F428401
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 379 | 241 | 377 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300031903|Ga0307407_10136844|Ga0307407_101368442 |
| Length | 248 |
| Sequence | MIYKQRSDLTASQGYWIVQGVLCNDLSRSNGSGNYLAAQLAHYADRDGVLVLALPRGGVPVAFEVAKALRAPLDIFLVRKLGIPGHEELAMDAIATGGVRVLNDEVVEYLRIPSRVIDSVAADELLELERRERAYRGNRPEPEVRAKTVILVDDGLATGSTMRAAAAALRLQDPIRIVVAVPVSAPETCDEYRMGVDEIICAATPKRFQGVGKWYEDFSQTTDEEVRNLLEQARTQHTAMEDHEMAHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 3 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 143 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 144 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 148 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 152 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 179 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 180 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 202 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 203 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 204 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 205 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 206 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 207 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 213 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 218 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 227 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 228 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 240 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.4 |
| Metatranscriptomes | 6.07 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0 |
| Rhizoplane | 1.32 |
| Rhizosphere | 94.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_923896 | 2162886006 | Unclassified | 1019 |
| 2 | rootL2_10035964 | 3300003322 | Bacteria | 4451 |
| 3 | Ga0058863_10779178 | 3300004799 | Bacteria | 1689 |
| 4 | Ga0065704_10098548 | 3300005289 | Bacteria | 2348 |
| 5 | Ga0065707_10004415 | 3300005295 | Bacteria | 4260 |
| 6 | Ga0070683_100159033 | 3300005329 | Bacteria | 2143 |
| 7 | Ga0070690_100131547 | 3300005330 | Bacteria | 1690 |
| 8 | Ga0070670_100104054 | 3300005331 | Unclassified | 2445 |
| 9 | Ga0070680_100101572 | 3300005336 | Bacteria | 2387 |
| 10 | Ga0070689_100090183 | 3300005340 | Bacteria | 2415 |
| 11 | Ga0070689_100468422 | 3300005340 | Bacteria | 1074 |
| 12 | Ga0070669_100013568 | 3300005353 | Bacteria | 5792 |
| 13 | Ga0070669_100130676 | 3300005353 | Unclassified | 1926 |
| 14 | Ga0070675_100036437 | 3300005354 | Bacteria | 4003 |
| 15 | Ga0070675_100817993 | 3300005354 | Bacteria | 852 |
| 16 | Ga0070673_100775160 | 3300005364 | Bacteria | 884 |
| 17 | Ga0070659_100335135 | 3300005366 | Bacteria | 1267 |
| 18 | Ga0070659_100454389 | 3300005366 | Bacteria | 1087 |
| 19 | Ga0070709_10138752 | 3300005434 | Bacteria | 1668 |
| 20 | Ga0070709_10154068 | 3300005434 | Bacteria | 1591 |
| 21 | Ga0070710_10139037 | 3300005437 | Bacteria | 1487 |
| 22 | Ga0070701_10036245 | 3300005438 | Unclassified | 2484 |
| 23 | Ga0070701_10146628 | 3300005438 | Bacteria | 1355 |
| 24 | Ga0070711_100029555 | 3300005439 | Bacteria | 3618 |
| 25 | Ga0070711_100348332 | 3300005439 | Bacteria | 1190 |
| 26 | Ga0070694_100003244 | 3300005444 | Bacteria | 9712 |
| 27 | Ga0070694_100018871 | 3300005444 | Bacteria | 4382 |
| 28 | Ga0070678_100189761 | 3300005456 | Bacteria | 1689 |
| 29 | Ga0070662_100040318 | 3300005457 | Bacteria | 3324 |
| 30 | Ga0070681_10013537 | 3300005458 | Bacteria | 8111 |
| 31 | Ga0070681_10518284 | 3300005458 | Bacteria | 1105 |
| 32 | Ga0070706_100183879 | 3300005467 | Bacteria | 1952 |
| 33 | Ga0070707_100392984 | 3300005468 | Unclassified | 1347 |
| 34 | Ga0070707_100802767 | 3300005468 | Bacteria | 905 |
| 35 | Ga0070698_100005504 | 3300005471 | Bacteria | 13828 |
| 36 | Ga0070698_100019178 | 3300005471 | Bacteria | 7188 |
| 37 | Ga0070698_100111747 | 3300005471 | Bacteria | 2697 |
| 38 | Ga0070699_100048915 | 3300005518 | Unclassified | 3659 |
| 39 | Ga0070699_100213989 | 3300005518 | Bacteria | 1716 |
| 40 | Ga0070679_100100302 | 3300005530 | Unclassified | 2882 |
| 41 | Ga0070679_100202841 | 3300005530 | Bacteria | 1948 |
| 42 | Ga0070684_100771780 | 3300005535 | Unclassified | 898 |
| 43 | Ga0070697_100030075 | 3300005536 | Bacteria | 4360 |
| 44 | Ga0070697_100050808 | 3300005536 | Unclassified | 3366 |
| 45 | Ga0070672_100958606 | 3300005543 | Bacteria | 757 |
| 46 | Ga0070696_100190972 | 3300005546 | Bacteria | 1524 |
| 47 | Ga0070696_100402221 | 3300005546 | Bacteria | 1071 |
| 48 | Ga0070704_100099174 | 3300005549 | Bacteria | 2190 |
| 49 | Ga0070664_100034224 | 3300005564 | Bacteria | 4261 |
| 50 | Ga0068857_100014900 | 3300005577 | Bacteria | 6781 |
| 51 | Ga0068856_100000405 | 3300005614 | Bacteria | 47341 |
| 52 | Ga0070702_100052350 | 3300005615 | Bacteria | 2341 |
| 53 | Ga0068859_100025351 | 3300005617 | Bacteria | 5949 |
| 54 | Ga0068859_100076525 | 3300005617 | Bacteria | 3387 |
| 55 | Ga0068859_100086766 | 3300005617 | Bacteria | 3177 |
| 56 | Ga0068859_100576971 | 3300005617 | Bacteria | 1218 |
| 57 | Ga0068863_100333413 | 3300005841 | Bacteria | 1475 |
| 58 | Ga0068858_100000230 | 3300005842 | Bacteria | 60483 |
| 59 | Ga0068858_100040184 | 3300005842 | Bacteria | 4337 |
| 60 | Ga0068858_100059959 | 3300005842 | Unclassified | 3517 |
| 61 | Ga0068858_100101435 | 3300005842 | Bacteria | 2684 |
| 62 | Ga0068858_100253395 | 3300005842 | Bacteria | 1672 |
| 63 | Ga0068858_100297637 | 3300005842 | Bacteria | 1539 |
| 64 | Ga0068860_100027462 | 3300005843 | Bacteria | 5481 |
| 65 | Ga0068860_100035083 | 3300005843 | Bacteria | 4813 |
| 66 | Ga0068862_100005232 | 3300005844 | Bacteria | 10890 |
| 67 | Ga0068862_100116237 | 3300005844 | Unclassified | 2353 |
| 68 | Ga0081539_10006371 | 3300005985 | Bacteria | 11357 |
| 69 | Ga0081539_10008543 | 3300005985 | Bacteria | 8867 |
| 70 | Ga0070717_10576488 | 3300006028 | Unclassified | 1020 |
| 71 | Ga0075363_100087668 | 3300006048 | Bacteria | 1710 |
| 72 | Ga0075367_10033283 | 3300006178 | Bacteria | 2970 |
| 73 | Ga0097621_100150535 | 3300006237 | Unclassified | 1995 |
| 74 | Ga0068871_100067937 | 3300006358 | Bacteria | 2925 |
| 75 | Ga0068871_100082764 | 3300006358 | Bacteria | 2661 |
| 76 | Ga0075428_100040862 | 3300006844 | Bacteria | 5101 |
| 77 | Ga0075430_100021891 | 3300006846 | Bacteria | 5432 |
| 78 | Ga0075430_100188816 | 3300006846 | Bacteria | 1713 |
| 79 | Ga0075430_100791640 | 3300006846 | Bacteria | 781 |
| 80 | Ga0075431_100035497 | 3300006847 | Bacteria | 5133 |
| 81 | Ga0075431_100286369 | 3300006847 | Bacteria | 1668 |
| 82 | Ga0075433_10039007 | 3300006852 | Bacteria | 4105 |
| 83 | Ga0075433_10042585 | 3300006852 | Bacteria | 3940 |
