F428166

General Info

Members Datasets Scaffolds Average Seq Length
378 269 376 128

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0272770|Ga0501074_0272770_239_658
Length 139
Sequence MAEATNSSKSPPVTSLRTPIARVRGLGSAKEGAAHWWAQRVTAVALVPLLLWFVASVVALTGAGQTVVAAWIGQPVHAILLVLLVGAGLYHAQLGLQVVIEDYVHTKWLKLISIIAIKFAAVVIVAATVFAVLKIAFAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
172 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
186 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
200 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
218 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
219 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
269 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.06
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 0
Rhizoplane 2.38
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1511188 2162886012 Bacteria 984
2 ARcpr5oldR_c002450 3300000041 Bacteria 1712
3 ARcpr5yngRDRAFT_c001786 3300000043 Bacteria 2302
4 ARCol0yngRDRAFT_1009461 3300000652 Bacteria 706
5 JGI25150J39212_1000313 3300002774 Bacteria 23995
6 JGI25151J46595_10065158 3300003187 Bacteria 1136
7 JGI25153J46596_10000027 3300003215 Bacteria 210760
8 JGI25153J46596_10017687 3300003215 Bacteria 2799
9 Ga0055526_1007689 3300003771 Bacteria 5541
10 Ga0055537_1001210 3300003773 Bacteria 10889
11 Ga0055537_1004639 3300003773 Bacteria 3882
12 Ga0055524_1000409 3300003775 Bacteria 36411
13 Ga0055536_1015850 3300003781 Bacteria 2554
14 Ga0055530_10000638 3300003791 Bacteria 30190
15 Ga0055530_10039525 3300003791 Bacteria 1164
16 Ga0055530_10048148 3300003791 Bacteria 1004
17 Ga0055540_1002114 3300003792 Bacteria 10857
18 Ga0055531_10000640 3300003794 Bacteria 30187
19 Ga0055531_10013791 3300003794 Bacteria 3699
20 Ga0055531_10063070 3300003794 Bacteria 893
21 Ga0055543_1019303 3300004625 Bacteria 1262
22 Ga0065165_1010107 3300005262 Bacteria 4134
23 Ga0065165_1017322 3300005262 Bacteria 2659
24 Ga0065712_10002984 3300005290 Bacteria 4356
25 Ga0065715_10112838 3300005293 Bacteria 2513
26 Ga0070658_10000172 3300005327 Bacteria 56478
27 Ga0070658_10000826 3300005327 Bacteria 26516
28 Ga0070683_100117637 3300005329 Bacteria 2509
29 Ga0070690_100003382 3300005330 Bacteria 8712
30 Ga0070670_100195175 3300005331 Bacteria 1758
31 Ga0068869_100019038 3300005334 Bacteria 4683
32 Ga0068869_100831397 3300005334 Bacteria 796
33 Ga0070666_10097905 3300005335 Bacteria 2020
34 Ga0070680_100171468 3300005336 Bacteria 1826
35 Ga0070680_100401871 3300005336 Bacteria 1168
36 Ga0070680_100593321 3300005336 Bacteria 951
37 Ga0070682_100074675 3300005337 Bacteria 2178
38 Ga0068868_100115536 3300005338 Bacteria 2185
39 Ga0070660_100000399 3300005339 Bacteria 28896
40 Ga0070660_101049614 3300005339 Bacteria 689
41 Ga0070689_100006225 3300005340 Bacteria 8237
42 Ga0070691_10858211 3300005341 Bacteria 557
43 Ga0070687_100033301 3300005343 Bacteria 2542
44 Ga0070661_100006458 3300005344 Bacteria 8085
45 Ga0070692_10016156 3300005345 Bacteria 3547
46 Ga0070692_10059896 3300005345 Bacteria 2003
47 Ga0070692_10073046 3300005345 Bacteria 1832
48 Ga0070668_100019966 3300005347 Bacteria 5050
49 Ga0070669_100022189 3300005353 Bacteria 4539
50 Ga0070675_100071797 3300005354 Bacteria 2873
51 Ga0070671_100425830 3300005355 Bacteria 1137
52 Ga0070674_100905620 3300005356 Bacteria 768
53 Ga0070673_100000430 3300005364 Bacteria 22151
54 Ga0070688_100060641 3300005365 Bacteria 2389
55 Ga0070659_100002584 3300005366 Bacteria 12872
56 Ga0070659_101594034 3300005366 Bacteria 583
57 Ga0070710_10628937 3300005437 Bacteria 750
58 Ga0070701_10013099 3300005438 Bacteria 3762
59 Ga0070705_100003246 3300005440 Bacteria 7991
60 Ga0070700_100461721 3300005441 Bacteria 968
61 Ga0070694_100123326 3300005444 Bacteria 1862
62 Ga0070678_100078523 3300005456 Bacteria 2494
63 Ga0070662_100026278 3300005457 Bacteria 4030
64 Ga0070662_100308214 3300005457 Bacteria 1288
65 Ga0070681_10001208 3300005458 Bacteria 22475
66 Ga0070681_10302878 3300005458 Bacteria 1508
67 Ga0068867_100016655 3300005459 Bacteria 5221
68 Ga0070685_10011323 3300005466 Bacteria 4671
69 Ga0070679_100002407 3300005530 Bacteria 16967
70 Ga0070679_100085690 3300005530 Bacteria 3137
71 Ga0070679_100361616 3300005530 Bacteria 1399
72 Ga0070679_100769939 3300005530 Bacteria 905
73 Ga0070679_101064721 3300005530 Bacteria 753
74 Ga0070684_100052756 3300005535 Bacteria 3537
75 Ga0070672_100035707 3300005543 Bacteria 3780
76 Ga0070686_100004718 3300005544 Bacteria 7517
77 Ga0070665_100058966 3300005548 Bacteria 3847
78 Ga0070704_101823568 3300005549 Bacteria 563
79 Ga0068855_100027732 3300005563 Bacteria 6776
80 Ga0068855_100305030 3300005563 Bacteria 1763
81 Ga0070664_100003466 3300005564 Bacteria 12739
82 Ga0070664_100189358 3300005564 Bacteria 1833
83 Ga0068857_100029446 3300005577 Bacteria 4845
84 Ga0068857_102405987 3300005577 Bacteria 517
85 Ga0068854_101592235 3300005578 Bacteria 595
86 Ga0070702_100153313 3300005615 Bacteria 1482
87 Ga0068859_100002119 3300005617 Bacteria 20213
88 Ga0068859_100002396 3300005617 Bacteria 19088
89 Ga0068864_100052238 3300005618 Bacteria 3522
90 Ga0068861_100000678 3300005719 Bacteria 20317
91 Ga0068861_100037252 3300005719 Bacteria 3615
92 Ga0068861_100336678 3300005719 Bacteria 1319
93 Ga0068870_10010534 3300005840 Bacteria 4253
94 Ga0068870_10447761 3300005840 Bacteria 851
95 Ga0068863_100001397 3300005841 Bacteria 23940
96 Ga0068858_100034877 3300005842 Bacteria 4667
