F428107

General Info

Members Datasets Scaffolds Average Seq Length
378 208 756 261

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0009584|Ga0466963_0009584_677_1660
Length 302
Sequence VPLGLLDGRLRRLQAAEDDEHSVDRRAHDEFVDLLEVGALSSGTRPEIQEALLRLDAITRRLRRECPWDREQDERTIVPHTVEEAYELADAAHKRDDAKLLDELGDVLFQVHFLALLLEERGAGDLAQVAEHCTEKLIRRHPHVFGEAEAQTAAQVLRNWDKIKQDEPGRERGVFAEVPENLPGPLYARKVQRRAASSGFDFHDEEIAVDALKAELEELQNASNADERFHEVGDVLFAAVNIARKLRVDPELAVRAASDRFRARVTAAAELAASESRNWNDLAPEEQLTYYARARLSEGGAN

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 6.35
Rhizosphere 81.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0009584 3300044694 Bacteria 5836
2 JGI25406J46586_10004234 3300003203 Bacteria 6702
3 Ga0070683_100029764 3300005329 Bacteria 4948
4 Ga0070683_100276840 3300005329 Bacteria 1596
5 Ga0070683_100435186 3300005329 Bacteria 1251
6 Ga0068868_100060910 3300005338 Bacteria 2989
7 Ga0068868_100072095 3300005338 Bacteria 2755
8 Ga0068868_100251878 3300005338 Bacteria 1486
9 Ga0070660_100004690 3300005339 Bacteria 9466
10 Ga0070660_100038746 3300005339 Bacteria 3619
11 Ga0070660_100317898 3300005339 Bacteria 1278
12 Ga0070691_10137020 3300005341 Bacteria 1244
13 Ga0070691_10145909 3300005341 Bacteria 1210
14 Ga0070692_10153463 3300005345 Bacteria 1314
15 Ga0070668_100496707 3300005347 Bacteria 1056
16 Ga0070669_100293480 3300005353 Bacteria 1306
17 Ga0070671_100096756 3300005355 Bacteria 2475
18 Ga0070674_100164375 3300005356 Bacteria 1687
19 Ga0070674_100167917 3300005356 Bacteria 1670
20 Ga0070674_100224914 3300005356 Bacteria 1462
21 Ga0070659_100000163 3300005366 Bacteria 51399
22 Ga0070714_100000038 3300005435 Bacteria 121712
23 Ga0070714_100016724 3300005435 Bacteria 5931
24 Ga0070714_100040292 3300005435 Bacteria 3937
25 Ga0070714_100042666 3300005435 Bacteria 3833
26 Ga0070714_100052740 3300005435 Bacteria 3470
27 Ga0070714_100330278 3300005435 Bacteria 1428
28 Ga0070710_10000001 3300005437 Bacteria 552187
29 Ga0070705_100056018 3300005440 Bacteria 2320
30 Ga0070700_100015018 3300005441 Bacteria 4382
31 Ga0070663_100228956 3300005455 Bacteria 1463
32 Ga0070663_100516723 3300005455 Bacteria 994
33 Ga0070685_10133700 3300005466 Bacteria 1554
34 Ga0070672_100076224 3300005543 Bacteria 2678
35 Ga0070672_100175707 3300005543 Bacteria 1783
36 Ga0070686_100137037 3300005544 Bacteria 1699
37 Ga0070665_100003731 3300005548 Bacteria 16131
38 Ga0070664_100190162 3300005564 Bacteria 1829
39 Ga0068857_100036706 3300005577 Bacteria 4342
40 Ga0068854_100034003 3300005578 Bacteria 3557
41 Ga0068854_100059475 3300005578 Bacteria 2761
42 Ga0070702_100002819 3300005615 Bacteria 7621
43 Ga0068852_100069583 3300005616 Bacteria 3085
44 Ga0068859_100027244 3300005617 Bacteria 5733
45 Ga0068866_10048961 3300005718 Bacteria 2139
46 Ga0068861_100012688 3300005719 Bacteria 5880
47 Ga0068861_100105720 3300005719 Bacteria 2248
48 Ga0068861_100141871 3300005719 Bacteria 1961
49 Ga0068858_100069380 3300005842 Bacteria 3267
50 Ga0068862_100269813 3300005844 Bacteria 1556
51 Ga0081538_10001846 3300005981 Bacteria 21363
52 Ga0081538_10012745 3300005981 Bacteria 6714
53 Ga0081540_1005116 3300005983 Bacteria 9835
54 Ga0081539_10002326 3300005985 Bacteria 27362
55 Ga0081539_10011774 3300005985 Bacteria 6855
56 Ga0070717_10000010 3300006028 Bacteria 283501
57 Ga0070717_10050225 3300006028 Bacteria 3426
58 Ga0070717_10153228 3300006028 Bacteria 1995
59 Ga0070712_100000009 3300006175 Bacteria 143615
60 Ga0070712_100018866 3300006175 Bacteria 4488
61 Ga0097621_100298669 3300006237 Bacteria 1422
62 Ga0068871_100438618 3300006358 Bacteria 1169