| 84 | Ga0075433_10095053 | 3300006852 | Bacteria | 2637 |
| 85 | Ga0075433_10271186 | 3300006852 | Bacteria | 1504 |
| 86 | Ga0075433_10382710 | 3300006852 | Bacteria | 1242 |
| 87 | Ga0075434_100150920 | 3300006871 | Bacteria | 2344 |
| 88 | Ga0075429_100005766 | 3300006880 | Bacteria | 10692 |
| 89 | Ga0097620_100025352 | 3300006931 | Bacteria | 5949 |
| 90 | Ga0097620_100076524 | 3300006931 | Bacteria | 3387 |
| 91 | Ga0097620_100086766 | 3300006931 | Bacteria | 3177 |
| 92 | Ga0097620_100576957 | 3300006931 | Bacteria | 1218 |
| 93 | Ga0099794_10037340 | 3300007265 | Bacteria | 2299 |
| 94 | Ga0105240_11044142 | 3300009093 | Unclassified | 872 |
| 95 | Ga0111539_10188632 | 3300009094 | Bacteria | 2406 |
| 96 | Ga0111539_10290055 | 3300009094 | Bacteria | 1904 |
| 97 | Ga0105247_10000697 | 3300009101 | Bacteria | 26376 |
| 98 | Ga0114129_10011331 | 3300009147 | Bacteria | 12701 |
| 99 | Ga0114129_10020671 | 3300009147 | Bacteria | 9358 |
| 100 | Ga0114129_10089979 | 3300009147 | Unclassified | 4255 |
| 101 | Ga0114129_10094788 | 3300009147 | Bacteria | 4134 |
| 102 | Ga0114129_10190689 | 3300009147 | Bacteria | 2784 |
| 103 | Ga0114129_10217328 | 3300009147 | Bacteria | 2581 |
| 104 | Ga0114129_10641458 | 3300009147 | Unclassified | 1372 |
| 105 | Ga0114129_10676045 | 3300009147 | Unclassified | 1330 |
| 106 | Ga0114129_11082664 | 3300009147 | Unclassified | 1004 |
| 107 | Ga0105242_10162514 | 3300009176 | Unclassified | 1956 |
| 108 | Ga0105248_10009151 | 3300009177 | Bacteria | 10894 |
| 109 | Ga0105248_10033545 | 3300009177 | Bacteria | 5736 |
| 110 | Ga0105248_10149774 | 3300009177 | Bacteria | 2633 |
| 111 | Ga0105248_10216479 | 3300009177 | Bacteria | 2157 |
| 112 | Ga0105248_10240820 | 3300009177 | Bacteria | 2036 |
| 113 | Ga0105237_10004434 | 3300009545 | Bacteria | 16266 |
| 114 | Ga0105237_10643785 | 3300009545 | Unclassified | 1067 |
| 115 | Ga0105238_10003415 | 3300009551 | Bacteria | 15831 |
| 116 | Ga0105238_10043027 | 3300009551 | Bacteria | 4571 |
| 117 | Ga0105249_10050620 | 3300009553 | Bacteria | 3787 |
| 118 | Ga0105239_11033450 | 3300010375 | Bacteria | 945 |
| 119 | Ga0105246_10024247 | 3300011119 | Bacteria | 3939 |
| 120 | Ga0157373_10234560 | 3300013100 | Bacteria | 1296 |
| 121 | Ga0157369_10774950 | 3300013105 | Unclassified | 986 |
| 122 | Ga0157374_10129375 | 3300013296 | Bacteria | 2442 |
| 123 | Ga0163162_10009656 | 3300013306 | Bacteria | 9382 |
| 124 | Ga0157375_10053593 | 3300013308 | Bacteria | 3970 |
| 125 | Ga0163163_10306105 | 3300014325 | Bacteria | 1642 |
| 126 | Ga0157380_10329022 | 3300014326 | Bacteria | 1420 |
| 127 | Ga0157377_10059509 | 3300014745 | Bacteria | 2178 |
| 128 | Ga0157379_10004176 | 3300014968 | Bacteria | 12337 |
| 129 | Ga0197907_10092348 | 3300020069 | Bacteria | 2068 |
| 130 | Ga0197907_11248989 | 3300020069 | Bacteria | 1138 |
| 131 | Ga0206349_1132621 | 3300020075 | Bacteria | 2626 |
| 132 | Ga0206351_10024221 | 3300020077 | Bacteria | 1135 |
| 133 | Ga0206351_10363393 | 3300020077 | Bacteria | 879 |
| 134 | Ga0206351_10663954 | 3300020077 | Unclassified | 726 |
| 135 | Ga0206350_10685405 | 3300020080 | Bacteria | 1157 |
| 136 | Ga0206350_11199836 | 3300020080 | Bacteria | 1386 |
| 137 | Ga0206350_11245833 | 3300020080 | Bacteria | 1482 |
| 138 | Ga0206350_11434512 | 3300020080 | Bacteria | 3373 |
| 139 | Ga0206354_11329041 | 3300020081 | Bacteria | 1632 |
| 140 | Ga0206354_11495242 | 3300020081 | Bacteria | 1328 |
| 141 | Ga0206353_11048894 | 3300020082 | Bacteria | 1020 |
| 142 | Ga0206353_11791449 | 3300020082 | Bacteria | 1018 |
| 143 | Ga0213876_10087317 | 3300021384 | Bacteria | 1651 |
| 144 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 145 | Ga0224712_10012729 | 3300022467 | Bacteria | 2657 |
| 146 | Ga0224712_10018280 | 3300022467 | Bacteria | 2340 |
| 147 | Ga0224712_10062447 | 3300022467 | Bacteria | 1488 |
| 148 | Ga0224712_10070910 | 3300022467 | Bacteria | 1414 |
| 149 | Ga0224712_10083335 | 3300022467 | Unclassified | 1325 |
| 150 | Ga0224712_10097459 | 3300022467 | Bacteria | 1242 |
| 151 | Ga0224712_10104203 | 3300022467 | Bacteria | 1208 |
| 152 | Ga0207710_10000037 | 3300025900 | Bacteria | 243545 |
| 153 | Ga0207699_10107436 | 3300025906 | Bacteria | 1783 |
| 154 | Ga0207684_10046168 | 3300025910 | Bacteria | 3696 |
| 155 | Ga0207684_10211772 | 3300025910 | Bacteria | 1672 |
| 156 | Ga0207707_10010175 | 3300025912 | Bacteria | 8163 |
| 157 | Ga0207707_10011065 | 3300025912 | Bacteria | 7847 |
| 158 | Ga0207671_10007177 | 3300025914 | Bacteria | 9713 |
| 159 | Ga0207693_10068578 | 3300025915 | Bacteria | 2776 |
| 160 | Ga0207663_10106793 | 3300025916 | Bacteria | 1893 |
| 161 | Ga0207660_10152991 | 3300025917 | Bacteria | 1774 |
| 162 | Ga0207649_10315830 | 3300025920 | Bacteria | 1146 |
| 163 | Ga0207652_10600074 | 3300025921 | Bacteria | 987 |
| 164 | Ga0207646_10335998 | 3300025922 | Bacteria | 1365 |
| 165 | Ga0207694_10002767 | 3300025924 | Bacteria | 14161 |
| 166 | Ga0207659_10000651 | 3300025926 | Bacteria | 20674 |
| 167 | Ga0207690_10305591 | 3300025932 | Bacteria | 1246 |
| 168 | Ga0207706_10000470 | 3300025933 | Bacteria | 43085 |
| 169 | Ga0207686_10389660 | 3300025934 | Unclassified | 1059 |
| 170 | Ga0207670_10192187 | 3300025936 | Bacteria | 1545 |
| 171 | Ga0207691_10017053 | 3300025940 | Bacteria | 6892 |
| 172 | Ga0207691_10304721 | 3300025940 | Bacteria | 1368 |
| 173 | Ga0207711_10481317 | 3300025941 | Bacteria | 1156 |
| 174 | Ga0207679_10010271 | 3300025945 | Bacteria | 6024 |
| 175 | Ga0207679_10063331 | 3300025945 | Bacteria | 2760 |
| 176 | Ga0207651_10138493 | 3300025960 | Bacteria | 1876 |
| 177 | Ga0207712_10388502 | 3300025961 | Bacteria | 1170 |
| 178 | Ga0207668_10194840 | 3300025972 | Bacteria | 1609 |
| 179 | Ga0207703_10000010 | 3300026035 | Bacteria | 343466 |
| 180 | Ga0207703_10086235 | 3300026035 | Bacteria | 2629 |
| 181 | Ga0207703_10123136 | 3300026035 | Unclassified | 2229 |
| 182 | Ga0207703_10174789 | 3300026035 | Bacteria | 1892 |
| 183 | Ga0207703_10183334 | 3300026035 | Bacteria | 1849 |
| 184 | Ga0207708_10089836 | 3300026075 | Bacteria | 2368 |
| 185 | Ga0207702_10011097 | 3300026078 | Bacteria | 7520 |
| 186 | Ga0207641_10416798 | 3300026088 | Bacteria | 1292 |
| 187 | Ga0207676_10327558 | 3300026095 | Bacteria | 1408 |
| 188 | Ga0207674_10002442 | 3300026116 | Bacteria | 23469 |
| 189 | Ga0207683_10092775 | 3300026121 | Bacteria | 2690 |
| 190 | Ga0207683_10594917 | 3300026121 | Bacteria | 1024 |
| 191 | Ga0209588_1028378 | 3300027671 | Bacteria | 1781 |
| 192 | Ga0207428_10396966 | 3300027907 | Unclassified | 1010 |
| 193 | Ga0268265_10031196 | 3300028380 | Bacteria | 3847 |