97 Ga0068858_100451818 3300005842 Bacteria 1238
98 Ga0068860_100054783 3300005843 Bacteria 3791
99 Ga0068862_100007923 3300005844 Bacteria 8787
100 Ga0068862_100012284 3300005844 Bacteria 7081
101 Ga0075362_10291026 3300006177 Bacteria 809
102 Ga0097621_100062474 3300006237 Bacteria 3058
103 Ga0068871_100116256 3300006358 Bacteria 2255
104 Ga0068871_101051577 3300006358 Bacteria 760
105 Ga0075428_100016530 3300006844 Bacteria 8148
106 Ga0075430_100076166 3300006846 Bacteria 2811
107 Ga0075431_100015034 3300006847 Bacteria 7837
108 Ga0075431_100019809 3300006847 Bacteria 6868
109 Ga0075431_101132371 3300006847 Bacteria 747
110 Ga0075434_100552943 3300006871 Bacteria 1170
111 Ga0075429_100007843 3300006880 Bacteria 9274
112 Ga0068865_100138739 3300006881 Bacteria 1831
113 Ga0097620_100002119 3300006931 Bacteria 20213
114 Ga0105250_10104944 3300009092 Bacteria 1155
115 Ga0105240_10035052 3300009093 Bacteria 6471
116 Ga0105240_10128165 3300009093 Bacteria 3047
117 Ga0105240_11180889 3300009093 Bacteria 811
118 Ga0111539_10018303 3300009094 Bacteria 8678
119 Ga0111539_10096186 3300009094 Bacteria 3478
120 Ga0111539_10422800 3300009094 Bacteria 1552
121 Ga0111539_11526724 3300009094 Bacteria 775
122 Ga0105245_12435910 3300009098 Bacteria 577
123 Ga0105245_13054126 3300009098 Bacteria 519
124 Ga0114129_10003651 3300009147 Bacteria 21648
125 Ga0105243_13071824 3300009148 Bacteria 506
126 Ga0105248_10041090 3300009177 Bacteria 5184
127 Ga0105237_12153969 3300009545 Unclassified 567
128 Ga0105238_10002428 3300009551 Bacteria 18694
129 Ga0105238_11051042 3300009551 Bacteria 836
130 Ga0105249_10037769 3300009553 Bacteria 4382
131 Ga0105249_10102879 3300009553 Bacteria 2689
132 Ga0105239_10246697 3300010375 Bacteria 2005
133 Ga0105239_10440405 3300010375 Bacteria 1477
134 Ga0105246_10591389 3300011119 Bacteria 957
135 Ga0157373_10437037 3300013100 Bacteria 940
136 Ga0157370_10001569 3300013104 Bacteria 28272
137 Ga0157370_10002636 3300013104 Bacteria 21556
138 Ga0157374_10399758 3300013296 Bacteria 1370
139 Ga0157374_10699475 3300013296 Bacteria 1027
140 Ga0157378_10397996 3300013297 Bacteria 1356
141 Ga0157378_11139795 3300013297 Bacteria 818
142 Ga0163162_10178353 3300013306 Bacteria 2250
143 Ga0157372_10257677 3300013307 Bacteria 2025
144 Ga0157372_11014697 3300013307 Bacteria 961
145 Ga0157375_10084022 3300013308 Bacteria 3231
146 Ga0163163_10003527 3300014325 Bacteria 13287
147 Ga0157379_10091536 3300014968 Bacteria 2728
148 Ga0157379_10165218 3300014968 Bacteria 1997
149 Ga0157376_10079286 3300014969 Bacteria 2815
150 Ga0157376_10626850 3300014969 Bacteria 1073
151 Ga0213874_10030436 3300021377 Bacteria 1555
152 Ga0213876_10000486 3300021384 Bacteria 31448
153 Ga0207425_1000005 3300025245 Bacteria 900502
154 Ga0207425_1053617 3300025245 Bacteria 729
155 Ga0209129_1002457 3300025258 Bacteria 9079
156 Ga0209565_1000007 3300025263 Bacteria 784361
157 Ga0209565_1000231 3300025263 Bacteria 61384
158 Ga0209673_1006153 3300025273 Bacteria 5879
159 Ga0209673_1035094 3300025273 Bacteria 1506
160 Ga0209675_1005570 3300025291 Bacteria 5244
161 Ga0209675_1040024 3300025291 Bacteria 1034
162 Ga0209676_1021147 3300025292 Bacteria 2192
163 Ga0209025_1000515 3300025294 Bacteria 73801
164 Ga0209564_1000619 3300025295 Bacteria 54397
165 Ga0209758_1000002 3300025297 Bacteria 1400310
166 Ga0209758_1058536 3300025297 Bacteria 1288
167 Ga0209050_1000001 3300025298 Bacteria 3563507
168 Ga0209050_1000010 3300025298 Bacteria 980454
169 Ga0209050_1000483 3300025298 Bacteria 69796
170 Ga0209050_1004560 3300025298 Bacteria 9297
171 Ga0209256_1000008 3300025299 Bacteria 975723
172 Ga0207426_1068947 3300025302 Bacteria 992
173 Ga0209051_1000817 3300025303 Bacteria 32251
174 Ga0209257_1000027 3300025304 Bacteria 703541
175 Ga0209257_1000820 3300025304 Bacteria 45043
176 Ga0209257_1020410 3300025304 Bacteria 2450
177 Ga0207692_10718564 3300025898 Unclassified 649
178 Ga0207688_11013213 3300025901 Bacteria 525
179 Ga0207680_10071056 3300025903 Bacteria 2157
180 Ga0207645_10009699 3300025907 Bacteria 6651
181 Ga0207645_11184858 3300025907 Bacteria 513
182 Ga0207643_10006565 3300025908 Bacteria 6236
183 Ga0207643_10057239 3300025908 Bacteria 2219
184 Ga0207705_10000002 3300025909 Bacteria 2046852
185 Ga0207705_10000711 3300025909 Bacteria 27463
186 Ga0207707_10040851 3300025912 Bacteria 4050
187 Ga0207707_10707565 3300025912 Bacteria 845
188 Ga0207707_10897367 3300025912 Bacteria 733
189 Ga0207695_10080851 3300025913 Bacteria 3290
190 Ga0207671_11571740 3300025914 Unclassified 506
191 Ga0207660_10148084 3300025917 Bacteria 1801
192 Ga0207660_11007599 3300025917 Bacteria 679
193 Ga0207660_11174918 3300025917 Bacteria 625
194 Ga0207662_10019154 3300025918 Bacteria 3890
195 Ga0207657_10000579 3300025919 Bacteria 38919
196 Ga0207652_10001336 3300025921 Bacteria 21912
197 Ga0207652_10834022 3300025921 Bacteria 817
198 Ga0207681_10015049 3300025923 Bacteria 4822
199 Ga0207681_10186579 3300025923 Bacteria 1583
200 Ga0207694_10009783 3300025924 Bacteria 7236
201 Ga0207650_10267094 3300025925 Bacteria 1389
202 Ga0207659_10007508 3300025926 Bacteria 6710
203 Ga0207687_11959858 3300025927 Bacteria 500
204 Ga0207644_10483133 3300025931 Bacteria 1020
205 Ga0207690_10048394 3300025932 Bacteria 2827
206 Ga0207690_10459802 3300025932 Bacteria 1024
207 Ga0207690_11619554 3300025932 Unclassified 541
208 Ga0207706_10019088 3300025933 Bacteria 6168
209 Ga0207706_10230528 3300025933 Bacteria 1620