63 Ga0075434_100307031 3300006871 Bacteria 1607
64 Ga0075429_100162334 3300006880 Bacteria 1957
65 Ga0068865_100137906 3300006881 Bacteria 1836
66 Ga0068865_100167365 3300006881 Bacteria 1682
67 Ga0097620_100027244 3300006931 Bacteria 5733
68 Ga0075435_100427733 3300007076 Bacteria 1141
69 Ga0105240_10072052 3300009093 Bacteria 4271
70 Ga0111539_10212283 3300009094 Bacteria 2255
71 Ga0105245_10036413 3300009098 Bacteria 4371
72 Ga0105245_10129295 3300009098 Bacteria 2367
73 Ga0105245_10619229 3300009098 Bacteria 1110
74 Ga0105245_10702844 3300009098 Bacteria 1044
75 Ga0105247_10047240 3300009101 Bacteria 2643
76 Ga0105247_10125384 3300009101 Bacteria 1668
77 Ga0105247_10181553 3300009101 Bacteria 1405
78 Ga0105243_10025675 3300009148 Bacteria 4505
79 Ga0105243_10077192 3300009148 Bacteria 2709
80 Ga0105243_10302673 3300009148 Bacteria 1450
81 Ga0105242_10418305 3300009176 Bacteria 1255
82 Ga0105237_10246799 3300009545 Bacteria 1787
83 Ga0105238_10633458 3300009551 Bacteria 1079
84 Ga0105249_10010808 3300009553 Bacteria 8024
85 Ga0105249_10159414 3300009553 Bacteria 2179
86 Ga0105246_10006461 3300011119 Bacteria 7161
87 Ga0163162_10100400 3300013306 Bacteria 2985
88 Ga0163162_10215077 3300013306 Bacteria 2052
89 Ga0157375_10229347 3300013308 Bacteria 2016
90 Ga0157375_10663252 3300013308 Bacteria 1199
91 Ga0163163_10132952 3300014325 Bacteria 2528
92 Ga0163163_10144875 3300014325 Bacteria 2419
93 Ga0157380_10380202 3300014326 Bacteria 1332
94 Ga0157379_10010046 3300014968 Bacteria 8247
95 Ga0157379_10207228 3300014968 Bacteria 1774
96 Ga0213874_10000318 3300021377 Bacteria 9539
97 Ga0213874_10042510 3300021377 Bacteria 1365
98 Ga0213876_10001692 3300021384 Bacteria 13415
99 Ga0213876_10013437 3300021384 Bacteria 4349
100 Ga0213876_10043704 3300021384 Bacteria 2368
101 Ga0213876_10077779 3300021384 Bacteria 1752
102 Ga0213876_10096928 3300021384 Bacteria 1562
103 Ga0213876_10130176 3300021384 Bacteria 1337
104 Ga0213876_10132701 3300021384 Bacteria 1324
105 Ga0213875_10001710 3300021388 Bacteria 13777
106 Ga0213875_10001732 3300021388 Bacteria 13687
107 Ga0213875_10004326 3300021388 Bacteria 7824
108 Ga0213875_10043118 3300021388 Bacteria 2118
109 Ga0207426_1022908 3300025302 Bacteria 2137
110 Ga0207692_10000004 3300025898 Bacteria 413600
111 Ga0207692_10077996 3300025898 Bacteria 1764
112 Ga0207642_10032940 3300025899 Bacteria 2187
113 Ga0207710_10107455 3300025900 Bacteria 1322
114 Ga0207688_10013321 3300025901 Bacteria 4468
115 Ga0207695_10133945 3300025913 Bacteria 2433
116 Ga0207693_10000036 3300025915 Bacteria 109562
117 Ga0207693_10005672 3300025915 Bacteria 10379
118 Ga0207657_10009622 3300025919 Bacteria 9697
119 Ga0207657_10076117 3300025919 Bacteria 2832
120 Ga0207657_10094868 3300025919 Bacteria 2483
121 Ga0207681_10272880 3300025923 Bacteria 1328
122 Ga0207687_10088514 3300025927 Bacteria 2253
123 Ga0207687_10177945 3300025927 Bacteria 1646
124 Ga0207700_10165499 3300025928 Bacteria 1840
125 Ga0207700_10193792 3300025928 Bacteria 1709
126 Ga0207664_10000040 3300025929 Bacteria 158895
127 Ga0207664_10010865 3300025929 Bacteria 6447
128 Ga0207664_10034621 3300025929 Bacteria 3890
129 Ga0207664_10043485 3300025929 Bacteria 3514
130 Ga0207664_10073918 3300025929 Bacteria 2752
131 Ga0207690_10000166 3300025932 Bacteria 51430
132 Ga0207690_10252104 3300025932 Bacteria 1364
133 Ga0207706_10627036 3300025933 Bacteria 922
134 Ga0207709_10030947 3300025935 Bacteria 3119
135 Ga0207670_10018552 3300025936 Bacteria 4232
136 Ga0207704_10058459 3300025938 Bacteria 2374
137 Ga0207691_10128429 3300025940 Bacteria 2241
138 Ga0207691_10150882 3300025940 Bacteria 2043
