224712_10070910 Ga0224712_100709103 205
314 3300026035 Ga0207703_10123136 Ga0207703_101231362 205
315 3300031824 Ga0307413_10094534 Ga0307413_100945341 205
316 3300049591 Ga0501075_0213049 Ga0501075_0213049_734_1405 205
317 3300049663 Ga0501223_011532 Ga0501223_011532_209_898 205
318 2162886006 SwRhRL3b_contig_923896 SwRhRL3b_0658.00001380 206
319 3300005289 Ga0065704_10098548 Ga0065704_100985483 206
320 3300005295 Ga0065707_10004415 Ga0065707_100044152 206
321 3300005354 Ga0070675_100036437 Ga0070675_1000364374 206
322 3300005366 Ga0070659_100454389 Ga0070659_1004543892 206
323 3300005434 Ga0070709_10138752 Ga0070709_101387521 206
324 3300005438 Ga0070701_10146628 Ga0070701_101466282 206
325 3300005439 Ga0070711_100029555 Ga0070711_1000295552 206
326 3300005456 Ga0070678_100189761 Ga0070678_1001897612 206
327 3300005458 Ga0070681_10013537 Ga0070681_100135372 206
328 3300005549 Ga0070704_100099174 Ga0070704_1000991742 206
329 3300005615 Ga0070702_100052350 Ga0070702_1000523502 206
330 3300005617 Ga0068859_100025351 Ga0068859_1000253516 206
331 3300005842 Ga0068858_100297637 Ga0068858_1002976372 206
332 3300005843 Ga0068860_100027462 Ga0068860_1000274625 206
333 3300006237 Ga0097621_100150535 Ga0097621_1001505353 206
334 3300006358 Ga0068871_100082764 Ga0068871_1000827643 206
335 3300006846 Ga0075430_100791640 Ga0075430_1007916401 206
336 3300006931 Ga0097620_100025352 Ga0097620_1000253524 206
337 3300009177 Ga0105248_10216479 Ga0105248_102164792 206
338 3300013100 Ga0157373_10234560 Ga0157373_102345602 206
339 3300013296 Ga0157374_10129375 Ga0157374_101293753 206
340 3300013308 Ga0157375_10053593 Ga0157375_100535931 206
341 3300014326 Ga0157380_10329022 Ga0157380_103290222 206
342 3300014745 Ga0157377_10059509 Ga0157377_100595092 206
343 3300020069 Ga0197907_10092348 Ga0197907_100923483 206
344 3300020082 Ga0206353_11791449 Ga0206353_117914491 206
345 3300022467 Ga0224712_10018280 Ga0224712_100182801 206
346 3300025906 Ga0207699_10107436 Ga0207699_101074361 206
347 3300025912 Ga0207707_10011065 Ga0207707_100110652 206
348 3300025916 Ga0207663_10106793 Ga0207663_101067932 206
349 3300025926 Ga0207659_10000651 Ga0207659_1000065113 206
350 3300025940 Ga0207691_10017053 Ga0207691_100170533 206
351 3300025941 Ga0207711_10481317 Ga0207711_104813172 206
352 3300025960 Ga0207651_10138493 Ga0207651_101384933 206
353 3300026035 Ga0207703_10183334 Ga0207703_101833342 206
354 3300026075 Ga0207708_10089836 Ga0207708_100898362 206
355 3300026095 Ga0207676_10327558 Ga0207676_103275582 206
356 3300026121 Ga0207683_10092775 Ga0207683_100927753 206
357 3300028381 Ga0268264_10021088 Ga0268264_100210882 206
358 3300031249 Ga0265339_10096305 Ga0265339_100963052 206
359 3300031250 Ga0265331_10125352 Ga0265331_101253522 206
360 3300031344 Ga0265316_10259024 Ga0265316_102590242 206
361 3300031731 Ga0307405_10119229 Ga0307405_101192292 206
362 3300031824 Ga0307413_10014703 Ga0307413_100147034 206
363 3300031903 Ga0307407_10372549 Ga0307407_103725491 206
364 3300031995 Ga0307409_100036531 Ga0307409_1000365312 206
365 3300032004 Ga0307414_10019663 Ga0307414_100196634 206
366 3300032005 Ga0307411_10102383 Ga0307411_101023833 206
367 3300035084 Ga0373928_0062507 Ga0373928_0062507_91_759 206
368 3300035398 Ga0316574_0000413 Ga0316574_0000413_1408_2094 206
369 3300035398 Ga0316574_0040909 Ga0316574_0040909_838_1533 206
370 3300045051 Ga0451576_0550292 Ga0451576_0550292_230_898 206
371 3300046664 Ga0495659_0123841 Ga0495659_0123841_138_806 206
372 3300048909 Ga0496106_0811172 Ga0496106_0811172_49_717 206
373 3300049515 Ga0501292_022805 Ga0501292_022805_20_724 206
374 3300049534 Ga0501318_021808 Ga0501318_021808_59_769 206
375 3300049656 Ga0501209_061533 Ga0501209_061533_163_876 206
376 3300049705 Ga0501225_0046605 Ga0501225_0046605_317_1030 206
377 3300050491 nmdc:mga00v17_126265_c1 nmdc:mga00v17_126265_c1_849_1544 206
378 3300050511 nmdc:mga08y16_722542_c1 nmdc:mga08y16_722542_c1_73_741 206
379 3300050515 nmdc:mga0a205_283203_c1 nmdc:mga0a205_283203_c1_517_1251 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

32

216

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u9y-assembly1.cif.gz_A crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii 0.7553 13 171
3lpn-assembly1.cif.gz_B crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). 0.7489 13 166
5hkf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.7438 10 169
1wd5-assembly1.cif.gz_A crystal structure of tt1426 from thermus thermophilus hb8 0.7397 4 197
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.7384 10 169
ID Description Score Start End Superfamily
1wd5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9405 7 197 3.40.50.2020
1wd5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9093 7 197 3.40.50.2020
af_Q54QU9_156_292_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7586 29 166 3.40.50.2020
1u9yA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7545 14 171 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.751 12 56 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7V6YD72-F1-model_v4 deleted 0.9782 103 200
AF-A0A3D3T369-F1-model_v4 Phosphoribosyltransferase 0.9778 103 200 GO:0016757
AF-A0A7V0Q5M7-F1-model_v4 Phosphoribosyltransferase 0.9764 107 200 GO:0016757
AF-A0A2V5XFV8-F1-model_v4 Phosphoribosyl transferase 0.9707 105 200 GO:0016740
AF-A0A1E4C3Z6-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9683 103 200

Feature Viewer

pLDDT pTM Quality
79.12 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map