210 Ga0207709_10562890 3300025935 Bacteria 898
211 Ga0207670_10003454 3300025936 Bacteria 8378
212 Ga0207669_10137689 3300025937 Bacteria 1689
213 Ga0207704_10523786 3300025938 Bacteria 959
214 Ga0207691_10136961 3300025940 Bacteria 2159
215 Ga0207711_10008818 3300025941 Bacteria 8433
216 Ga0207689_10101227 3300025942 Bacteria 2367
217 Ga0207661_10188182 3300025944 Bacteria 1808
218 Ga0207679_10003913 3300025945 Bacteria 9242
219 Ga0207679_10646388 3300025945 Bacteria 956
220 Ga0207667_10300951 3300025949 Bacteria 1639
221 Ga0207651_10015594 3300025960 Bacteria 4422
222 Ga0207712_10061997 3300025961 Bacteria 2656
223 Ga0207712_10108351 3300025961 Bacteria 2079
224 Ga0207668_10012496 3300025972 Bacteria 5199
225 Ga0207658_10184706 3300025986 Bacteria 1728
226 Ga0207677_10178570 3300026023 Bacteria 1668
227 Ga0207703_10020059 3300026035 Bacteria 5224
228 Ga0207703_10605693 3300026035 Bacteria 1036
229 Ga0207708_10054456 3300026075 Bacteria 3050
230 Ga0207708_10068905 3300026075 Bacteria 2708
231 Ga0207702_10222570 3300026078 Bacteria 1759
232 Ga0207641_10002890 3300026088 Bacteria 15549
233 Ga0207648_10018924 3300026089 Bacteria 6221
234 Ga0207648_10511495 3300026089 Bacteria 1100
235 Ga0207676_10008243 3300026095 Bacteria 7412
236 Ga0207674_10037824 3300026116 Bacteria 5014
237 Ga0207674_10165238 3300026116 Bacteria 2167
238 Ga0207675_100000584 3300026118 Bacteria 35641
239 Ga0207675_100058985 3300026118 Bacteria 3582
240 Ga0207675_100227659 3300026118 Bacteria 1798
241 Ga0207683_10075714 3300026121 Bacteria 2979
242 Ga0207428_10017747 3300027907 Bacteria 6103
243 Ga0207428_10439171 3300027907 Bacteria 952
244 Ga0268266_10192746 3300028379 Bacteria 1861
245 Ga0268265_10000723 3300028380 Bacteria 32332
246 Ga0268265_10003337 3300028380 Bacteria 11612
247 Ga0268264_10659216 3300028381 Bacteria 1036
248 Ga0265338_10646345 3300028800 Bacteria 733
249 Ga0314311_1000754 3300030733 Bacteria 720
250 Ga0316182_1200252 3300030745 Bacteria 658
251 Ga0307513_10032872 3300031456 Bacteria 5841
252 Ga0307513_10810740 3300031456 Bacteria 642
253 Ga0307509_10000675 3300031507 Bacteria 58150
254 Ga0307408_100019209 3300031548 Bacteria 4599
255 Ga0307408_100704643 3300031548 Bacteria 908
256 Ga0316579_10114115 3300031691 Bacteria 1297
257 Ga0316579_10508470 3300031691 Bacteria 583
258 Ga0265314_10294784 3300031711 Bacteria 912
259 Ga0316576_10109429 3300031727 Bacteria 2070
260 Ga0316578_10106601 3300031728 Bacteria 1682
261 Ga0316577_10118140 3300031733 Bacteria 1489
262 Ga0307406_10132645 3300031901 Bacteria 1751
263 Ga0307412_10404766 3300031911 Bacteria 1112
264 Ga0307416_100037362 3300032002 Bacteria 3736
265 Ga0307415_101596220 3300032126 Bacteria 627
266 Ga0307415_102473585 3300032126 Bacteria 511
267 Ga0316585_10038597 3300032137 Bacteria 1518
268 Ga0316593_10409011 3300032168 Unclassified 525
269 Ga0316592_1011707 3300033524 Bacteria 1788
270 Ga0316596_1008866 3300033541 Bacteria 2406
271 Ga0316596_1080595 3300033541 Bacteria 875
272 Ga0373958_0002274 3300034819 Bacteria 2673
273 Ga0373954_0352539 3300035118 Unclassified 727
274 Ga0316574_0017337 3300035398 Bacteria 4214
275 Ga0373931_0231781 3300035691 Bacteria 1116
276 Ga0373933_0370517 3300035724 Bacteria 932
277 Ga0316582_0067581 3300036647 Bacteria 2306
278 Ga0316584_0009771 3300036712 Bacteria 6675
279 Ga0316584_1146601 3300036712 Unclassified 514
280 Ga0395899_0026316 3300037312 Bacteria 4389
281 Ga0395900_0011340 3300037418 Bacteria 9118
282 Ga0395900_0172047 3300037418 Bacteria 2204
283 Ga0395900_1468451 3300037418 Bacteria 594
284 Ga0395901_0058907 3300038443 Bacteria 3995
285 Ga0400491_25494 3300038727 Bacteria 1099
286 Ga0400483_204542 3300039062 Bacteria 1677
287 Ga0400483_276003 3300039062 Unclassified 1033
288 Ga0436365_1047135 3300039437 Bacteria 31623
289 Ga0436363_0593086 3300039450 Bacteria 2040
290 Ga0439436_0018298 3300041404 Bacteria 2094
291 Ga0439436_0036247 3300041404 Bacteria 1423
292 Ga0439447_044256 3300041407 Bacteria 1077
293 Ga0439461_0002704 3300041410 Bacteria 2858
294 Ga0439461_0003451 3300041410 Bacteria 2600
295 Ga0439465_0023416 3300041413 Bacteria 1943
296 Ga0439465_0096710 3300041413 Bacteria 1015
297 Ga0451800_0367495 3300041459 Bacteria 2184
298 Ga0451807_0991499 3300041486 Bacteria 512
299 Ga0451807_2334594 3300041486 Bacteria 798
300 Ga0439431_0003924 3300041997 Bacteria 3281
301 Ga0439442_066775 3300042002 Bacteria 764
302 Ga0439445_0008866 3300042004 Bacteria 2362
303 Ga0439445_0178417 3300042004 Bacteria 623
304 Ga0439445_0242166 3300042004 Bacteria 537
305 Ga0439448_0382067 3300042005 Unclassified 503
306 Ga0439432_000489 3300042006 Bacteria 14770
307 Ga0439452_044218 3300042010 Bacteria 1039
308 Ga0439457_007031 3300042014 Bacteria 2717
309 Ga0439462_0003560 3300042015 Bacteria 3746
310 Ga0439462_0041099 3300042015 Bacteria 1234
311 Ga0450920_018568 3300042122 Bacteria 1332
312 Ga0450910_041856 3300042147 Bacteria 742
313 Ga0450909_005567 3300042185 Bacteria 1812
314 Ga0439434_0015129 3300042435 Bacteria 2299
315 Ga0439434_0018363 3300042435 Bacteria 2093
316 Ga0451577_0066116 3300042876 Bacteria 3225
317 Ga0453684_0006801 3300044712 Bacteria 21511
318 Ga0451576_1399447 3300045051 Bacteria 728
319 Ga0495627_029314 3300046453 Bacteria 1752
320 Ga0495638_0126306 3300046460 Bacteria 1507
321 Ga0495651_0064578 3300046462 Bacteria 2797
322 Ga0495608_0099311 3300046511 Bacteria 1878
323 Ga0495628_0246388 3300046516 Unclassified 1335