139 Ga0207689_10117959 3300025942 Bacteria 2182
140 Ga0207661_10205322 3300025944 Bacteria 1734
141 Ga0207661_10232783 3300025944 Bacteria 1632
142 Ga0207661_10657360 3300025944 Bacteria 963
143 Ga0207712_10027128 3300025961 Bacteria 3823
144 Ga0207640_10075630 3300025981 Bacteria 2283
145 Ga0207677_10244926 3300026023 Bacteria 1452
146 Ga0207677_10245456 3300026023 Bacteria 1451
147 Ga0207639_10489806 3300026041 Bacteria 1122
148 Ga0207678_10135506 3300026067 Bacteria 2101
149 Ga0207678_10211992 3300026067 Bacteria 1657
150 Ga0207678_10304646 3300026067 Bacteria 1369
151 Ga0207708_10003129 3300026075 Bacteria 12181
152 Ga0207708_10068824 3300026075 Bacteria 2709
153 Ga0207648_10103568 3300026089 Bacteria 2496
154 Ga0207674_10043480 3300026116 Bacteria 4632
155 Ga0207675_100172719 3300026118 Bacteria 2066
156 Ga0207675_100310371 3300026118 Bacteria 1538
157 Ga0207683_10102349 3300026121 Bacteria 2557
158 Ga0207698_10144101 3300026142 Bacteria 2057
159 Ga0207428_10061940 3300027907 Bacteria 2960
160 Ga0268266_10042905 3300028379 Bacteria 3864
161 Ga0268265_10141555 3300028380 Bacteria 2014
162 Ga0268264_10179239 3300028381 Bacteria 1923
163 Ga0265326_10000008 3300028558 Bacteria 210923
164 Ga0265319_1000502 3300028563 Bacteria 27032
165 Ga0265334_10000263 3300028573 Bacteria 29651
166 Ga0265336_10001790 3300028666 Bacteria 9396
167 Ga0265338_10041520 3300028800 Bacteria 4300
168 Ga0265338_10242957 3300028800 Bacteria 1332
169 Ga0265324_10003994 3300029957 Bacteria 6800
170 Ga0307405_10317804 3300031731 Bacteria 1188
171 Ga0307405_10401837 3300031731 Bacteria 1073
172 Ga0307413_10008134 3300031824 Bacteria 4929
173 Ga0307413_10035017 3300031824 Bacteria 2876
174 Ga0307410_10010479 3300031852 Bacteria 5253
175 Ga0307410_10026771 3300031852 Bacteria 3635
176 Ga0307406_10050814 3300031901 Bacteria 2630
177 Ga0307406_10110181 3300031901 Bacteria 1894
178 Ga0307406_10233299 3300031901 Bacteria 1376
179 Ga0307406_10291952 3300031901 Bacteria 1249
180 Ga0307407_10091929 3300031903 Bacteria 1862
181 Ga0307409_100089311 3300031995 Bacteria 2519
182 Ga0307409_100235629 3300031995 Bacteria 1662
183 Ga0307409_100350204 3300031995 Bacteria 1393
184 Ga0307409_100398196 3300031995 Bacteria 1314
185 Ga0307416_100014281 3300032002 Bacteria 5434
186 Ga0307416_100157537 3300032002 Bacteria 2093
187 Ga0307416_100188677 3300032002 Bacteria 1941
188 Ga0307416_100426774 3300032002 Bacteria 1372
189 Ga0307414_10060231 3300032004 Bacteria 2684
190 Ga0307414_10206438 3300032004 Bacteria 1602
191 Ga0307414_10301886 3300032004 Bacteria 1355
192 Ga0307411_10126307 3300032005 Bacteria 1861
193 Ga0307415_100003903 3300032126 Bacteria 7662
194 Ga0307415_100010548 3300032126 Bacteria 5238
195 Ga0307415_100091283 3300032126 Bacteria 2206
196 Ga0373955_0110473 3300035172 Bacteria 1589
197 Ga0373924_0081320 3300035410 Bacteria 1378
198 Ga0395898_0233445 3300037466 Bacteria 1754
199 Ga0395905_0077337 3300037471 Bacteria 3118
200 Ga0436364_0031730 3300037853 Bacteria 5776
201 Ga0436364_0106425 3300037853 Bacteria 7406
202 Ga0436364_0121607 3300037853 Bacteria 14288
203 Ga0436364_0303596 3300037853 Bacteria 2575
204 Ga0436364_0314883 3300037853 Bacteria 27454
205 Ga0436364_0458129 3300037853 Bacteria 5793
206 Ga0436364_0513584 3300037853 Bacteria 44658
207 Ga0436364_0513878 3300037853 Bacteria 2061
208 Ga0436364_0684153 3300037853 Bacteria 1761
209 Ga0436364_0799263 3300037853 Bacteria 930
210 Ga0436364_1200429 3300037853 Bacteria 5907
211 Ga0436364_1471445 3300037853 Bacteria 3180
212 Ga0395901_0039008 3300038443 Bacteria 4914
213 Ga0395901_0072309 3300038443 Bacteria 3595