| 194 | Ga0268264_10021088 | 3300028381 | Bacteria | 5324 |
| 195 | Ga0268264_10044288 | 3300028381 | Bacteria | 3691 |
| 196 | Ga0265339_10096305 | 3300031249 | Unclassified | 1545 |
| 197 | Ga0265331_10125352 | 3300031250 | Unclassified | 1173 |
| 198 | Ga0265316_10259024 | 3300031344 | Unclassified | 1276 |
| 199 | Ga0307408_100187807 | 3300031548 | Bacteria | 1662 |
| 200 | Ga0307408_100288474 | 3300031548 | Bacteria | 1369 |
| 201 | Ga0265313_10003069 | 3300031595 | Bacteria | 13853 |
| 202 | Ga0316576_10002357 | 3300031727 | Bacteria | 10747 |
| 203 | Ga0307405_10007140 | 3300031731 | Bacteria | 5555 |
| 204 | Ga0307405_10119229 | 3300031731 | Bacteria | 1803 |
| 205 | Ga0307405_10136992 | 3300031731 | Unclassified | 1701 |
| 206 | Ga0307405_10381821 | 3300031731 | Bacteria | 1097 |
| 207 | Ga0307413_10014703 | 3300031824 | Bacteria | 3986 |
| 208 | Ga0307413_10034344 | 3300031824 | Bacteria | 2898 |
| 209 | Ga0307413_10079949 | 3300031824 | Bacteria | 2091 |
| 210 | Ga0307413_10094534 | 3300031824 | Bacteria | 1957 |
| 211 | Ga0307413_10266082 | 3300031824 | Unclassified | 1281 |
| 212 | Ga0307410_10016073 | 3300031852 | Unclassified | 4453 |
| 213 | Ga0307406_10050199 | 3300031901 | Bacteria | 2643 |
| 214 | Ga0307407_10136844 | 3300031903 | Bacteria | 1575 |
| 215 | Ga0307407_10199102 | 3300031903 | Bacteria | 1341 |
| 216 | Ga0307407_10372549 | 3300031903 | Bacteria | 1017 |
| 217 | Ga0307412_10013390 | 3300031911 | Bacteria | 4809 |
| 218 | Ga0307412_10145291 | 3300031911 | Bacteria | 1742 |
| 219 | Ga0307409_100036531 | 3300031995 | Bacteria | 3612 |
| 220 | Ga0307416_100005887 | 3300032002 | Bacteria | 7610 |
| 221 | Ga0307416_100494452 | 3300032002 | Bacteria | 1286 |
| 222 | Ga0307416_101839705 | 3300032002 | Bacteria | 709 |
| 223 | Ga0307414_10000992 | 3300032004 | Bacteria | 14504 |
| 224 | Ga0307414_10011841 | 3300032004 | Bacteria | 5135 |
| 225 | Ga0307414_10019663 | 3300032004 | Bacteria | 4191 |
| 226 | Ga0307414_10042071 | 3300032004 | Bacteria | 3101 |
| 227 | Ga0307414_10152622 | 3300032004 | Bacteria | 1824 |
| 228 | Ga0307411_10102383 | 3300032005 | Bacteria | 2029 |
| 229 | Ga0307411_10279587 | 3300032005 | Bacteria | 1328 |
| 230 | Ga0307415_100007446 | 3300032126 | Bacteria | 5988 |
| 231 | Ga0307415_100030676 | 3300032126 | Bacteria | 3454 |
| 232 | Ga0307415_100056274 | 3300032126 | Bacteria | 2695 |
| 233 | Ga0307415_100232625 | 3300032126 | Bacteria | 1485 |
| 234 | Ga0373928_0062507 | 3300035084 | Bacteria | 904 |
| 235 | Ga0373934_0028391 | 3300035086 | Bacteria | 2180 |
| 236 | Ga0373954_0011200 | 3300035118 | Bacteria | 3970 |
| 237 | Ga0373956_0004741 | 3300035119 | Bacteria | 5441 |
| 238 | Ga0373956_0008552 | 3300035119 | Bacteria | 4144 |
| 239 | Ga0316574_0000413 | 3300035398 | Bacteria | 16888 |
| 240 | Ga0316574_0040909 | 3300035398 | Bacteria | 2855 |
| 241 | Ga0373924_0128272 | 3300035410 | Bacteria | 1103 |
| 242 | Ga0373935_0629440 | 3300035692 | Bacteria | 786 |
| 243 | Ga0373933_0000093 | 3300035724 | Bacteria | 56013 |
| 244 | Ga0373937_0000020 | 3300036401 | Bacteria | 131263 |
| 245 | Ga0373937_0027288 | 3300036401 | Bacteria | 5164 |
| 246 | Ga0395905_0108025 | 3300037471 | Bacteria | 2612 |
| 247 | Ga0395905_0239429 | 3300037471 | Unclassified | 1696 |
| 248 | Ga0395905_0527024 | 3300037471 | Unclassified | 1082 |
| 249 | Ga0436364_0080170 | 3300037853 | Bacteria | 70161 |
| 250 | Ga0395901_0573363 | 3300038443 | Bacteria | 1141 |
| 251 | Ga0395901_1054315 | 3300038443 | Bacteria | 786 |
| 252 | Ga0436365_0052778 | 3300039437 | Bacteria | 5394 |
| 253 | Ga0436365_0926743 | 3300039437 | Bacteria | 678 |
| 254 | Ga0436360_0278187 | 3300039438 | Bacteria | 1845 |
| 255 | Ga0453683_0009739 | 3300044673 | Bacteria | 6405 |
| 256 | Ga0451576_0339457 | 3300045051 | Bacteria | 1573 |
| 257 | Ga0451576_0550292 | 3300045051 | Bacteria | 1212 |
| 258 | Ga0451576_0611090 | 3300045051 | Bacteria | 1146 |
| 259 | Ga0495651_0001243 | 3300046462 | Bacteria | 19728 |
| 260 | Ga0495653_0185182 | 3300046463 | Bacteria | 1425 |
| 261 | Ga0495580_0309602 | 3300046472 | Bacteria | 1075 |
| 262 | Ga0495644_0196115 | 3300046523 | Unclassified | 778 |
| 263 | Ga0495652_0006914 | 3300046529 | Bacteria | 10500 |
| 264 | Ga0495587_0000578 | 3300046536 | Bacteria | 25197 |
| 265 | Ga0495621_0015224 | 3300046539 | Bacteria | 2450 |
| 266 | Ga0495667_0339139 | 3300046559 | Bacteria | 950 |
| 267 | Ga0495656_0122859 | 3300046615 | Bacteria | 1227 |
| 268 | Ga0495656_0581009 | 3300046615 | Bacteria | 599 |
| 269 | Ga0495659_0064952 | 3300046664 | Bacteria | 1356 |
| 270 | Ga0495659_0123841 | 3300046664 | Bacteria | 1020 |
| 271 | Ga0495646_0309037 | 3300046680 | Bacteria | 835 |
| 272 | Ga0495669_0010995 | 3300046684 | Bacteria | 3832 |
| 273 | Ga0495670_0159116 | 3300046691 | Bacteria | 1186 |
| 274 | Ga0495600_0264132 | 3300046809 | Bacteria | 1093 |
| 275 | Ga0495636_0108170 | 3300047318 | Bacteria | 1221 |
| 276 | Ga0495680_0369121 | 3300047322 | Bacteria | 996 |
| 277 | Ga0495675_0016270 | 3300047444 | Bacteria | 4704 |
| 278 | Ga0495602_0000037 | 3300048088 | Bacteria | 132280 |
| 279 | Ga0496104_0364286 | 3300048907 | Bacteria | 1358 |
| 280 | Ga0496106_0050317 | 3300048909 | Bacteria | 3141 |
| 281 | Ga0496106_0811172 | 3300048909 | Bacteria | 742 |
| 282 | Ga0496107_0195875 | 3300048910 | Bacteria | 1502 |
| 283 | Ga0496112_0199130 | 3300048915 | Bacteria | 1963 |
| 284 | Ga0496116_0000044 | 3300048919 | Bacteria | 327709 |
| 285 | Ga0496121_0000049 | 3300048924 | Bacteria | 324451 |
| 286 | Ga0496121_0041210 | 3300048924 | Bacteria | 4039 |
| 287 | Ga0501292_022805 | 3300049515 | Bacteria | 1020 |
| 288 | Ga0501299_014534 | 3300049522 | Unclassified | 1371 |
| 289 | Ga0501318_021808 | 3300049534 | Bacteria | 817 |
| 290 | Ga0501031_0244750 | 3300049568 | Bacteria | 1165 |
| 291 | Ga0501033_0045176 | 3300049570 | Bacteria | 3279 |
| 292 | Ga0501034_0728832 | 3300049571 | Bacteria | 888 |
| 293 | Ga0501034_0917658 | 3300049571 | Bacteria | 763 |
| 294 | Ga0501036_0006662 | 3300049572 | Bacteria | 9392 |
| 295 | Ga0501037_0365707 | 3300049573 | Bacteria | 993 |
| 296 | Ga0501039_0851922 | 3300049575 | Bacteria | 710 |
| 297 | Ga0501040_0005723 | 3300049576 | Bacteria | 8039 |
| 298 | Ga0501041_0004893 | 3300049577 | Bacteria | 7784 |
| 299 | Ga0501042_0008729 | 3300049578 | Bacteria | 6722 |
| 300 | Ga0501043_0171608 | 3300049579 | Bacteria | 1692 |
| 301 | Ga0501046_0161557 | 3300049580 | Bacteria | 1684 |
| 302 | Ga0501047_0568495 | 3300049581 | Bacteria | 957 |
| 303 | Ga0501048_0062261 | 3300049582 | Bacteria | 2641 |
| 304 | Ga0501068_0069356 | 3300049584 | Bacteria | 2150 |
| 305 | Ga0501068_0220678 | 3300049584 | Bacteria | 1205 |