324 Ga0495652_0264235 3300046529 Bacteria 1269
325 Ga0495635_0717180 3300046663 Unclassified 648
326 Ga0495657_0078357 3300046675 Bacteria 2142
327 Ga0495670_0000165 3300046691 Bacteria 28951
328 Ga0495600_0104285 3300046809 Bacteria 1848
329 Ga0495604_0093547 3300047317 Bacteria 2224
330 Ga0495636_0329616 3300047318 Bacteria 718
331 Ga0495681_0183554 3300047470 Bacteria 858
332 Ga0495602_0026310 3300048088 Bacteria 5614
333 Ga0496101_0163179 3300048904 Bacteria 1710
334 Ga0496106_0186111 3300048909 Bacteria 1650
335 Ga0496108_0355893 3300048911 Bacteria 1278
336 Ga0496114_0162790 3300048917 Bacteria 1941
337 Ga0496115_0000817 3300048918 Bacteria 22834
338 Ga0496115_0447540 3300048918 Unclassified 1044
339 Ga0501298_005599 3300049521 Bacteria 2022
340 Ga0501043_1033649 3300049579 Bacteria 583
341 Ga0501047_0356795 3300049581 Bacteria 1298
342 Ga0501070_0379689 3300049586 Bacteria 1145
343 Ga0501073_0191870 3300049589 Bacteria 1414
344 Ga0501074_0158923 3300049590 Bacteria 1614
345 Ga0501074_0272770 3300049590 Bacteria 1203
346 Ga0501239_005984 3300049672 Bacteria 1239
347 Ga0501249_012762 3300049679 Bacteria 1779
348 Ga0501225_0185928 3300049705 Bacteria 652
349 Ga0501083_0327374 3300049744 Bacteria 996
350 Ga0501083_0555199 3300049744 Bacteria 747
351 Ga0501241_012359 3300049758 Bacteria 1552
352 nmdc:mga03683_462310_c1 3300050489 Bacteria 611
353 nmdc:mga05p37_12919_c1 3300050507 Bacteria 9988
354 nmdc:mga09592_1753_c1 3300050508 Bacteria 17437
355 nmdc:mga09592_323043_c1 3300050508 Bacteria 1337
356 nmdc:mga09592_374784_c1 3300050508 Bacteria 1231
357 nmdc:mga0qj67_5998_c1 3300050509 Bacteria 8905
358 nmdc:mga06r32_173362_c1 3300050510 Bacteria 2141
359 nmdc:mga06r32_21720_c1 3300050510 Bacteria 5927
360 nmdc:mga06r32_3866_c1 3300050510 Bacteria 13403
361 nmdc:mga06r32_511616_c1 3300050510 Bacteria 1177
362 nmdc:mga08y16_21928_c1 3300050511 Bacteria 6742
363 nmdc:mga08y16_70105_c1 3300050511 Bacteria 3654
364 nmdc:mga08y16_92069_c1 3300050511 Bacteria 3159
365 nmdc:mga08y16_934941_c1 3300050511 Bacteria 851
366 nmdc:mga0n895_91673_c1 3300050512 Bacteria 3041
367 nmdc:mga0a205_574665_c1 3300050515 Bacteria 981
368 Ga0495601_0131456 3300053077 Bacteria 1630
369 Ga0495595_0084192 3300053084 Bacteria 1519
370 Ga0500643_014433 3300053087 Bacteria 2746
371 Ga0500566_0004958 3300053094 Bacteria 7929
372 Ga0500658_0067635 3300053134 Bacteria 1500
373 Ga0500568_0007329 3300053139 Bacteria 5423
374 Ga0500577_0057929 3300053142 Bacteria 1480
375 Ga0500577_0406207 3300053142 Bacteria 596
376 Ga0500588_0413387 3300053146 Bacteria 514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0006801 Ga0453684_0006801_13455_13838 113
2 3300013297 Ga0157378_11139795 Ga0157378_111397952 116
3 3300013307 Ga0157372_11014697 Ga0157372_110146972 116
4 3300005356 Ga0070674_100905620 Ga0070674_1009056202 120
5 3300049521 Ga0501298_005599 Ga0501298_005599_419_787 122
6 3300049672 Ga0501239_005984 Ga0501239_005984_92_460 122
7 3300049679 Ga0501249_012762 Ga0501249_012762_1321_1689 122
8 3300005327 Ga0070658_10000826 Ga0070658_1000082622 123
9 3300009093 Ga0105240_10035052 Ga0105240_100350528 123
10 3300010375 Ga0105239_10246697 Ga0105239_102466971 123
11 3300013104 Ga0157370_10002636 Ga0157370_1000263610 123
12 3300025909 Ga0207705_10000711 Ga0207705_1000071115 123
13 3300035118 Ga0373954_0352539 Ga0373954_0352539_109_480 123
14 3300035724 Ga0373933_0370517 Ga0373933_0370517_402_773 123
15 3300037418 Ga0395900_0172047 Ga0395900_0172047_1313_1684 123
16 3300046462 Ga0495651_0064578 Ga0495651_0064578_999_1370 123
17 3300046511 Ga0495608_0099311 Ga0495608_0099311_381_752 123
18 3300046516 Ga0495628_0246388 Ga0495628_0246388_440_811 123
19 3300046529 Ga0495652_0264235 Ga0495652_0264235_640_1011 123
20 3300046663 Ga0495635_0717180 Ga0495635_0717180_142_513 123
21 3300046675 Ga0495657_0078357 Ga0495657_0078357_1038_1409 123
22 3300047317 Ga0495604_0093547 Ga0495604_0093547_861_1232 123
23 3300048088 Ga0495602_0026310 Ga0495602_0026310_843_1214 123
24 3300053077 Ga0495601_0131456 Ga0495601_0131456_981_1352 123
25 3300053084 Ga0495595_0084192 Ga0495595_0084192_786_1157 123
26 iso_pu_bacteria 2643221622 2644125513 123
27 iso_pu_bacteria 2885429604 2885430456 123
28 3300009093 Ga0105240_11180889 Ga0105240_111808892 124
29 3300005530 Ga0070679_100085690 Ga0070679_1000856903 125
30 3300005563 Ga0068855_100027732 Ga0068855_1000277329 125
31 3300009094 Ga0111539_11526724 Ga0111539_115267242 125
32 3300009551 Ga0105238_10002428 Ga0105238_100024284 125
33 3300025917 Ga0207660_11174918 Ga0207660_111749182 125
34 3300025924 Ga0207694_10009783 Ga0207694_100097833 125
35 3300031456 Ga0307513_10032872 Ga0307513_100328724 125
36 3300031456 Ga0307513_10810740 Ga0307513_108107402 125
37 3300041486 Ga0451807_2334594 Ga0451807_2334594_344_751 125
38 3300046809 Ga0495600_0104285 Ga0495600_0104285_1055_1447 125
39 3300049705 Ga0501225_0185928 Ga0501225_0185928_129_512 125
40 3300049744 Ga0501083_0555199 Ga0501083_0555199_83_463 125
41 3300050511 nmdc:mga08y16_934941_c1 nmdc:mga08y16_934941_c1_156_533 125
42 3300005336 Ga0070680_100171468 Ga0070680_1001714683 126
43 3300005437 Ga0070710_10628937 Ga0070710_106289372 126
44 3300005458 Ga0070681_10001208 Ga0070681_100012084 126
45 3300005530 Ga0070679_100002407 Ga0070679_10000240714 126
46 3300005530 Ga0070679_100769939 Ga0070679_1007699391 126
47 3300005563 Ga0068855_100305030 Ga0068855_1003050303 126