214 Ga0436365_0423871 3300039437 Bacteria 4767
215 Ga0436365_0464312 3300039437 Bacteria 1779
216 Ga0436365_1115198 3300039437 Bacteria 3390
217 Ga0436365_1300790 3300039437 Bacteria 3828
218 Ga0436365_1637917 3300039437 Bacteria 3177
219 Ga0436365_1788134 3300039437 Bacteria 1173
220 Ga0436365_1806950 3300039437 Bacteria 6364
221 Ga0436365_1818229 3300039437 Bacteria 32919
222 Ga0436365_1839714 3300039437 Bacteria 5046
223 Ga0436360_0127123 3300039438 Bacteria 1497
224 Ga0436361_0010055 3300039447 Bacteria 3243
225 Ga0436363_0235841 3300039450 Bacteria 2213
226 Ga0436363_0586875 3300039450 Bacteria 1397
227 Ga0436363_0641248 3300039450 Bacteria 1803
228 Ga0436363_1241269 3300039450 Bacteria 1208
229 Ga0436363_1604873 3300039450 Bacteria 11412
230 Ga0436363_1612774 3300039450 Bacteria 12809
231 Ga0436362_0044815 3300039453 Bacteria 1280
232 Ga0436362_0745720 3300039453 Bacteria 1700
233 Ga0436362_0902931 3300039453 Bacteria 2633
234 Ga0466969_0018543 3300044656 Bacteria 3624
235 Ga0466969_0064788 3300044656 Bacteria 1768
236 Ga0466966_0017855 3300044684 Bacteria 4685
237 Ga0466966_0049297 3300044684 Bacteria 2682
238 Ga0466966_0054201 3300044684 Bacteria 2542
239 Ga0466966_0058318 3300044684 Bacteria 2440
240 Ga0466966_0344431 3300044684 Bacteria 895
241 Ga0466961_0071468 3300044693 Bacteria 2202
242 Ga0466961_0131442 3300044693 Bacteria 1569
243 Ga0466963_0000913 3300044694 Bacteria 15031
244 Ga0466963_0017073 3300044694 Bacteria 4521
245 Ga0466963_0054559 3300044694 Bacteria 2657
246 Ga0466963_0116593 3300044694 Bacteria 1836
247 Ga0466971_0008705 3300044719 Bacteria 4428
248 Ga0466971_0011660 3300044719 Bacteria 3849
249 Ga0466971_0016442 3300044719 Bacteria 3266
250 Ga0466971_0054050 3300044719 Bacteria 1810
251 Ga0466968_0029150 3300044735 Bacteria 2281
252 Ga0466968_0049340 3300044735 Bacteria 1793
253 Ga0466957_0025640 3300044842 Bacteria 3495
254 Ga0466957_0028080 3300044842 Bacteria 3349
255 Ga0466957_0244176 3300044842 Bacteria 1192
256 Ga0466960_0000623 3300044901 Bacteria 12210
257 Ga0466960_0010417 3300044901 Bacteria 3862
258 Ga0466960_0017766 3300044901 Bacteria 3108
259 Ga0466960_0059201 3300044901 Bacteria 1873
260 Ga0466960_0103897 3300044901 Bacteria 1467
261 Ga0466959_0003140 3300045049 Bacteria 10714
262 Ga0466959_0005352 3300045049 Bacteria 8783
263 Ga0466959_0021063 3300045049 Bacteria 4807
264 Ga0466959_0057846 3300045049 Bacteria 2825
265 Ga0466959_0096117 3300045049 Bacteria 2124
266 Ga0466959_0128948 3300045049 Bacteria 1793
267 Ga0466959_0175871 3300045049 Bacteria 1499
268 Ga0466959_0249870 3300045049 Bacteria 1223
269 Ga0466959_0280689 3300045049 Bacteria 1143
270 Ga0466958_0000299 3300045836 Bacteria 19393
271 Ga0466958_0001632 3300045836 Bacteria 10792
272 Ga0466958_0015829 3300045836 Bacteria 4332
273 Ga0466958_0021471 3300045836 Bacteria 3774
274 Ga0466958_0157043 3300045836 Bacteria 1436
275 Ga0466958_0240275 3300045836 Bacteria 1157
276 Ga0466967_0013704 3300045976 Bacteria 6280
277 Ga0466967_0034223 3300045976 Bacteria 4310
278 Ga0466967_0067015 3300045976 Bacteria 3201
279 Ga0466967_0102479 3300045976 Bacteria 2618
280 Ga0466967_0199405 3300045976 Bacteria 1895
281 Ga0466967_0199885 3300045976 Bacteria 1892
282 Ga0466967_0223702 3300045976 Bacteria 1789
283 Ga0466967_0310809 3300045976 Bacteria 1518
284 Ga0495603_0074307 3300046455 Bacteria 1996
285 Ga0495629_0052735 3300046459 Bacteria 2846
286 Ga0495651_0089931 3300046462 Bacteria 2303
287 Ga0495653_0023997 3300046463 Bacteria 4920
288 Ga0495650_0000012 3300046471 Bacteria 613144
289 Ga0495639_0099983 3300046475 Bacteria 1369