| 306 | Ga0501070_0355666 | 3300049586 | Bacteria | 1188 |
| 307 | Ga0501073_0301781 | 3300049589 | Bacteria | 1105 |
| 308 | Ga0501073_0412236 | 3300049589 | Bacteria | 933 |
| 309 | Ga0501074_0058412 | 3300049590 | Bacteria | 2779 |
| 310 | Ga0501074_0077131 | 3300049590 | Bacteria | 2392 |
| 311 | Ga0501075_0013226 | 3300049591 | Bacteria | 5887 |
| 312 | Ga0501075_0213049 | 3300049591 | Bacteria | 1473 |
| 313 | Ga0501076_0002423 | 3300049592 | Bacteria | 12791 |
| 314 | Ga0501077_0010675 | 3300049593 | Bacteria | 5719 |
| 315 | Ga0501198_002858 | 3300049649 | Bacteria | 2346 |
| 316 | Ga0501198_010279 | 3300049649 | Bacteria | 1382 |
| 317 | Ga0501207_000050 | 3300049654 | Bacteria | 8606 |
| 318 | Ga0501209_061533 | 3300049656 | Bacteria | 1049 |
| 319 | Ga0501214_008875 | 3300049659 | Bacteria | 1066 |
| 320 | Ga0501216_001093 | 3300049660 | Unclassified | 3537 |
| 321 | Ga0501217_004441 | 3300049661 | Bacteria | 2884 |
| 322 | Ga0501217_032761 | 3300049661 | Bacteria | 1287 |
| 323 | Ga0501223_002730 | 3300049663 | Bacteria | 3881 |
| 324 | Ga0501223_005459 | 3300049663 | Bacteria | 2670 |
| 325 | Ga0501223_011532 | 3300049663 | Bacteria | 1774 |
| 326 | Ga0501224_000371 | 3300049664 | Bacteria | 5286 |
| 327 | Ga0501224_000949 | 3300049664 | Bacteria | 3735 |
| 328 | Ga0501227_000008 | 3300049665 | Bacteria | 36003 |
| 329 | Ga0501227_000231 | 3300049665 | Bacteria | 11284 |
| 330 | Ga0501227_001519 | 3300049665 | Bacteria | 5182 |
| 331 | Ga0501233_006634 | 3300049668 | Bacteria | 2180 |
| 332 | Ga0501236_003770 | 3300049670 | Bacteria | 1779 |
| 333 | Ga0501243_003369 | 3300049675 | Bacteria | 2364 |
| 334 | Ga0501243_014861 | 3300049675 | Unclassified | 1246 |
| 335 | Ga0501257_005707 | 3300049686 | Unclassified | 2749 |
| 336 | Ga0501259_016964 | 3300049688 | Unclassified | 1257 |
| 337 | Ga0501221_002655 | 3300049704 | Bacteria | 2946 |
| 338 | Ga0501225_0000543 | 3300049705 | Bacteria | 11823 |
| 339 | Ga0501225_0010264 | 3300049705 | Bacteria | 2656 |
| 340 | Ga0501225_0046605 | 3300049705 | Bacteria | 1202 |
| 341 | Ga0501229_013540 | 3300049706 | Bacteria | 1048 |
| 342 | Ga0501234_000259 | 3300049707 | Bacteria | 7705 |
| 343 | Ga0501234_001108 | 3300049707 | Bacteria | 4256 |
| 344 | Ga0501079_0122479 | 3300049741 | Bacteria | 2022 |
| 345 | Ga0501080_0113435 | 3300049742 | Bacteria | 2513 |
| 346 | Ga0501081_0006872 | 3300049743 | Bacteria | 7400 |
| 347 | Ga0501081_0028261 | 3300049743 | Bacteria | 3784 |
| 348 | Ga0501083_0021730 | 3300049744 | Bacteria | 4457 |
| 349 | Ga0501083_0328938 | 3300049744 | Bacteria | 994 |
| 350 | Ga0501241_010975 | 3300049758 | Bacteria | 1645 |
| 351 | Ga0501044_0006232 | 3300049823 | Bacteria | 13186 |
| 352 | Ga0501045_0002990 | 3300049824 | Bacteria | 11565 |
| 353 | Ga0501045_0071644 | 3300049824 | Bacteria | 2551 |
| 354 | Ga0501204_001077 | 3300049850 | Bacteria | 2587 |
| 355 | Ga0501212_014326 | 3300049851 | Bacteria | 1172 |
| 356 | Ga0501226_000214 | 3300049853 | Bacteria | 9165 |
| 357 | nmdc:mga00v17_126265_c1 | 3300050491 | Bacteria | 1632 |
| 358 | nmdc:mga0k408_611401_c1 | 3300050493 | Bacteria | 642 |
| 359 | nmdc:mga05p37_146639_c1 | 3300050507 | Bacteria | 2889 |
| 360 | nmdc:mga05p37_148438_c1 | 3300050507 | Unclassified | 2869 |
| 361 | nmdc:mga05p37_159444_c1 | 3300050507 | Bacteria | 1251 |
| 362 | nmdc:mga05p37_513768_c1 | 3300050507 | Unclassified | 1372 |
| 363 | nmdc:mga05p37_72406_c1 | 3300050507 | Bacteria | 4240 |
| 364 | nmdc:mga09592_4398_c1 | 3300050508 | Bacteria | 11400 |
| 365 | nmdc:mga0qj67_194044_c1 | 3300050509 | Bacteria | 1650 |
| 366 | nmdc:mga0qj67_2453_c1 | 3300050509 | Bacteria | 13203 |
| 367 | nmdc:mga06r32_234725_c1 | 3300050510 | Bacteria | 1822 |
| 368 | nmdc:mga08y16_209775_c1 | 3300050511 | Bacteria | 2017 |
| 369 | nmdc:mga08y16_364463_c1 | 3300050511 | Bacteria | 1483 |
| 370 | nmdc:mga08y16_722542_c1 | 3300050511 | Unclassified | 994 |
| 371 | nmdc:mga0a205_110714_c1 | 3300050515 | Bacteria | 2645 |
| 372 | nmdc:mga0a205_283203_c1 | 3300050515 | Bacteria | 1533 |
| 373 | Ga0495619_0226462 | 3300053085 | Bacteria | 1295 |
| 374 | Ga0501084_0001133 | 3300054114 | Bacteria | 20773 |
| 375 | Ga0590075_040165 | 3300059424 | Bacteria | 1195 |
| 376 | Ga0501082_0010713 | 3300060353 | Bacteria | 7890 |
| 377 | Ga0530510_0030079 | 3300061734 | Bacteria | 3899 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050493 | nmdc:mga0k408_611401_c1 | nmdc:mga0k408_611401_c1_31_585 | 146 |
| 2 | 3300046615 | Ga0495656_0581009 | Ga0495656_0581009_32_580 | 161 |
| 3 | 3300046680 | Ga0495646_0309037 | Ga0495646_0309037_76_675 | 177 |
| 4 | 3300049575 | Ga0501039_0851922 | Ga0501039_0851922_99_698 | 177 |
| 5 | 3300006048 | Ga0075363_100087668 | Ga0075363_1000876682 | 183 |
| 6 | 3300006178 | Ga0075367_10033283 | Ga0075367_100332832 | 183 |
| 7 | 3300046472 | Ga0495580_0309602 | Ga0495580_0309602_425_1063 | 185 |
| 8 | 3300009177 | Ga0105248_10033545 | Ga0105248_100335452 | 186 |
| 9 | 3300021384 | Ga0213876_10087317 | Ga0213876_100873172 | 186 |
| 10 | 3300039437 | Ga0436365_0926743 | Ga0436365_0926743_21_629 | 186 |
| 11 | 3300049571 | Ga0501034_0917658 | Ga0501034_0917658_95_703 | 186 |
| 12 | 3300049584 | Ga0501068_0220678 | Ga0501068_0220678_15_683 | 187 |
| 13 | 3300006028 | Ga0070717_10576488 | Ga0070717_105764881 | 189 |
| 14 | 3300048907 | Ga0496104_0364286 | Ga0496104_0364286_133_807 | 189 |
| 15 | 3300005518 | Ga0070699_100213989 | Ga0070699_1002139892 | 190 |
| 16 | 3300005353 | Ga0070669_100130676 | Ga0070669_1001306762 | 191 |
| 17 | 3300005467 | Ga0070706_100183879 | Ga0070706_1001838792 | 191 |
| 18 | 3300005844 | Ga0068862_100116237 | Ga0068862_1001162374 | 191 |
| 19 | 3300006844 | Ga0075428_100040862 | Ga0075428_1000408623 | 191 |
| 20 | 3300006846 | Ga0075430_100188816 | Ga0075430_1001888163 | 191 |
| 21 | 3300006852 | Ga0075433_10039007 | Ga0075433_100390073 | 191 |
| 22 | 3300006880 | Ga0075429_100005766 | Ga0075429_1000057665 | 191 |
| 23 | 3300009147 | Ga0114129_10190689 | Ga0114129_101906892 | 191 |
| 24 | 3300025910 | Ga0207684_10211772 | Ga0207684_102117722 | 191 |
| 25 | 3300035692 | Ga0373935_0629440 | Ga0373935_0629440_12_635 | 191 |
| 26 | 3300050507 | nmdc:mga05p37_159444_c1 | nmdc:mga05p37_159444_c1_410_1033 | 191 |
| 27 | 3300050508 | nmdc:mga09592_4398_c1 | nmdc:mga09592_4398_c1_1470_2093 | 191 |
| 28 | 3300050509 | nmdc:mga0qj67_194044_c1 | nmdc:mga0qj67_194044_c1_84_707 | 191 |
| 29 | 3300005471 | Ga0070698_100111747 | Ga0070698_1001117473 | 194 |
| 30 | 3300048915 | Ga0496112_0199130 | Ga0496112_0199130_14_679 | 194 |
| 31 | 3300005985 | Ga0081539_10008543 | Ga0081539_100085432 | 195 |
| 32 | 3300009176 | Ga0105242_10162514 | Ga0105242_101625142 | 195 |