48 3300005578 Ga0068854_101592235 Ga0068854_1015922351 126
49 3300005842 Ga0068858_100451818 Ga0068858_1004518182 126
50 3300006358 Ga0068871_101051577 Ga0068871_1010515772 126
51 3300009093 Ga0105240_10128165 Ga0105240_101281652 126
52 3300009545 Ga0105237_12153969 Ga0105237_121539691 126
53 3300013100 Ga0157373_10437037 Ga0157373_104370372 126
54 3300013104 Ga0157370_10001569 Ga0157370_1000156910 126
55 3300013296 Ga0157374_10399758 Ga0157374_103997583 126
56 3300013307 Ga0157372_10257677 Ga0157372_102576772 126
57 3300025898 Ga0207692_10718564 Ga0207692_107185642 126
58 3300025912 Ga0207707_10040851 Ga0207707_100408512 126
59 3300025912 Ga0207707_10707565 Ga0207707_107075652 126
60 3300025913 Ga0207695_10080851 Ga0207695_100808514 126
61 3300025914 Ga0207671_11571740 Ga0207671_115717401 126
62 3300025917 Ga0207660_10148084 Ga0207660_101480842 126
63 3300025917 Ga0207660_11007599 Ga0207660_110075992 126
64 3300025921 Ga0207652_10001336 Ga0207652_1000133611 126
65 3300025921 Ga0207652_10834022 Ga0207652_108340222 126
66 3300025932 Ga0207690_10459802 Ga0207690_104598021 126
67 3300025949 Ga0207667_10300951 Ga0207667_103009511 126
68 3300026035 Ga0207703_10605693 Ga0207703_106056932 126
69 3300026078 Ga0207702_10222570 Ga0207702_102225703 126
70 3300031691 Ga0316579_10114115 Ga0316579_101141152 126
71 3300031728 Ga0316578_10106601 Ga0316578_101066012 126
72 3300032168 Ga0316593_10409011 Ga0316593_104090112 126
73 3300033524 Ga0316592_1011707 Ga0316592_10117072 126
74 3300033541 Ga0316596_1008866 Ga0316596_10088662 126
75 3300036712 Ga0316584_1146601 Ga0316584_1146601_106_486 126
76 3300037312 Ga0395899_0026316 Ga0395899_0026316_2392_2772 126
77 3300037418 Ga0395900_0011340 Ga0395900_0011340_4762_5142 126
78 3300037418 Ga0395900_1468451 Ga0395900_1468451_135_515 126
79 3300038443 Ga0395901_0058907 Ga0395901_0058907_2683_3063 126
80 3300038727 Ga0400491_25494 Ga0400491_25494_155_535 126
81 3300039062 Ga0400483_204542 Ga0400483_204542_154_534 126
82 3300039062 Ga0400483_276003 Ga0400483_276003_447_827 126
83 3300042876 Ga0451577_0066116 Ga0451577_0066116_2700_3083 126
84 3300048918 Ga0496115_0447540 Ga0496115_0447540_607_996 126
85 3300049579 Ga0501043_1033649 Ga0501043_1033649_28_408 126
86 3300049581 Ga0501047_0356795 Ga0501047_0356795_250_630 126
87 3300049586 Ga0501070_0379689 Ga0501070_0379689_280_672 126
88 3300049589 Ga0501073_0191870 Ga0501073_0191870_285_677 126
89 3300049590 Ga0501074_0158923 Ga0501074_0158923_745_1137 126
90 3300049590 Ga0501074_0272770 Ga0501074_0272770_239_658 126
91 3300000041 ARcpr5oldR_c002450 ARcpr5oldR_0024503 127
92 3300000043 ARcpr5yngRDRAFT_c001786 ARcpr5yngRDRAFT_0017862 127
93 3300000652 ARCol0yngRDRAFT_1009461 ARCol0yngRDRAFT_10094611 127
94 3300002774 JGI25150J39212_1000313 JGI25150J39212_10003136 127
95 3300003187 JGI25151J46595_10065158 JGI25151J46595_100651583 127
96 3300003215 JGI25153J46596_10000027 JGI25153J46596_10000027158 127
97 3300003215 JGI25153J46596_10017687 JGI25153J46596_100176874 127
98 3300003771 Ga0055526_1007689 Ga0055526_10076897 127
99 3300003773 Ga0055537_1001210 Ga0055537_100121013 127
100 3300003773 Ga0055537_1004639 Ga0055537_10046392 127
101 3300003775 Ga0055524_1000409 Ga0055524_100040933 127
102 3300003781 Ga0055536_1015850 Ga0055536_10158502 127
103 3300003791 Ga0055530_10000638 Ga0055530_1000063831 127
104 3300003791 Ga0055530_10039525 Ga0055530_100395252 127
105 3300003791 Ga0055530_10048148 Ga0055530_100481482 127
106 3300003792 Ga0055540_1002114 Ga0055540_10021144 127
107 3300003794 Ga0055531_10000640 Ga0055531_100006402 127
108 3300003794 Ga0055531_10013791 Ga0055531_100137914 127
109 3300003794 Ga0055531_10063070 Ga0055531_100630701 127
110 3300004625 Ga0055543_1019303 Ga0055543_10193031 127
111 3300005262 Ga0065165_1010107 Ga0065165_10101074 127
112 3300005262 Ga0065165_1017322 Ga0065165_10173222 127
113 3300005327 Ga0070658_10000172 Ga0070658_1000017245 127
114 3300005339 Ga0070660_100000399 Ga0070660_1000003994 127
115 3300005345 Ga0070692_10016156 Ga0070692_100161565 127
116 3300005366 Ga0070659_100002584 Ga0070659_1000025848 127
117 3300005577 Ga0068857_102405987 Ga0068857_1024059872 127
118 3300005617 Ga0068859_100002396 Ga0068859_1000023964 127
119 3300005719 Ga0068861_100000678 Ga0068861_1000006783 127
120 3300006177 Ga0075362_10291026 Ga0075362_102910262 127
121 3300021377 Ga0213874_10030436 Ga0213874_100304361 127
122 3300021384 Ga0213876_10000486 Ga0213876_100004868 127
123 3300025245 Ga0207425_1000005 Ga0207425_1000005246 127
124 3300025245 Ga0207425_1053617 Ga0207425_10536172 127
125 3300025258 Ga0209129_1002457 Ga0209129_10024579 127
126 3300025263 Ga0209565_1000007 Ga0209565_1000007381 127
127 3300025263 Ga0209565_1000231 Ga0209565_100023128 127
128 3300025273 Ga0209673_1006153 Ga0209673_10061534 127
129 3300025273 Ga0209673_1035094 Ga0209673_10350942 127
130 3300025291 Ga0209675_1005570 Ga0209675_10055703 127
131 3300025291 Ga0209675_1040024 Ga0209675_10400242 127
132 3300025292 Ga0209676_1021147 Ga0209676_10211473 127
133 3300025294 Ga0209025_1000515 Ga0209025_100051545 127
134 3300025295 Ga0209564_1000619 Ga0209564_100061931 127
135 3300025297 Ga0209758_1000002 Ga0209758_10000021098 127
136 3300025297 Ga0209758_1058536 Ga0209758_10585362 127
137 3300025298 Ga0209050_1000001 Ga0209050_10000011086 127
138 3300025298 Ga0209050_1000010 Ga0209050_1000010791 127
139 3300025298 Ga0209050_1000483 Ga0209050_100048337 127
140 3300025298 Ga0209050_1004560 Ga0209050_10045603 127