290 Ga0495594_0139309 3300046499 Bacteria 1376
291 Ga0495608_0028758 3300046511 Bacteria 3777
292 Ga0495620_0103416 3300046515 Bacteria 1134
293 Ga0495628_0146297 3300046516 Bacteria 1801
294 Ga0495652_0045862 3300046529 Bacteria 3755
295 Ga0495640_0026260 3300046533 Bacteria 4211
296 Ga0495645_0238434 3300046543 Bacteria 1215
297 Ga0495667_0034239 3300046559 Bacteria 3396
298 Ga0495635_0003233 3300046663 Bacteria 11232
299 Ga0495657_0011672 3300046675 Bacteria 6556
300 Ga0495599_0040083 3300046678 Bacteria 2942
301 Ga0495599_0153220 3300046678 Bacteria 1427
302 Ga0495658_0118994 3300046683 Bacteria 1596
303 Ga0495613_0238621 3300046689 Bacteria 1272
304 Ga0495604_0015298 3300047317 Bacteria 6124
305 Ga0495672_0018385 3300047320 Bacteria 4642
306 Ga0495676_0038599 3300047321 Bacteria 3965
307 Ga0495680_0007550 3300047322 Bacteria 9943
308 Ga0495684_0033661 3300047471 Bacteria 3930
309 Ga0495602_0036459 3300048088 Bacteria 4577
310 Ga0496100_0000211 3300048903 Bacteria 32290
311 Ga0496100_0132271 3300048903 Bacteria 1759
312 Ga0496101_0015050 3300048904 Bacteria 5206
313 Ga0496101_0127979 3300048904 Bacteria 1926
314 Ga0496103_0035116 3300048906 Bacteria 3069
315 Ga0496103_0087422 3300048906 Bacteria 1965
316 Ga0496104_0036404 3300048907 Bacteria 4601
317 Ga0496105_0081767 3300048908 Bacteria 2668
318 Ga0496107_0235792 3300048910 Bacteria 1361
319 Ga0496108_0006061 3300048911 Bacteria 9776
320 Ga0496109_0046857 3300048912 Bacteria 3928
321 Ga0496110_0102256 3300048913 Bacteria 2570
322 Ga0496110_0116963 3300048913 Bacteria 2400
323 Ga0496111_0339793 3300048914 Bacteria 1111
324 Ga0496112_0004893 3300048915 Bacteria 11458
325 Ga0496112_0012804 3300048915 Bacteria 7721
326 Ga0496112_0031138 3300048915 Bacteria 5170
327 Ga0496112_0102257 3300048915 Bacteria 2835
328 Ga0496113_0011835 3300048916 Bacteria 5845
329 Ga0496113_0061887 3300048916 Bacteria 2825
330 Ga0496113_0537880 3300048916 Bacteria 937
331 Ga0496114_0048421 3300048917 Bacteria 3536
332 Ga0496114_0050450 3300048917 Bacteria 3464
333 Ga0496115_0082899 3300048918 Bacteria 2613
334 Ga0496121_0001166 3300048924 Bacteria 46113
335 Ga0496121_0025885 3300048924 Bacteria 5551
336 Ga0501032_0010669 3300049569 Bacteria 6613
337 Ga0501034_0040359 3300049571 Bacteria 4724
338 Ga0501034_0142185 3300049571 Bacteria 2378
339 Ga0501036_0004603 3300049572 Bacteria 11143
340 Ga0501037_0023614 3300049573 Bacteria 4546
341 Ga0501038_0046801 3300049574 Bacteria 3749
342 Ga0501039_0050799 3300049575 Bacteria 3208
343 Ga0501039_0070309 3300049575 Bacteria 2719
344 Ga0501043_0049685 3300049579 Bacteria 3297
345 Ga0501046_0043439 3300049580 Bacteria 3578
346 Ga0501047_0148827 3300049581 Bacteria 2217
347 Ga0501048_0060061 3300049582 Bacteria 2694
348 Ga0501048_0127363 3300049582 Bacteria 1800
349 Ga0501067_0104785 3300049583 Bacteria 1571
350 Ga0501068_0030771 3300049584 Bacteria 3186
351 Ga0501069_0073489 3300049585 Bacteria 1917
352 Ga0501070_0159414 3300049586 Bacteria 1860
353 Ga0501070_0219226 3300049586 Bacteria 1561
354 Ga0501072_0356350 3300049588 Bacteria 1161
355 Ga0501073_0018378 3300049589 Bacteria 5053
356 Ga0501074_0023746 3300049590 Bacteria 4457
357 Ga0501075_0161696 3300049591 Bacteria 1708
358 Ga0501079_0205572 3300049741 Bacteria 1538
359 Ga0501080_0045778 3300049742 Bacteria 4073
360 Ga0501083_0033933 3300049744 Bacteria 3491
361 Ga0501035_0016593 3300049822 Bacteria 6790
362 Ga0501045_0237451 3300049824 Bacteria 1357
363 nmdc:mga09592_63283_c1 3300050508 Bacteria 3131
364 nmdc:mga06r32_221122_c1 3300050510 Bacteria 1882
365 nmdc:mga08y16_161454_c1 3300050511 Bacteria 2329