| 33 | 3300025934 | Ga0207686_10389660 | Ga0207686_103896601 | 195 |
| 34 | 3300031727 | Ga0316576_10002357 | Ga0316576_100023576 | 195 |
| 35 | 3300009147 | Ga0114129_10089979 | Ga0114129_100899794 | 196 |
| 36 | 3300009551 | Ga0105238_10003415 | Ga0105238_1000341515 | 196 |
| 37 | 3300014325 | Ga0163163_10306105 | Ga0163163_103061052 | 196 |
| 38 | 3300031731 | Ga0307405_10381821 | Ga0307405_103818212 | 196 |
| 39 | 3300049571 | Ga0501034_0728832 | Ga0501034_0728832_125_763 | 196 |
| 40 | 3300049589 | Ga0501073_0412236 | Ga0501073_0412236_254_892 | 196 |
| 41 | 3300050507 | nmdc:mga05p37_148438_c1 | nmdc:mga05p37_148438_c1_1182_1826 | 196 |
| 42 | 3300005444 | Ga0070694_100018871 | Ga0070694_1000188712 | 197 |
| 43 | 3300005842 | Ga0068858_100253395 | Ga0068858_1002533952 | 197 |
| 44 | 3300006871 | Ga0075434_100150920 | Ga0075434_1001509203 | 197 |
| 45 | 3300009147 | Ga0114129_10011331 | Ga0114129_100113313 | 197 |
| 46 | 3300013306 | Ga0163162_10009656 | Ga0163162_100096567 | 197 |
| 47 | 3300026035 | Ga0207703_10174789 | Ga0207703_101747892 | 197 |
| 48 | 3300031548 | Ga0307408_100187807 | Ga0307408_1001878071 | 197 |
| 49 | 3300031731 | Ga0307405_10136992 | Ga0307405_101369922 | 197 |
| 50 | 3300031824 | Ga0307413_10266082 | Ga0307413_102660822 | 197 |
| 51 | 3300031901 | Ga0307406_10050199 | Ga0307406_100501991 | 197 |
| 52 | 3300031911 | Ga0307412_10145291 | Ga0307412_101452913 | 197 |
| 53 | 3300032002 | Ga0307416_101839705 | Ga0307416_1018397051 | 197 |
| 54 | 3300032004 | Ga0307414_10042071 | Ga0307414_100420712 | 197 |
| 55 | 3300032126 | Ga0307415_100056274 | Ga0307415_1000562743 | 197 |
| 56 | 3300049522 | Ga0501299_014534 | Ga0501299_014534_51_722 | 197 |
| 57 | 3300049654 | Ga0501207_000050 | Ga0501207_000050_3552_4220 | 197 |
| 58 | 3300049661 | Ga0501217_004441 | Ga0501217_004441_1663_2334 | 197 |
| 59 | 3300049663 | Ga0501223_005459 | Ga0501223_005459_262_933 | 197 |
| 60 | 3300049664 | Ga0501224_000949 | Ga0501224_000949_1099_1770 | 197 |
| 61 | 3300049665 | Ga0501227_001519 | Ga0501227_001519_2862_3533 | 197 |
| 62 | 3300049688 | Ga0501259_016964 | Ga0501259_016964_50_721 | 197 |
| 63 | 3300049705 | Ga0501225_0010264 | Ga0501225_0010264_21_692 | 197 |
| 64 | 3300049850 | Ga0501204_001077 | Ga0501204_001077_328_999 | 197 |
| 65 | 3300049851 | Ga0501212_014326 | Ga0501212_014326_210_878 | 197 |
| 66 | 3300050507 | nmdc:mga05p37_146639_c1 | nmdc:mga05p37_146639_c1_2141_2782 | 197 |
| 67 | 3300005437 | Ga0070710_10139037 | Ga0070710_101390372 | 198 |
| 68 | 3300005439 | Ga0070711_100348332 | Ga0070711_1003483322 | 198 |
| 69 | 3300025910 | Ga0207684_10046168 | Ga0207684_100461684 | 198 |
| 70 | 3300025915 | Ga0207693_10068578 | Ga0207693_100685781 | 198 |
| 71 | 3300032126 | Ga0307415_100232625 | Ga0307415_1002326252 | 198 |
| 72 | 3300038443 | Ga0395901_0573363 | Ga0395901_0573363_407_1069 | 198 |
| 73 | 3300009094 | Ga0111539_10290055 | Ga0111539_102900552 | 199 |
| 74 | 3300049744 | Ga0501083_0328938 | Ga0501083_0328938_72_752 | 199 |
| 75 | 3300060353 | Ga0501082_0010713 | Ga0501082_0010713_1364_2044 | 199 |
| 76 | iso_pu_bacteria | 2524614857 | 2526061371 | 199 |
| 77 | iso_pu_bacteria | 2739367875 | 2740064941 | 199 |
| 78 | 3300005444 | Ga0070694_100003244 | Ga0070694_1000032443 | 200 |
| 79 | 3300005535 | Ga0070684_100771780 | Ga0070684_1007717801 | 200 |
| 80 | 3300031824 | Ga0307413_10034344 | Ga0307413_100343443 | 200 |
| 81 | 3300031903 | Ga0307407_10199102 | Ga0307407_101991022 | 200 |
| 82 | 3300032002 | Ga0307416_100494452 | Ga0307416_1004944522 | 200 |
| 83 | 3300035086 | Ga0373934_0028391 | Ga0373934_0028391_1208_1873 | 200 |
| 84 | 3300035119 | Ga0373956_0004741 | Ga0373956_0004741_2508_3173 | 200 |
| 85 | 3300035410 | Ga0373924_0128272 | Ga0373924_0128272_226_891 | 200 |
| 86 | 3300035724 | Ga0373933_0000093 | Ga0373933_0000093_30495_31160 | 200 |
| 87 | 3300036401 | Ga0373937_0000020 | Ga0373937_0000020_73508_74173 | 200 |
| 88 | 3300036401 | Ga0373937_0027288 | Ga0373937_0027288_1779_2444 | 200 |
| 89 | 3300039437 | Ga0436365_0052778 | Ga0436365_0052778_630_1280 | 200 |
| 90 | 3300046462 | Ga0495651_0001243 | Ga0495651_0001243_18371_19036 | 200 |
| 91 | 3300046463 | Ga0495653_0185182 | Ga0495653_0185182_415_1080 | 200 |
| 92 | 3300046529 | Ga0495652_0006914 | Ga0495652_0006914_3302_3967 | 200 |
| 93 | 3300046536 | Ga0495587_0000578 | Ga0495587_0000578_9914_10579 | 200 |
| 94 | 3300046559 | Ga0495667_0339139 | Ga0495667_0339139_198_863 | 200 |
| 95 | 3300046809 | Ga0495600_0264132 | Ga0495600_0264132_162_827 | 200 |
| 96 | 3300047322 | Ga0495680_0369121 | Ga0495680_0369121_95_760 | 200 |
| 97 | 3300047444 | Ga0495675_0016270 | Ga0495675_0016270_2040_2705 | 200 |
| 98 | 3300048088 | Ga0495602_0000037 | Ga0495602_0000037_97196_97861 | 200 |
| 99 | 3300005842 | Ga0068858_100000230 | Ga0068858_1000002306 | 201 |
| 100 | 3300009177 | Ga0105248_10009151 | Ga0105248_1000915110 | 201 |
| 101 | 3300009551 | Ga0105238_10043027 | Ga0105238_100430273 | 201 |
| 102 | 3300011119 | Ga0105246_10024247 | Ga0105246_100242472 | 201 |
| 103 | 3300014968 | Ga0157379_10004176 | Ga0157379_100041766 | 201 |
| 104 | 3300020077 | Ga0206351_10663954 | Ga0206351_106639541 | 201 |
| 105 | 3300020080 | Ga0206350_11434512 | Ga0206350_114345125 | 201 |
| 106 | 3300020081 | Ga0206354_11329041 | Ga0206354_113290412 | 201 |
| 107 | 3300022467 | Ga0224712_10097459 | Ga0224712_100974592 | 201 |
| 108 | 3300026035 | Ga0207703_10000010 | Ga0207703_10000010152 | 201 |
| 109 | 3300031548 | Ga0307408_100288474 | Ga0307408_1002884742 | 201 |
| 110 | 3300031595 | Ga0265313_10003069 | Ga0265313_1000306912 | 201 |
| 111 | 3300031852 | Ga0307410_10016073 | Ga0307410_100160733 | 201 |
| 112 | 3300032004 | Ga0307414_10011841 | Ga0307414_100118417 | 201 |
| 113 | 3300032126 | Ga0307415_100007446 | Ga0307415_1000074461 | 201 |
| 114 | 3300037471 | Ga0395905_0527024 | Ga0395905_0527024_168_821 | 201 |
| 115 | 3300049581 | Ga0501047_0568495 | Ga0501047_0568495_226_897 | 201 |
| 116 | 3300049590 | Ga0501074_0077131 | Ga0501074_0077131_1381_2034 | 201 |
| 117 | 3300049649 | Ga0501198_010279 | Ga0501198_010279_399_1067 | 201 |
| 118 | 3300049659 | Ga0501214_008875 | Ga0501214_008875_17_685 | 201 |
| 119 | 3300049660 | Ga0501216_001093 | Ga0501216_001093_1685_2374 | 201 |
| 120 | 3300049661 | Ga0501217_032761 | Ga0501217_032761_327_995 | 201 |
| 121 | 3300049665 | Ga0501227_000231 | Ga0501227_000231_201_869 | 201 |
| 122 | 3300049668 | Ga0501233_006634 | Ga0501233_006634_951_1640 | 201 |
| 123 | 3300049670 | Ga0501236_003770 | Ga0501236_003770_552_1220 | 201 |
| 124 | 3300049675 | Ga0501243_014861 | Ga0501243_014861_55_723 | 201 |
| 125 | 3300049705 | Ga0501225_0000543 | Ga0501225_0000543_10958_11626 | 201 |