141 3300025299 Ga0209256_1000008 Ga0209256_1000008223 127
142 3300025302 Ga0207426_1068947 Ga0207426_10689472 127
143 3300025303 Ga0209051_1000817 Ga0209051_100081719 127
144 3300025304 Ga0209257_1000027 Ga0209257_1000027433 127
145 3300025304 Ga0209257_1000820 Ga0209257_100082035 127
146 3300025304 Ga0209257_1020410 Ga0209257_10204102 127
147 3300025909 Ga0207705_10000002 Ga0207705_10000002653 127
148 3300025919 Ga0207657_10000579 Ga0207657_1000057941 127
149 3300025932 Ga0207690_10048394 Ga0207690_100483942 127
150 3300026118 Ga0207675_100000584 Ga0207675_10000058437 127
151 3300030733 Ga0314311_1000754 Ga0314311_10007541 127
152 3300030745 Ga0316182_1200252 Ga0316182_12002522 127
153 3300031691 Ga0316579_10508470 Ga0316579_105084702 127
154 3300031727 Ga0316576_10109429 Ga0316576_101094292 127
155 3300031733 Ga0316577_10118140 Ga0316577_101181403 127
156 3300032137 Ga0316585_10038597 Ga0316585_100385972 127
157 3300033541 Ga0316596_1080595 Ga0316596_10805952 127
158 3300035398 Ga0316574_0017337 Ga0316574_0017337_1672_2055 127
159 3300036647 Ga0316582_0067581 Ga0316582_0067581_108_491 127
160 3300036712 Ga0316584_0009771 Ga0316584_0009771_4998_5381 127
161 3300039437 Ga0436365_1047135 Ga0436365_1047135_24719_25111 127
162 3300039450 Ga0436363_0593086 Ga0436363_0593086_1580_1966 127
163 3300041404 Ga0439436_0018298 Ga0439436_0018298_1202_1591 127
164 3300041404 Ga0439436_0036247 Ga0439436_0036247_775_1164 127
165 3300041407 Ga0439447_044256 Ga0439447_044256_415_804 127
166 3300041410 Ga0439461_0002704 Ga0439461_0002704_1060_1449 127
167 3300041410 Ga0439461_0003451 Ga0439461_0003451_1363_1752 127
168 3300041413 Ga0439465_0023416 Ga0439465_0023416_39_428 127
169 3300041413 Ga0439465_0096710 Ga0439465_0096710_342_731 127
170 3300041459 Ga0451800_0367495 Ga0451800_0367495_517_903 127
171 3300041486 Ga0451807_0991499 Ga0451807_0991499_78_464 127
172 3300041997 Ga0439431_0003924 Ga0439431_0003924_179_568 127
173 3300042002 Ga0439442_066775 Ga0439442_066775_294_683 127
174 3300042004 Ga0439445_0008866 Ga0439445_0008866_158_547 127
175 3300042004 Ga0439445_0178417 Ga0439445_0178417_125_514 127
176 3300042004 Ga0439445_0242166 Ga0439445_0242166_110_499 127
177 3300042006 Ga0439432_000489 Ga0439432_000489_8994_9383 127
178 3300042010 Ga0439452_044218 Ga0439452_044218_252_641 127
179 3300042014 Ga0439457_007031 Ga0439457_007031_440_829 127
180 3300042015 Ga0439462_0003560 Ga0439462_0003560_677_1066 127
181 3300042015 Ga0439462_0041099 Ga0439462_0041099_463_852 127
182 3300042122 Ga0450920_018568 Ga0450920_018568_875_1264 127
183 3300042147 Ga0450910_041856 Ga0450910_041856_269_658 127
184 3300042185 Ga0450909_005567 Ga0450909_005567_1382_1771 127
185 3300042435 Ga0439434_0015129 Ga0439434_0015129_518_907 127
186 3300042435 Ga0439434_0018363 Ga0439434_0018363_391_780 127
187 3300046453 Ga0495627_029314 Ga0495627_029314_1142_1531 127
188 3300046691 Ga0495670_0000165 Ga0495670_0000165_27178_27567 127
189 3300047318 Ga0495636_0329616 Ga0495636_0329616_29_418 127
190 3300047470 Ga0495681_0183554 Ga0495681_0183554_257_646 127
191 3300048918 Ga0496115_0000817 Ga0496115_0000817_17621_18007 127
192 3300049744 Ga0501083_0327374 Ga0501083_0327374_591_977 127
193 3300049758 Ga0501241_012359 Ga0501241_012359_724_1113 127
194 3300050489 nmdc:mga03683_462310_c1 nmdc:mga03683_462310_c1_98_484 127
195 3300053087 Ga0500643_014433 Ga0500643_014433_498_887 127
196 3300053094 Ga0500566_0004958 Ga0500566_0004958_4210_4599 127
197 3300053134 Ga0500658_0067635 Ga0500658_0067635_813_1202 127
198 3300053139 Ga0500568_0007329 Ga0500568_0007329_4799_5188 127
199 3300053142 Ga0500577_0057929 Ga0500577_0057929_1056_1442 127
200 3300053142 Ga0500577_0406207 Ga0500577_0406207_100_486 127
201 2162886012 MBSR1b_contig_1511188 MBSR1b_0757.00007150 128
202 3300005290 Ga0065712_10002984 Ga0065712_100029844 128
203 3300005293 Ga0065715_10112838 Ga0065715_101128384 128
204 3300005329 Ga0070683_100117637 Ga0070683_1001176374 128
205 3300005330 Ga0070690_100003382 Ga0070690_1000033822 128
206 3300005331 Ga0070670_100195175 Ga0070670_1001951753 128
207 3300005334 Ga0068869_100019038 Ga0068869_1000190384 128
208 3300005334 Ga0068869_100831397 Ga0068869_1008313971 128
209 3300005335 Ga0070666_10097905 Ga0070666_100979054 128
210 3300005336 Ga0070680_100401871 Ga0070680_1004018712 128
211 3300005336 Ga0070680_100593321 Ga0070680_1005933212 128
212 3300005337 Ga0070682_100074675 Ga0070682_1000746754 128
213 3300005338 Ga0068868_100115536 Ga0068868_1001155364 128
214 3300005339 Ga0070660_101049614 Ga0070660_1010496142 128
215 3300005340 Ga0070689_100006225 Ga0070689_10000622510 128
216 3300005341 Ga0070691_10858211 Ga0070691_108582111 128
217 3300005343 Ga0070687_100033301 Ga0070687_1000333012 128
218 3300005344 Ga0070661_100006458 Ga0070661_1000064587 128
219 3300005345 Ga0070692_10059896 Ga0070692_100598962 128
220 3300005345 Ga0070692_10073046 Ga0070692_100730463 128
221 3300005347 Ga0070668_100019966 Ga0070668_1000199666 128
222 3300005353 Ga0070669_100022189 Ga0070669_1000221894 128
223 3300005354 Ga0070675_100071797 Ga0070675_1000717972 128
224 3300005355 Ga0070671_100425830 Ga0070671_1004258301 128
225 3300005364 Ga0070673_100000430 Ga0070673_10000043016 128
226 3300005365 Ga0070688_100060641 Ga0070688_1000606414 128
227 3300005366 Ga0070659_101594034 Ga0070659_1015940341 128
228 3300005438 Ga0070701_10013099 Ga0070701_100130994 128