366 nmdc:mga08y16_760055_c1 3300050511 Bacteria 965
367 Ga0495601_0030336 3300053077 Bacteria 3357
368 Ga0495595_0016780 3300053084 Bacteria 3138
369 Ga0495619_0037609 3300053085 Bacteria 3155
370 Ga0500556_0001523 3300053104 Bacteria 9535
371 Ga0500616_0005841 3300053153 Bacteria 8245
372 Ga0500599_002112 3300053736 Bacteria 2360
373 Ga0501084_0040915 3300054114 Bacteria 3878
374 Ga0501082_0074066 3300060353 Bacteria 2932
375 Ga0501082_0649961 3300060353 Bacteria 923
376 Ga0466962_0000147 3300061719 Bacteria 29152
377 Ga0466962_0010828 3300061719 Bacteria 4384
378 Ga0466962_0084279 3300061719 Bacteria 1521
379 Ga0466963_0009584
380 JGI25406J46586_10004234
381 Ga0070683_100029764
382 Ga0070683_100276840
383 Ga0070683_100435186
384 Ga0068868_100060910
385 Ga0068868_100072095
386 Ga0068868_100251878
387 Ga0070660_100004690
388 Ga0070660_100038746
389 Ga0070660_100317898
390 Ga0070691_10137020
391 Ga0070691_10145909
392 Ga0070692_10153463
393 Ga0070668_100496707
394 Ga0070669_100293480
395 Ga0070671_100096756
396 Ga0070674_100164375
397 Ga0070674_100167917
398 Ga0070674_100224914
399 Ga0070659_100000163
400 Ga0070714_100000038
401 Ga0070714_100016724
402 Ga0070714_100040292
403 Ga0070714_100042666
404 Ga0070714_100052740
405 Ga0070714_100330278
406 Ga0070710_10000001
407 Ga0070705_100056018
408 Ga0070700_100015018
409 Ga0070663_100228956
410 Ga0070663_100516723
411 Ga0070685_10133700
412 Ga0070672_100076224
413 Ga0070672_100175707
414 Ga0070686_100137037
415 Ga0070665_100003731
416 Ga0070664_100190162
417 Ga0068857_100036706
418 Ga0068854_100034003
419 Ga0068854_100059475
420 Ga0070702_100002819
421 Ga0068852_100069583
422 Ga0068859_100027244
423 Ga0068866_10048961
424 Ga0068861_100012688
425 Ga0068861_100105720
426 Ga0068861_100141871
427 Ga0068858_100069380
428 Ga0068862_100269813
429 Ga0081538_10001846
430 Ga0081538_10012745
431 Ga0081540_1005116
432 Ga0081539_10002326
433 Ga0081539_10011774
434 Ga0070717_10000010
435 Ga0070717_10050225
436 Ga0070717_10153228
437 Ga0070712_100000009
438 Ga0070712_100018866
439 Ga0097621_100298669
440 Ga0068871_100438618
441 Ga0075434_100307031
442 Ga0075429_100162334
443 Ga0068865_100137906
444 Ga0068865_100167365
445 Ga0097620_100027244
446 Ga0075435_100427733
447 Ga0105240_10072052
448 Ga0111539_10212283
449 Ga0105245_10036413
450 Ga0105245_10129295
451 Ga0105245_10619229
452 Ga0105245_10702844
453 Ga0105247_10047240
454 Ga0105247_10125384
455 Ga0105247_10181553
456 Ga0105243_10025675
457 Ga0105243_10077192
458 Ga0105243_10302673
459 Ga0105242_10418305
460 Ga0105237_10246799
461 Ga0105238_10633458
462 Ga0105249_10010808
463 Ga0105249_10159414
464 Ga0105246_10006461
465 Ga0163162_10100400
466 Ga0163162_10215077
467 Ga0157375_10229347
468 Ga0157375_10663252
469 Ga0163163_10132952
470 Ga0163163_10144875
471 Ga0157380_10380202
472 Ga0157379_10010046
473 Ga0157379_10207228
474 Ga0213874_10000318
475 Ga0213874_10042510
476 Ga0213876_10001692
477 Ga0213876_10013437
478 Ga0213876_10043704
479 Ga0213876_10077779
480 Ga0213876_10096928
481 Ga0213876_10130176
482 Ga0213876_10132701
483 Ga0213875_10001710
484 Ga0213875_10001732
485 Ga0213875_10004326
486 Ga0213875_10043118
487 Ga0207426_1022908
488 Ga0207692_10000004
489 Ga0207692_10077996
490 Ga0207642_10032940
491 Ga0207710_10107455
492 Ga0207688_10013321
493 Ga0207695_10133945
494 Ga0207693_10000036
495 Ga0207693_10005672
496 Ga0207657_10009622
497 Ga0207657_10076117
498 Ga0207657_10094868
499 Ga0207681_10272880
500 Ga0207687_10088514
501 Ga0207687_10177945
502 Ga0207700_10165499
503 Ga0207700_10193792
504 Ga0207664_10000040
505 Ga0207664_10010865
506 Ga0207664_10034621