| 126 | 3300049706 | Ga0501229_013540 | Ga0501229_013540_349_1017 | 201 |
| 127 | 3300049707 | Ga0501234_000259 | Ga0501234_000259_842_1510 | 201 |
| 128 | 3300049707 | Ga0501234_001108 | Ga0501234_001108_1868_2551 | 201 |
| 129 | 3300049743 | Ga0501081_0028261 | Ga0501081_0028261_3064_3717 | 201 |
| 130 | 3300049758 | Ga0501241_010975 | Ga0501241_010975_341_1009 | 201 |
| 131 | 3300049823 | Ga0501044_0006232 | Ga0501044_0006232_2738_3409 | 201 |
| 132 | 3300049824 | Ga0501045_0071644 | Ga0501045_0071644_1279_1932 | 201 |
| 133 | 3300005329 | Ga0070683_100159033 | Ga0070683_1001590332 | 202 |
| 134 | 3300005331 | Ga0070670_100104054 | Ga0070670_1001040544 | 202 |
| 135 | 3300005364 | Ga0070673_100775160 | Ga0070673_1007751602 | 202 |
| 136 | 3300005468 | Ga0070707_100392984 | Ga0070707_1003929842 | 202 |
| 137 | 3300005468 | Ga0070707_100802767 | Ga0070707_1008027672 | 202 |
| 138 | 3300005471 | Ga0070698_100005504 | Ga0070698_1000055046 | 202 |
| 139 | 3300005518 | Ga0070699_100048915 | Ga0070699_1000489152 | 202 |
| 140 | 3300005536 | Ga0070697_100030075 | Ga0070697_1000300753 | 202 |
| 141 | 3300005546 | Ga0070696_100190972 | Ga0070696_1001909721 | 202 |
| 142 | 3300005614 | Ga0068856_100000405 | Ga0068856_1000004055 | 202 |
| 143 | 3300005985 | Ga0081539_10006371 | Ga0081539_1000637111 | 202 |
| 144 | 3300006358 | Ga0068871_100067937 | Ga0068871_1000679373 | 202 |
| 145 | 3300006852 | Ga0075433_10042585 | Ga0075433_100425853 | 202 |
| 146 | 3300006852 | Ga0075433_10095053 | Ga0075433_100950532 | 202 |
| 147 | 3300006852 | Ga0075433_10271186 | Ga0075433_102711862 | 202 |
| 148 | 3300009093 | Ga0105240_11044142 | Ga0105240_110441421 | 202 |
| 149 | 3300009094 | Ga0111539_10188632 | Ga0111539_101886322 | 202 |
| 150 | 3300009147 | Ga0114129_10217328 | Ga0114129_102173284 | 202 |
| 151 | 3300009147 | Ga0114129_10641458 | Ga0114129_106414582 | 202 |
| 152 | 3300009147 | Ga0114129_10676045 | Ga0114129_106760452 | 202 |
| 153 | 3300009545 | Ga0105237_10643785 | Ga0105237_106437852 | 202 |
| 154 | 3300013105 | Ga0157369_10774950 | Ga0157369_107749502 | 202 |
| 155 | 3300020077 | Ga0206351_10363393 | Ga0206351_103633932 | 202 |
| 156 | 3300020080 | Ga0206350_11199836 | Ga0206350_111998362 | 202 |
| 157 | 3300022467 | Ga0224712_10062447 | Ga0224712_100624471 | 202 |
| 158 | 3300025924 | Ga0207694_10002767 | Ga0207694_1000276716 | 202 |
| 159 | 3300025945 | Ga0207679_10063331 | Ga0207679_100633313 | 202 |
| 160 | 3300026078 | Ga0207702_10011097 | Ga0207702_100110974 | 202 |
| 161 | 3300026121 | Ga0207683_10594917 | Ga0207683_105949171 | 202 |
| 162 | 3300031731 | Ga0307405_10007140 | Ga0307405_100071404 | 202 |
| 163 | 3300031824 | Ga0307413_10079949 | Ga0307413_100799492 | 202 |
| 164 | 3300031903 | Ga0307407_10136844 | Ga0307407_101368442 | 202 |
| 165 | 3300031911 | Ga0307412_10013390 | Ga0307412_100133907 | 202 |
| 166 | 3300032002 | Ga0307416_100005887 | Ga0307416_1000058876 | 202 |
| 167 | 3300032004 | Ga0307414_10000992 | Ga0307414_100009926 | 202 |
| 168 | 3300032004 | Ga0307414_10152622 | Ga0307414_101526222 | 202 |
| 169 | 3300032005 | Ga0307411_10279587 | Ga0307411_102795872 | 202 |
| 170 | 3300032126 | Ga0307415_100030676 | Ga0307415_1000306763 | 202 |
| 171 | 3300044673 | Ga0453683_0009739 | Ga0453683_0009739_2717_3385 | 202 |
| 172 | 3300045051 | Ga0451576_0611090 | Ga0451576_0611090_326_988 | 202 |
| 173 | 3300046615 | Ga0495656_0122859 | Ga0495656_0122859_271_939 | 202 |
| 174 | 3300047318 | Ga0495636_0108170 | Ga0495636_0108170_206_874 | 202 |
| 175 | 3300048919 | Ga0496116_0000044 | Ga0496116_0000044_94929_95585 | 202 |
| 176 | 3300048924 | Ga0496121_0000049 | Ga0496121_0000049_93573_94229 | 202 |
| 177 | 3300049649 | Ga0501198_002858 | Ga0501198_002858_1549_2226 | 202 |
| 178 | 3300049663 | Ga0501223_002730 | Ga0501223_002730_1788_2465 | 202 |
| 179 | 3300049664 | Ga0501224_000371 | Ga0501224_000371_3820_4497 | 202 |
| 180 | 3300049665 | Ga0501227_000008 | Ga0501227_000008_27158_27904 | 202 |
| 181 | 3300049675 | Ga0501243_003369 | Ga0501243_003369_1303_1980 | 202 |
| 182 | 3300049686 | Ga0501257_005707 | Ga0501257_005707_1940_2608 | 202 |
| 183 | 3300049704 | Ga0501221_002655 | Ga0501221_002655_296_973 | 202 |
| 184 | 3300049853 | Ga0501226_000214 | Ga0501226_000214_5578_6246 | 202 |
| 185 | 3300050507 | nmdc:mga05p37_513768_c1 | nmdc:mga05p37_513768_c1_460_1131 | 202 |
| 186 | 3300050511 | nmdc:mga08y16_209775_c1 | nmdc:mga08y16_209775_c1_339_1028 | 202 |
| 187 | 3300050515 | nmdc:mga0a205_110714_c1 | nmdc:mga0a205_110714_c1_1305_1985 | 202 |
| 188 | 3300053085 | Ga0495619_0226462 | Ga0495619_0226462_453_1127 | 202 |
| 189 | 3300059424 | Ga0590075_040165 | Ga0590075_040165_463_1125 | 202 |
| 190 | 3300003322 | rootL2_10035964 | rootL2_100359642 | 203 |
| 191 | 3300005336 | Ga0070680_100101572 | Ga0070680_1001015722 | 203 |
| 192 | 3300005340 | Ga0070689_100468422 | Ga0070689_1004684221 | 203 |
| 193 | 3300005353 | Ga0070669_100013568 | Ga0070669_1000135684 | 203 |
| 194 | 3300005366 | Ga0070659_100335135 | Ga0070659_1003351352 | 203 |
| 195 | 3300005434 | Ga0070709_10154068 | Ga0070709_101540682 | 203 |
| 196 | 3300005457 | Ga0070662_100040318 | Ga0070662_1000403183 | 203 |
| 197 | 3300005458 | Ga0070681_10518284 | Ga0070681_105182841 | 203 |
| 198 | 3300005530 | Ga0070679_100202841 | Ga0070679_1002028413 | 203 |
| 199 | 3300005543 | Ga0070672_100958606 | Ga0070672_1009586061 | 203 |
| 200 | 3300005546 | Ga0070696_100402221 | Ga0070696_1004022211 | 203 |
| 201 | 3300005564 | Ga0070664_100034224 | Ga0070664_1000342242 | 203 |
| 202 | 3300005577 | Ga0068857_100014900 | Ga0068857_1000149004 | 203 |
| 203 | 3300005617 | Ga0068859_100076525 | Ga0068859_1000765252 | 203 |
| 204 | 3300005617 | Ga0068859_100086766 | Ga0068859_1000867663 | 203 |
| 205 | 3300005841 | Ga0068863_100333413 | Ga0068863_1003334132 | 203 |
| 206 | 3300005842 | Ga0068858_100040184 | Ga0068858_1000401844 | 203 |
| 207 | 3300005842 | Ga0068858_100101435 | Ga0068858_1001014352 | 203 |
| 208 | 3300005843 | Ga0068860_100035083 | Ga0068860_1000350832 | 203 |
| 209 | 3300005844 | Ga0068862_100005232 | Ga0068862_1000052328 | 203 |
| 210 | 3300006846 | Ga0075430_100021891 | Ga0075430_1000218913 | 203 |
| 211 | 3300006931 | Ga0097620_100076524 | Ga0097620_1000765242 | 203 |
| 212 | 3300006931 | Ga0097620_100086766 | Ga0097620_1000867663 | 203 |
| 213 | 3300009101 | Ga0105247_10000697 | Ga0105247_1000069719 | 203 |
| 214 | 3300009177 | Ga0105248_10240820 | Ga0105248_102408202 | 203 |
| 215 | 3300009545 | Ga0105237_10004434 | Ga0105237_100044349 | 203 |
| 216 | 3300009553 | Ga0105249_10050620 | Ga0105249_100506204 | 203 |
| 217 | 3300010375 | Ga0105239_11033450 | Ga0105239_110334502 | 203 |