229 3300005440 Ga0070705_100003246 Ga0070705_1000032462 128
230 3300005441 Ga0070700_100461721 Ga0070700_1004617212 128
231 3300005444 Ga0070694_100123326 Ga0070694_1001233263 128
232 3300005456 Ga0070678_100078523 Ga0070678_1000785232 128
233 3300005457 Ga0070662_100026278 Ga0070662_1000262784 128
234 3300005457 Ga0070662_100308214 Ga0070662_1003082143 128
235 3300005458 Ga0070681_10302878 Ga0070681_103028782 128
236 3300005459 Ga0068867_100016655 Ga0068867_1000166554 128
237 3300005466 Ga0070685_10011323 Ga0070685_100113232 128
238 3300005530 Ga0070679_100361616 Ga0070679_1003616162 128
239 3300005530 Ga0070679_101064721 Ga0070679_1010647212 128
240 3300005535 Ga0070684_100052756 Ga0070684_1000527563 128
241 3300005543 Ga0070672_100035707 Ga0070672_1000357072 128
242 3300005544 Ga0070686_100004718 Ga0070686_1000047187 128
243 3300005548 Ga0070665_100058966 Ga0070665_1000589663 128
244 3300005549 Ga0070704_101823568 Ga0070704_1018235682 128
245 3300005564 Ga0070664_100003466 Ga0070664_1000034668 128
246 3300005564 Ga0070664_100189358 Ga0070664_1001893583 128
247 3300005577 Ga0068857_100029446 Ga0068857_1000294464 128
248 3300005615 Ga0070702_100153313 Ga0070702_1001533132 128
249 3300005617 Ga0068859_100002119 Ga0068859_10000211917 128
250 3300005618 Ga0068864_100052238 Ga0068864_1000522382 128
251 3300005719 Ga0068861_100037252 Ga0068861_1000372522 128
252 3300005719 Ga0068861_100336678 Ga0068861_1003366782 128
253 3300005840 Ga0068870_10010534 Ga0068870_100105342 128
254 3300005840 Ga0068870_10447761 Ga0068870_104477612 128
255 3300005841 Ga0068863_100001397 Ga0068863_10000139725 128
256 3300005842 Ga0068858_100034877 Ga0068858_1000348773 128
257 3300005843 Ga0068860_100054783 Ga0068860_1000547834 128
258 3300005844 Ga0068862_100007923 Ga0068862_10000792311 128
259 3300005844 Ga0068862_100012284 Ga0068862_1000122844 128
260 3300006237 Ga0097621_100062474 Ga0097621_1000624742 128
261 3300006358 Ga0068871_100116256 Ga0068871_1001162562 128
262 3300006844 Ga0075428_100016530 Ga0075428_1000165304 128
263 3300006846 Ga0075430_100076166 Ga0075430_1000761662 128
264 3300006847 Ga0075431_100015034 Ga0075431_1000150344 128
265 3300006847 Ga0075431_100019809 Ga0075431_1000198097 128
266 3300006847 Ga0075431_101132371 Ga0075431_1011323712 128
267 3300006871 Ga0075434_100552943 Ga0075434_1005529432 128
268 3300006880 Ga0075429_100007843 Ga0075429_10000784311 128
269 3300006881 Ga0068865_100138739 Ga0068865_1001387394 128
270 3300006931 Ga0097620_100002119 Ga0097620_10000211910 128
271 3300009092 Ga0105250_10104944 Ga0105250_101049441 128
272 3300009094 Ga0111539_10018303 Ga0111539_100183034 128
273 3300009094 Ga0111539_10096186 Ga0111539_100961863 128
274 3300009094 Ga0111539_10422800 Ga0111539_104228004 128
275 3300009098 Ga0105245_12435910 Ga0105245_124359101 128
276 3300009098 Ga0105245_13054126 Ga0105245_130541262 128
277 3300009147 Ga0114129_10003651 Ga0114129_1000365119 128
278 3300009148 Ga0105243_13071824 Ga0105243_130718242 128
279 3300009177 Ga0105248_10041090 Ga0105248_100410906 128
280 3300009551 Ga0105238_11051042 Ga0105238_110510422 128
281 3300009553 Ga0105249_10037769 Ga0105249_100377692 128
282 3300009553 Ga0105249_10102879 Ga0105249_101028792 128
283 3300010375 Ga0105239_10440405 Ga0105239_104404052 128
284 3300011119 Ga0105246_10591389 Ga0105246_105913892 128
285 3300013296 Ga0157374_10699475 Ga0157374_106994752 128
286 3300013297 Ga0157378_10397996 Ga0157378_103979961 128
287 3300013306 Ga0163162_10178353 Ga0163162_101783534 128
288 3300013308 Ga0157375_10084022 Ga0157375_100840225 128
289 3300014325 Ga0163163_10003527 Ga0163163_100035272 128
290 3300014968 Ga0157379_10091536 Ga0157379_100915364 128
291 3300014968 Ga0157379_10165218 Ga0157379_101652182 128
292 3300014969 Ga0157376_10079286 Ga0157376_100792861 128
293 3300014969 Ga0157376_10626850 Ga0157376_106268502 128
294 3300025901 Ga0207688_11013213 Ga0207688_110132131 128
295 3300025903 Ga0207680_10071056 Ga0207680_100710564 128
296 3300025907 Ga0207645_10009699 Ga0207645_100096997 128
297 3300025907 Ga0207645_11184858 Ga0207645_111848581 128
298 3300025908 Ga0207643_10006565 Ga0207643_100065656 128
299 3300025908 Ga0207643_10057239 Ga0207643_100572392 128
300 3300025912 Ga0207707_10897367 Ga0207707_108973672 128
301 3300025918 Ga0207662_10019154 Ga0207662_100191543 128
302 3300025923 Ga0207681_10015049 Ga0207681_100150494 128
303 3300025923 Ga0207681_10186579 Ga0207681_101865792 128
304 3300025925 Ga0207650_10267094 Ga0207650_102670942 128
305 3300025926 Ga0207659_10007508 Ga0207659_100075088 128
306 3300025927 Ga0207687_11959858 Ga0207687_119598582 128
307 3300025931 Ga0207644_10483133 Ga0207644_104831332 128
308 3300025932 Ga0207690_11619554 Ga0207690_116195542 128
309 3300025933 Ga0207706_10019088 Ga0207706_100190884 128
310 3300025933 Ga0207706_10230528 Ga0207706_102305282 128
311 3300025935 Ga0207709_10562890 Ga0207709_105628901 128
312 3300025936 Ga0207670_10003454 Ga0207670_1000345410 128
313 3300025937 Ga0207669_10137689 Ga0207669_101376892 128
314 3300025938 Ga0207704_10523786 Ga0207704_105237862 128
315 3300025940 Ga0207691_10136961 Ga0207691_101369614 128
316 3300025941 Ga0207711_10008818 Ga0207711_100088183 128
317 3300025942 Ga0207689_10101227 Ga0207689_101012272 128
318 3300025944 Ga0207661_10188182 Ga0207661_101881822 128
319 3300025945 Ga0207679_10003913 Ga0207679_100039136 128
320 3300025945 Ga0207679_10646388 Ga0207679_106463882 128