507 Ga0207664_10043485
508 Ga0207664_10073918
509 Ga0207690_10000166
510 Ga0207690_10252104
511 Ga0207706_10627036
512 Ga0207709_10030947
513 Ga0207670_10018552
514 Ga0207704_10058459
515 Ga0207691_10128429
516 Ga0207691_10150882
517 Ga0207689_10117959
518 Ga0207661_10205322
519 Ga0207661_10232783
520 Ga0207661_10657360
521 Ga0207712_10027128
522 Ga0207640_10075630
523 Ga0207677_10244926
524 Ga0207677_10245456
525 Ga0207639_10489806
526 Ga0207678_10135506
527 Ga0207678_10211992
528 Ga0207678_10304646
529 Ga0207708_10003129
530 Ga0207708_10068824
531 Ga0207648_10103568
532 Ga0207674_10043480
533 Ga0207675_100172719
534 Ga0207675_100310371
535 Ga0207683_10102349
536 Ga0207698_10144101
537 Ga0207428_10061940
538 Ga0268266_10042905
539 Ga0268265_10141555
540 Ga0268264_10179239
541 Ga0265326_10000008
542 Ga0265319_1000502
543 Ga0265334_10000263
544 Ga0265336_10001790
545 Ga0265338_10041520
546 Ga0265338_10242957
547 Ga0265324_10003994
548 Ga0307405_10317804
549 Ga0307405_10401837
550 Ga0307413_10008134
551 Ga0307413_10035017
552 Ga0307410_10010479
553 Ga0307410_10026771
554 Ga0307406_10050814
555 Ga0307406_10110181
556 Ga0307406_10233299
557 Ga0307406_10291952
558 Ga0307407_10091929
559 Ga0307409_100089311
560 Ga0307409_100235629
561 Ga0307409_100350204
562 Ga0307409_100398196
563 Ga0307416_100014281
564 Ga0307416_100157537
565 Ga0307416_100188677
566 Ga0307416_100426774
567 Ga0307414_10060231
568 Ga0307414_10206438
569 Ga0307414_10301886
570 Ga0307411_10126307
571 Ga0307415_100003903
572 Ga0307415_100010548
573 Ga0307415_100091283
574 Ga0373955_0110473
575 Ga0373924_0081320
576 Ga0395898_0233445
577 Ga0395905_0077337
578 Ga0436364_0031730
579 Ga0436364_0106425
580 Ga0436364_0121607
581 Ga0436364_0303596
582 Ga0436364_0314883
583 Ga0436364_0458129
584 Ga0436364_0513584
585 Ga0436364_0513878
586 Ga0436364_0684153
587 Ga0436364_0799263
588 Ga0436364_1200429
589 Ga0436364_1471445
590 Ga0395901_0039008
591 Ga0395901_0072309
592 Ga0436365_0423871
593 Ga0436365_0464312
594 Ga0436365_1115198
595 Ga0436365_1300790
596 Ga0436365_1637917
597 Ga0436365_1788134
598 Ga0436365_1806950
599 Ga0436365_1818229
600 Ga0436365_1839714
601 Ga0436360_0127123
602 Ga0436361_0010055
603 Ga0436363_0235841
604 Ga0436363_0586875
605 Ga0436363_0641248
606 Ga0436363_1241269
607 Ga0436363_1604873
608 Ga0436363_1612774
609 Ga0436362_0044815
610 Ga0436362_0745720
611 Ga0436362_0902931
612 Ga0466969_0018543
613 Ga0466969_0064788
614 Ga0466966_0017855
615 Ga0466966_0049297
616 Ga0466966_0054201
617 Ga0466966_0058318
618 Ga0466966_0344431
619 Ga0466961_0071468
620 Ga0466961_0131442
621 Ga0466963_0000913
622 Ga0466963_0017073
623 Ga0466963_0054559
624 Ga0466963_0116593
625 Ga0466971_0008705
626 Ga0466971_0011660
627 Ga0466971_0016442
628 Ga0466971_0054050
629 Ga0466968_0029150
630 Ga0466968_0049340
631 Ga0466957_0025640
632 Ga0466957_0028080
633 Ga0466957_0244176
634 Ga0466960_0000623
635 Ga0466960_0010417
636 Ga0466960_0017766
637 Ga0466960_0059201
638 Ga0466960_0103897
639 Ga0466959_0003140
640 Ga0466959_0005352
641 Ga0466959_0021063
642 Ga0466959_0057846
643 Ga0466959_0096117
644 Ga0466959_0128948
645 Ga0466959_0175871
646 Ga0466959_0249870
647 Ga0466959_0280689
648 Ga0466958_0000299
649 Ga0466958_0001632
650 Ga0466958_0015829
651 Ga0466958_0021471
652 Ga0466958_0157043
653 Ga0466958_0240275
654 Ga0466967_0013704
655 Ga0466967_0034223
656 Ga0466967_0067015
657 Ga0466967_0102479
658 Ga0466967_0199405
659 Ga0466967_0199885
660 Ga0466967_0223702
661 Ga0466967_0310809
662 Ga0495603_0074307
663 Ga0495629_0052735
664 Ga0495651_0089931
665 Ga0495653_0023997
666 Ga0495650_0000012