| 218 | 3300020077 | Ga0206351_10024221 | Ga0206351_100242211 | 203 |
| 219 | 3300020080 | Ga0206350_11245833 | Ga0206350_112458331 | 203 |
| 220 | 3300021388 | Ga0213875_10000005 | Ga0213875_1000000512 | 203 |
| 221 | 3300025900 | Ga0207710_10000037 | Ga0207710_1000003765 | 203 |
| 222 | 3300025912 | Ga0207707_10010175 | Ga0207707_100101758 | 203 |
| 223 | 3300025914 | Ga0207671_10007177 | Ga0207671_100071774 | 203 |
| 224 | 3300025917 | Ga0207660_10152991 | Ga0207660_101529912 | 203 |
| 225 | 3300025920 | Ga0207649_10315830 | Ga0207649_103158302 | 203 |
| 226 | 3300025932 | Ga0207690_10305591 | Ga0207690_103055912 | 203 |
| 227 | 3300025933 | Ga0207706_10000470 | Ga0207706_1000047027 | 203 |
| 228 | 3300025936 | Ga0207670_10192187 | Ga0207670_101921871 | 203 |
| 229 | 3300025940 | Ga0207691_10304721 | Ga0207691_103047211 | 203 |
| 230 | 3300025945 | Ga0207679_10010271 | Ga0207679_100102713 | 203 |
| 231 | 3300025961 | Ga0207712_10388502 | Ga0207712_103885021 | 203 |
| 232 | 3300025972 | Ga0207668_10194840 | Ga0207668_101948402 | 203 |
| 233 | 3300026035 | Ga0207703_10086235 | Ga0207703_100862352 | 203 |
| 234 | 3300026088 | Ga0207641_10416798 | Ga0207641_104167982 | 203 |
| 235 | 3300026116 | Ga0207674_10002442 | Ga0207674_100024424 | 203 |
| 236 | 3300028380 | Ga0268265_10031196 | Ga0268265_100311961 | 203 |
| 237 | 3300028381 | Ga0268264_10044288 | Ga0268264_100442882 | 203 |
| 238 | 3300035118 | Ga0373954_0011200 | Ga0373954_0011200_1606_2265 | 203 |
| 239 | 3300035119 | Ga0373956_0008552 | Ga0373956_0008552_1552_2211 | 203 |
| 240 | 3300037471 | Ga0395905_0239429 | Ga0395905_0239429_628_1287 | 203 |
| 241 | 3300037853 | Ga0436364_0080170 | Ga0436364_0080170_8236_8946 | 203 |
| 242 | 3300046523 | Ga0495644_0196115 | Ga0495644_0196115_47_715 | 203 |
| 243 | 3300046539 | Ga0495621_0015224 | Ga0495621_0015224_1536_2204 | 203 |
| 244 | 3300046664 | Ga0495659_0064952 | Ga0495659_0064952_86_754 | 203 |
| 245 | 3300046684 | Ga0495669_0010995 | Ga0495669_0010995_938_1606 | 203 |
| 246 | 3300046691 | Ga0495670_0159116 | Ga0495670_0159116_109_777 | 203 |
| 247 | 3300048909 | Ga0496106_0050317 | Ga0496106_0050317_2383_3072 | 203 |
| 248 | 3300048910 | Ga0496107_0195875 | Ga0496107_0195875_665_1354 | 203 |
| 249 | 3300048924 | Ga0496121_0041210 | Ga0496121_0041210_1710_2399 | 203 |
| 250 | 3300049568 | Ga0501031_0244750 | Ga0501031_0244750_254_946 | 203 |
| 251 | 3300049570 | Ga0501033_0045176 | Ga0501033_0045176_2065_2757 | 203 |
| 252 | 3300049572 | Ga0501036_0006662 | Ga0501036_0006662_2169_2861 | 203 |
| 253 | 3300049573 | Ga0501037_0365707 | Ga0501037_0365707_254_946 | 203 |
| 254 | 3300049576 | Ga0501040_0005723 | Ga0501040_0005723_6032_6724 | 203 |
| 255 | 3300049577 | Ga0501041_0004893 | Ga0501041_0004893_563_1255 | 203 |
| 256 | 3300049578 | Ga0501042_0008729 | Ga0501042_0008729_1397_2089 | 203 |
| 257 | 3300049579 | Ga0501043_0171608 | Ga0501043_0171608_700_1392 | 203 |
| 258 | 3300049580 | Ga0501046_0161557 | Ga0501046_0161557_780_1472 | 203 |
| 259 | 3300049582 | Ga0501048_0062261 | Ga0501048_0062261_786_1478 | 203 |
| 260 | 3300049584 | Ga0501068_0069356 | Ga0501068_0069356_201_893 | 203 |
| 261 | 3300049586 | Ga0501070_0355666 | Ga0501070_0355666_413_1105 | 203 |
| 262 | 3300049589 | Ga0501073_0301781 | Ga0501073_0301781_33_725 | 203 |
| 263 | 3300049590 | Ga0501074_0058412 | Ga0501074_0058412_1725_2417 | 203 |
| 264 | 3300049591 | Ga0501075_0013226 | Ga0501075_0013226_4077_4769 | 203 |
| 265 | 3300049592 | Ga0501076_0002423 | Ga0501076_0002423_7679_8371 | 203 |
| 266 | 3300049593 | Ga0501077_0010675 | Ga0501077_0010675_452_1144 | 203 |
| 267 | 3300049741 | Ga0501079_0122479 | Ga0501079_0122479_631_1323 | 203 |
| 268 | 3300049742 | Ga0501080_0113435 | Ga0501080_0113435_345_1037 | 203 |
| 269 | 3300049743 | Ga0501081_0006872 | Ga0501081_0006872_1771_2463 | 203 |
| 270 | 3300049744 | Ga0501083_0021730 | Ga0501083_0021730_1237_1929 | 203 |
| 271 | 3300049824 | Ga0501045_0002990 | Ga0501045_0002990_6364_7056 | 203 |
| 272 | 3300050509 | nmdc:mga0qj67_2453_c1 | nmdc:mga0qj67_2453_c1_1914_2585 | 203 |
| 273 | 3300054114 | Ga0501084_0001133 | Ga0501084_0001133_14064_14756 | 203 |
| 274 | 3300061734 | Ga0530510_0030079 | Ga0530510_0030079_1115_1807 | 203 |
| 275 | 3300004799 | Ga0058863_10779178 | Ga0058863_107791781 | 204 |
| 276 | 3300005438 | Ga0070701_10036245 | Ga0070701_100362452 | 204 |
| 277 | 3300005471 | Ga0070698_100019178 | Ga0070698_1000191789 | 204 |
| 278 | 3300005530 | Ga0070679_100100302 | Ga0070679_1001003023 | 204 |
| 279 | 3300005536 | Ga0070697_100050808 | Ga0070697_1000508084 | 204 |
| 280 | 3300006847 | Ga0075431_100035497 | Ga0075431_1000354974 | 204 |
| 281 | 3300006847 | Ga0075431_100286369 | Ga0075431_1002863692 | 204 |
| 282 | 3300006852 | Ga0075433_10382710 | Ga0075433_103827102 | 204 |
| 283 | 3300007265 | Ga0099794_10037340 | Ga0099794_100373402 | 204 |
| 284 | 3300009147 | Ga0114129_10020671 | Ga0114129_1002067111 | 204 |
| 285 | 3300009147 | Ga0114129_10094788 | Ga0114129_100947885 | 204 |
| 286 | 3300020069 | Ga0197907_11248989 | Ga0197907_112489891 | 204 |
| 287 | 3300020075 | Ga0206349_1132621 | Ga0206349_11326214 | 204 |
| 288 | 3300020080 | Ga0206350_10685405 | Ga0206350_106854052 | 204 |
| 289 | 3300020081 | Ga0206354_11495242 | Ga0206354_114952422 | 204 |
| 290 | 3300020082 | Ga0206353_11048894 | Ga0206353_110488941 | 204 |
| 291 | 3300022467 | Ga0224712_10012729 | Ga0224712_100127292 | 204 |
| 292 | 3300022467 | Ga0224712_10083335 | Ga0224712_100833351 | 204 |
| 293 | 3300022467 | Ga0224712_10104203 | Ga0224712_101042031 | 204 |
| 294 | 3300025921 | Ga0207652_10600074 | Ga0207652_106000742 | 204 |
| 295 | 3300025922 | Ga0207646_10335998 | Ga0207646_103359982 | 204 |
| 296 | 3300027671 | Ga0209588_1028378 | Ga0209588_10283782 | 204 |
| 297 | 3300027907 | Ga0207428_10396966 | Ga0207428_103969661 | 204 |
| 298 | 3300037471 | Ga0395905_0108025 | Ga0395905_0108025_1394_2062 | 204 |
| 299 | 3300038443 | Ga0395901_1054315 | Ga0395901_1054315_65_733 | 204 |
| 300 | 3300039438 | Ga0436360_0278187 | Ga0436360_0278187_120_782 | 204 |
| 301 | 3300045051 | Ga0451576_0339457 | Ga0451576_0339457_290_961 | 204 |
| 302 | 3300050507 | nmdc:mga05p37_72406_c1 | nmdc:mga05p37_72406_c1_308_988 | 204 |
| 303 | 3300050510 | nmdc:mga06r32_234725_c1 | nmdc:mga06r32_234725_c1_704_1384 | 204 |
| 304 | 3300050511 | nmdc:mga08y16_364463_c1 | nmdc:mga08y16_364463_c1_377_1039 | 204 |
| 305 | 3300005330 | Ga0070690_100131547 | Ga0070690_1001315472 | 205 |
| 306 | 3300005340 | Ga0070689_100090183 | Ga0070689_1000901832 | 205 |
| 307 | 3300005354 | Ga0070675_100817993 | Ga0070675_1008179931 | 205 |
| 308 | 3300005617 | Ga0068859_100576971 | Ga0068859_1005769712 | 205 |