321 3300025960 Ga0207651_10015594 Ga0207651_100155942 128
322 3300025961 Ga0207712_10061997 Ga0207712_100619972 128
323 3300025961 Ga0207712_10108351 Ga0207712_101083511 128
324 3300025972 Ga0207668_10012496 Ga0207668_100124964 128
325 3300025986 Ga0207658_10184706 Ga0207658_101847062 128
326 3300026023 Ga0207677_10178570 Ga0207677_101785703 128
327 3300026035 Ga0207703_10020059 Ga0207703_100200595 128
328 3300026075 Ga0207708_10054456 Ga0207708_100544563 128
329 3300026075 Ga0207708_10068905 Ga0207708_100689053 128
330 3300026088 Ga0207641_10002890 Ga0207641_100028904 128
331 3300026089 Ga0207648_10018924 Ga0207648_100189246 128
332 3300026089 Ga0207648_10511495 Ga0207648_105114952 128
333 3300026095 Ga0207676_10008243 Ga0207676_100082439 128
334 3300026116 Ga0207674_10037824 Ga0207674_100378245 128
335 3300026116 Ga0207674_10165238 Ga0207674_101652384 128
336 3300026118 Ga0207675_100058985 Ga0207675_1000589851 128
337 3300026118 Ga0207675_100227659 Ga0207675_1002276592 128
338 3300026121 Ga0207683_10075714 Ga0207683_100757143 128
339 3300027907 Ga0207428_10017747 Ga0207428_100177474 128
340 3300027907 Ga0207428_10439171 Ga0207428_104391712 128
341 3300028379 Ga0268266_10192746 Ga0268266_101927462 128
342 3300028380 Ga0268265_10000723 Ga0268265_1000072334 128
343 3300028380 Ga0268265_10003337 Ga0268265_100033378 128
344 3300028381 Ga0268264_10659216 Ga0268264_106592162 128
345 3300028800 Ga0265338_10646345 Ga0265338_106463451 128
346 3300031507 Ga0307509_10000675 Ga0307509_1000067535 128
347 3300031548 Ga0307408_100019209 Ga0307408_1000192094 128
348 3300031548 Ga0307408_100704643 Ga0307408_1007046432 128
349 3300031711 Ga0265314_10294784 Ga0265314_102947841 128
350 3300031901 Ga0307406_10132645 Ga0307406_101326452 128
351 3300031911 Ga0307412_10404766 Ga0307412_104047662 128
352 3300032002 Ga0307416_100037362 Ga0307416_1000373624 128
353 3300032126 Ga0307415_101596220 Ga0307415_1015962202 128
354 3300032126 Ga0307415_102473585 Ga0307415_1024735852 128
355 3300034819 Ga0373958_0002274 Ga0373958_0002274_2172_2558 128
356 3300035691 Ga0373931_0231781 Ga0373931_0231781_279_665 128
357 3300042005 Ga0439448_0382067 Ga0439448_0382067_93_479 128
358 3300045051 Ga0451576_1399447 Ga0451576_1399447_211_609 128
359 3300046460 Ga0495638_0126306 Ga0495638_0126306_255_641 128
360 3300048904 Ga0496101_0163179 Ga0496101_0163179_424_810 128
361 3300048909 Ga0496106_0186111 Ga0496106_0186111_69_455 128
362 3300048911 Ga0496108_0355893 Ga0496108_0355893_376_762 128
363 3300048917 Ga0496114_0162790 Ga0496114_0162790_1209_1595 128
364 3300050507 nmdc:mga05p37_12919_c1 nmdc:mga05p37_12919_c1_1347_1733 128
365 3300050508 nmdc:mga09592_1753_c1 nmdc:mga09592_1753_c1_11647_12033 128
366 3300050508 nmdc:mga09592_323043_c1 nmdc:mga09592_323043_c1_16_411 128
367 3300050508 nmdc:mga09592_374784_c1 nmdc:mga09592_374784_c1_273_659 128
368 3300050509 nmdc:mga0qj67_5998_c1 nmdc:mga0qj67_5998_c1_7343_7729 128
369 3300050510 nmdc:mga06r32_173362_c1 nmdc:mga06r32_173362_c1_77_472 128
370 3300050510 nmdc:mga06r32_21720_c1 nmdc:mga06r32_21720_c1_4365_4751 128
371 3300050510 nmdc:mga06r32_3866_c1 nmdc:mga06r32_3866_c1_10674_11060 128
372 3300050510 nmdc:mga06r32_511616_c1 nmdc:mga06r32_511616_c1_273_659 128
373 3300050511 nmdc:mga08y16_21928_c1 nmdc:mga08y16_21928_c1_3373_3768 128
374 3300050511 nmdc:mga08y16_70105_c1 nmdc:mga08y16_70105_c1_680_1066 128
375 3300050511 nmdc:mga08y16_92069_c1 nmdc:mga08y16_92069_c1_2548_2934 128
376 3300050512 nmdc:mga0n895_91673_c1 nmdc:mga0n895_91673_c1_2203_2589 128
377 3300050515 nmdc:mga0a205_574665_c1 nmdc:mga0a205_574665_c1_237_623 128
378 3300053146 Ga0500588_0413387 Ga0500588_0413387_41_427 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

14

132

0.92

PF05328

CybS

CybS, succinate dehydrogenase cytochrome B small subunit

13

138

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wdr-assembly1.cif.gz_D e. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound 0.9265 20 119
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.9234 22 119
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.9228 20 119
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.9102 18 119
4ytp-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide 0.8862 22 121
ID Description Score Start End Superfamily
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9228 20 119 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9215 20 119 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9112 20 119 1.20.1300.10
4ytpD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8862 22 121 1.20.1300.10
af_P0AC44_1_115_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8817 12 119 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A838UDD3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9881 51 125 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E5H4T6-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9853 21 125 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A382SNI6-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9805 20 124 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2D7KTS3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9768 20 123 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-A0A4U7EYN9-F1-model_v4 Succinate dehydrogenase, hydrophobic membrane anchor protein 0.9765 52 126 GO:0006099
GO:0016020
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.86 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map