667 Ga0495639_0099983
668 Ga0495594_0139309
669 Ga0495608_0028758
670 Ga0495620_0103416
671 Ga0495628_0146297
672 Ga0495652_0045862
673 Ga0495640_0026260
674 Ga0495645_0238434
675 Ga0495667_0034239
676 Ga0495635_0003233
677 Ga0495657_0011672
678 Ga0495599_0040083
679 Ga0495599_0153220
680 Ga0495658_0118994
681 Ga0495613_0238621
682 Ga0495604_0015298
683 Ga0495672_0018385
684 Ga0495676_0038599
685 Ga0495680_0007550
686 Ga0495684_0033661
687 Ga0495602_0036459
688 Ga0496100_0000211
689 Ga0496100_0132271
690 Ga0496101_0015050
691 Ga0496101_0127979
692 Ga0496103_0035116
693 Ga0496103_0087422
694 Ga0496104_0036404
695 Ga0496105_0081767
696 Ga0496107_0235792
697 Ga0496108_0006061
698 Ga0496109_0046857
699 Ga0496110_0102256
700 Ga0496110_0116963
701 Ga0496111_0339793
702 Ga0496112_0004893
703 Ga0496112_0012804
704 Ga0496112_0031138
705 Ga0496112_0102257
706 Ga0496113_0011835
707 Ga0496113_0061887
708 Ga0496113_0537880
709 Ga0496114_0048421
710 Ga0496114_0050450
711 Ga0496115_0082899
712 Ga0496121_0001166
713 Ga0496121_0025885
714 Ga0501032_0010669
715 Ga0501034_0040359
716 Ga0501034_0142185
717 Ga0501036_0004603
718 Ga0501037_0023614
719 Ga0501038_0046801
720 Ga0501039_0050799
721 Ga0501039_0070309
722 Ga0501043_0049685
723 Ga0501046_0043439
724 Ga0501047_0148827
725 Ga0501048_0060061
726 Ga0501048_0127363
727 Ga0501067_0104785
728 Ga0501068_0030771
729 Ga0501069_0073489
730 Ga0501070_0159414
731 Ga0501070_0219226
732 Ga0501072_0356350
733 Ga0501073_0018378
734 Ga0501074_0023746
735 Ga0501075_0161696
736 Ga0501079_0205572
737 Ga0501080_0045778
738 Ga0501083_0033933
739 Ga0501035_0016593
740 Ga0501045_0237451
741 nmdc:mga09592_63283_c1
742 nmdc:mga06r32_221122_c1
743 nmdc:mga08y16_161454_c1
744 nmdc:mga08y16_760055_c1
745 Ga0495601_0030336
746 Ga0495595_0016780
747 Ga0495619_0037609
748 Ga0500556_0001523
749 Ga0500616_0005841
750 Ga0500599_002112
751 Ga0501084_0040915
752 Ga0501082_0074066
753 Ga0501082_0649961
754 Ga0466962_0000147
755 Ga0466962_0010828
756 Ga0466962_0084279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

72

145

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yh5-assembly3.cif.gz_F-2 mazg(mycobacterium tuberculosis) 0.9272 17 97
7yh5-assembly2.cif.gz_D mazg(mycobacterium tuberculosis) 0.851 1 98
7yh5-assembly3.cif.gz_E mazg(mycobacterium tuberculosis) 0.8271 1 98
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8265 13 96
7yh5-assembly1.cif.gz_A mazg(mycobacterium tuberculosis) 0.8205 1 98
ID Description Score Start End Superfamily
3craB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9325 13 98 1.10.287.1080
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9314 12 125 1.10.287.1080
3crcB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9263 12 98 1.10.287.1080
3crcA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9162 12 103 1.10.287.1080
3crcB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8859 12 98 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A6I2VET9-F1-model_v4 Nucleoside triphosphate pyrophosphohydrolase 0.965 5 130 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-X1KZ39-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9574 6 110 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A7J4M276-F1-model_v4 NUDIX domain-containing protein 0.9419 11 125 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A2G6GRL6-F1-model_v4 Nucleoside triphosphate pyrophosphohydrolase 0.9407 6 125 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-X1KZ39-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9398 6 110 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429

Map