| 309 | 3300005842 | Ga0068858_100059959 | Ga0068858_1000599592 | 205 |
| 310 | 3300006931 | Ga0097620_100576957 | Ga0097620_1005769572 | 205 |
| 311 | 3300009147 | Ga0114129_11082664 | Ga0114129_110826641 | 205 |
| 312 | 3300009177 | Ga0105248_10149774 | Ga0105248_101497742 | 205 |
| 313 | 3300022467 | Ga0224712_10070910 | Ga0224712_100709103 | 205 |
| 314 | 3300026035 | Ga0207703_10123136 | Ga0207703_101231362 | 205 |
| 315 | 3300031824 | Ga0307413_10094534 | Ga0307413_100945341 | 205 |
| 316 | 3300049591 | Ga0501075_0213049 | Ga0501075_0213049_734_1405 | 205 |
| 317 | 3300049663 | Ga0501223_011532 | Ga0501223_011532_209_898 | 205 |
| 318 | 2162886006 | SwRhRL3b_contig_923896 | SwRhRL3b_0658.00001380 | 206 |
| 319 | 3300005289 | Ga0065704_10098548 | Ga0065704_100985483 | 206 |
| 320 | 3300005295 | Ga0065707_10004415 | Ga0065707_100044152 | 206 |
| 321 | 3300005354 | Ga0070675_100036437 | Ga0070675_1000364374 | 206 |
| 322 | 3300005366 | Ga0070659_100454389 | Ga0070659_1004543892 | 206 |
| 323 | 3300005434 | Ga0070709_10138752 | Ga0070709_101387521 | 206 |
| 324 | 3300005438 | Ga0070701_10146628 | Ga0070701_101466282 | 206 |
| 325 | 3300005439 | Ga0070711_100029555 | Ga0070711_1000295552 | 206 |
| 326 | 3300005456 | Ga0070678_100189761 | Ga0070678_1001897612 | 206 |
| 327 | 3300005458 | Ga0070681_10013537 | Ga0070681_100135372 | 206 |
| 328 | 3300005549 | Ga0070704_100099174 | Ga0070704_1000991742 | 206 |
| 329 | 3300005615 | Ga0070702_100052350 | Ga0070702_1000523502 | 206 |
| 330 | 3300005617 | Ga0068859_100025351 | Ga0068859_1000253516 | 206 |
| 331 | 3300005842 | Ga0068858_100297637 | Ga0068858_1002976372 | 206 |
| 332 | 3300005843 | Ga0068860_100027462 | Ga0068860_1000274625 | 206 |
| 333 | 3300006237 | Ga0097621_100150535 | Ga0097621_1001505353 | 206 |
| 334 | 3300006358 | Ga0068871_100082764 | Ga0068871_1000827643 | 206 |
| 335 | 3300006846 | Ga0075430_100791640 | Ga0075430_1007916401 | 206 |
| 336 | 3300006931 | Ga0097620_100025352 | Ga0097620_1000253524 | 206 |
| 337 | 3300009177 | Ga0105248_10216479 | Ga0105248_102164792 | 206 |
| 338 | 3300013100 | Ga0157373_10234560 | Ga0157373_102345602 | 206 |
| 339 | 3300013296 | Ga0157374_10129375 | Ga0157374_101293753 | 206 |
| 340 | 3300013308 | Ga0157375_10053593 | Ga0157375_100535931 | 206 |
| 341 | 3300014326 | Ga0157380_10329022 | Ga0157380_103290222 | 206 |
| 342 | 3300014745 | Ga0157377_10059509 | Ga0157377_100595092 | 206 |
| 343 | 3300020069 | Ga0197907_10092348 | Ga0197907_100923483 | 206 |
| 344 | 3300020082 | Ga0206353_11791449 | Ga0206353_117914491 | 206 |
| 345 | 3300022467 | Ga0224712_10018280 | Ga0224712_100182801 | 206 |
| 346 | 3300025906 | Ga0207699_10107436 | Ga0207699_101074361 | 206 |
| 347 | 3300025912 | Ga0207707_10011065 | Ga0207707_100110652 | 206 |
| 348 | 3300025916 | Ga0207663_10106793 | Ga0207663_101067932 | 206 |
| 349 | 3300025926 | Ga0207659_10000651 | Ga0207659_1000065113 | 206 |
| 350 | 3300025940 | Ga0207691_10017053 | Ga0207691_100170533 | 206 |
| 351 | 3300025941 | Ga0207711_10481317 | Ga0207711_104813172 | 206 |
| 352 | 3300025960 | Ga0207651_10138493 | Ga0207651_101384933 | 206 |
| 353 | 3300026035 | Ga0207703_10183334 | Ga0207703_101833342 | 206 |
| 354 | 3300026075 | Ga0207708_10089836 | Ga0207708_100898362 | 206 |
| 355 | 3300026095 | Ga0207676_10327558 | Ga0207676_103275582 | 206 |
| 356 | 3300026121 | Ga0207683_10092775 | Ga0207683_100927753 | 206 |
| 357 | 3300028381 | Ga0268264_10021088 | Ga0268264_100210882 | 206 |
| 358 | 3300031249 | Ga0265339_10096305 | Ga0265339_100963052 | 206 |
| 359 | 3300031250 | Ga0265331_10125352 | Ga0265331_101253522 | 206 |
| 360 | 3300031344 | Ga0265316_10259024 | Ga0265316_102590242 | 206 |
| 361 | 3300031731 | Ga0307405_10119229 | Ga0307405_101192292 | 206 |
| 362 | 3300031824 | Ga0307413_10014703 | Ga0307413_100147034 | 206 |
| 363 | 3300031903 | Ga0307407_10372549 | Ga0307407_103725491 | 206 |
| 364 | 3300031995 | Ga0307409_100036531 | Ga0307409_1000365312 | 206 |
| 365 | 3300032004 | Ga0307414_10019663 | Ga0307414_100196634 | 206 |
| 366 | 3300032005 | Ga0307411_10102383 | Ga0307411_101023833 | 206 |
| 367 | 3300035084 | Ga0373928_0062507 | Ga0373928_0062507_91_759 | 206 |
| 368 | 3300035398 | Ga0316574_0000413 | Ga0316574_0000413_1408_2094 | 206 |
| 369 | 3300035398 | Ga0316574_0040909 | Ga0316574_0040909_838_1533 | 206 |
| 370 | 3300045051 | Ga0451576_0550292 | Ga0451576_0550292_230_898 | 206 |
| 371 | 3300046664 | Ga0495659_0123841 | Ga0495659_0123841_138_806 | 206 |
| 372 | 3300048909 | Ga0496106_0811172 | Ga0496106_0811172_49_717 | 206 |
| 373 | 3300049515 | Ga0501292_022805 | Ga0501292_022805_20_724 | 206 |
| 374 | 3300049534 | Ga0501318_021808 | Ga0501318_021808_59_769 | 206 |
| 375 | 3300049656 | Ga0501209_061533 | Ga0501209_061533_163_876 | 206 |
| 376 | 3300049705 | Ga0501225_0046605 | Ga0501225_0046605_317_1030 | 206 |
| 377 | 3300050491 | nmdc:mga00v17_126265_c1 | nmdc:mga00v17_126265_c1_849_1544 | 206 |
| 378 | 3300050511 | nmdc:mga08y16_722542_c1 | nmdc:mga08y16_722542_c1_73_741 | 206 |
| 379 | 3300050515 | nmdc:mga0a205_283203_c1 | nmdc:mga0a205_283203_c1_517_1251 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u9y-assembly1.cif.gz_A | crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii | 0.7553 | 13 | 171 |
| 3lpn-assembly1.cif.gz_B | crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). | 0.7489 | 13 | 166 |
| 5hkf-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.7438 | 10 | 169 |
| 1wd5-assembly1.cif.gz_A | crystal structure of tt1426 from thermus thermophilus hb8 | 0.7397 | 4 | 197 |
| 5hki-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate | 0.7384 | 10 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wd5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9405 | 7 | 197 | 3.40.50.2020 |
| 1wd5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9093 | 7 | 197 | 3.40.50.2020 |
| af_Q54QU9_156_292_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7586 | 29 | 166 | 3.40.50.2020 |
| 1u9yA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7545 | 14 | 171 | 3.40.50.2020 |
| af_A0A0P0WCD3_31_176_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.751 | 12 | 56 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V6YD72-F1-model_v4 | deleted | 0.9782 | 103 | 200 |
|
| AF-A0A3D3T369-F1-model_v4 | Phosphoribosyltransferase | 0.9778 | 103 | 200 |
GO:0016757
|
| AF-A0A7V0Q5M7-F1-model_v4 | Phosphoribosyltransferase | 0.9764 | 107 | 200 |
GO:0016757
|
| AF-A0A2V5XFV8-F1-model_v4 | Phosphoribosyl transferase | 0.9707 | 105 | 200 |
GO:0016740
|
| AF-A0A1E4C3Z6-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9683 | 103 | 200 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar