F427777

General Info

Members Datasets Scaffolds Average Seq Length
377 174 754 329

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0034802|Ga0453683_0034802_1919_3103
Length 394
Sequence MAAFLTVLTHGYGVQSSVLISFTGSLNKLFANYQTKRRLFTAVPKYIHLALHNRIIYFQGIVIMPTLEHTAPSRNLALELARVTEAAALSAGRYMGRGDKEAADQAAVNAMRIVLQTVDMNGVIVIGEGEKDNAPMLYNGEVVGNGSEPDVDVAVDPIDGTRPLAFGRSNSLATVAIAPRGTMFNPGPFVYMNKLAVGPEAKGRINIEKSITDNLKAIAKAKNKSIEDLTAIILDRDRHSEMVKEIRNAGARLRQIPDGDVAAALMTAWPDSGVDVLIGIGGTPEGVIAACALRAMGGEIQGKLYARDEAELQRGHDAGYDFDKVLTMDDLVSSEDVFFAATGITDGELLQGVRYLGDGATTDSIVVRGLTGTVRQITATHRMDKLHYLSAVKY

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 1.33
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0034802 3300044673 Bacteria 3175
2 SwRhRL2b_contig_532328 2162886007 Bacteria 2759
3 rootL2_10254616 3300003322 Bacteria 2391
4 Ga0065707_10082710 3300005295 Bacteria 12558
5 Ga0070683_100399085 3300005329 Bacteria 1311
6 Ga0068869_100167832 3300005334 Bacteria 1713
7 Ga0068868_100120612 3300005338 Bacteria 2138
8 Ga0068868_100204275 3300005338 Bacteria 1648
9 Ga0070675_100125208 3300005354 Bacteria 2186
10 Ga0070710_10043020 3300005437 Bacteria 2500
11 Ga0070705_100157863 3300005440 Bacteria 1513
12 Ga0070708_100018467 3300005445 Bacteria 5837
13 Ga0070681_10074920 3300005458 Bacteria 3345
14 Ga0070681_10107802 3300005458 Bacteria 2726
15 Ga0070706_100036742 3300005467 Bacteria 4524
16 Ga0070706_100037484 3300005467 Bacteria 4477
17 Ga0070706_100056817 3300005467 Bacteria 3611
18 Ga0070706_100135974 3300005467 Bacteria 2294
19 Ga0070707_100151067 3300005468 Bacteria 2261
20 Ga0070707_100198105 3300005468 Unclassified 1958
21 Ga0070698_100050020 3300005471 Bacteria 4263
22 Ga0070698_100057620 3300005471 Bacteria 3931
23 Ga0070699_100146917 3300005518 Bacteria 2083
24 Ga0070699_100164213 3300005518 Bacteria 1966
25 Ga0070695_100027055 3300005545 Bacteria 3551
26 Ga0070696_100289650 3300005546 Bacteria 1251
27 Ga0070696_100298034 3300005546 Bacteria 1234
28 Ga0070704_100010583 3300005549 Bacteria 5616
29 Ga0068855_100070014 3300005563 Bacteria 4082
30 Ga0068854_100058929 3300005578 Bacteria 2774
31 Ga0068859_100074851 3300005617 Bacteria 3425
32 Ga0068859_100198327 3300005617 Bacteria 2091
33 Ga0068866_10027229 3300005718 Bacteria 2708
34 Ga0068861_100008968 3300005719 Bacteria 6893
35 Ga0068861_100036264 3300005719 Bacteria 3658
36 Ga0068861_100308836 3300005719 Bacteria 1373
37 Ga0068862_100026336 3300005844 Bacteria 4887
38 Ga0068862_100104419 3300005844 Bacteria 2482
39 Ga0068862_100276847 3300005844 Bacteria 1537
40 Ga0081455_10063165 3300005937 Bacteria 3108
41 Ga0081455_10077360 3300005937 Bacteria 2737
42 Ga0081538_10000030 3300005981 Bacteria 124321
43 Ga0081538_10000163 3300005981 Bacteria 70652
44 Ga0081538_10056751 3300005981 Bacteria 2290
45 Ga0081539_10000599 3300005985 Bacteria 73432
46 Ga0081539_10004394 3300005985 Bacteria 15630
47 Ga0081539_10005121 3300005985 Bacteria 13695
48 Ga0081539_10021086 3300005985 Bacteria 4369
49 Ga0075365_10113073 3300006038 Bacteria 1867
50 Ga0075363_100108544 3300006048 Bacteria 1541
51 Ga0075364_10014168 3300006051 Bacteria 4921
52 Ga0075364_10016404 3300006051 Bacteria 4608
53 Ga0075362_10018153 3300006177 Bacteria 2906
54 Ga0075428_100073252 3300006844 Bacteria 3740
55 Ga0075428_100177082 3300006844 Bacteria 2310
56 Ga0075428_100402243 3300006844 Bacteria 1467
57 Ga0075430_100152452 3300006846 Bacteria 1924
58 Ga0075430_100275306 3300006846 Bacteria 1393
59 Ga0075430_100300416 3300006846 Bacteria 1328
60 Ga0075431_100041013 3300006847 Bacteria 4772
61 Ga0075431_100054011 3300006847 Bacteria 4143
62 Ga0075431_100157404 3300006847 Bacteria 2337
63 Ga0075431_100299988 3300006847 Bacteria 1623
64 Ga0075433_10016175 3300006852 Bacteria 6138
65 Ga0075429_100002367 3300006880 Bacteria 15866
66 Ga0075429_100032678 3300006880 Bacteria 4522
67 Ga0075429_100055783 3300006880 Bacteria 3438
68 Ga0075429_100084535 3300006880 Bacteria 2766
69 Ga0075429_100106427 3300006880 Bacteria 2450
70 Ga0075429_100152259 3300006880 Bacteria 2025
71 Ga0068865_100012217 3300006881 Bacteria 5402
72 Ga0075436_100110239 3300006914 Bacteria 1921
73 Ga0097620_100074852 3300006931 Bacteria 3425
74 Ga0097620_100198342 3300006931 Bacteria 2091
75 Ga0075435_100004822 3300007076 Bacteria 9330
76 Ga0105240_10006422 3300009093 Bacteria 17279
77 Ga0105245_10377763 3300009098 Bacteria 1410
78 Ga0114129_10000864 3300009147 Bacteria 39418
79 Ga0114129_10038868 3300009147 Bacteria 6708
80 Ga0114129_10109508 3300009147 Bacteria 3813
81 Ga0114129_10216830 3300009147 Bacteria 2584
82 Ga0114129_10365416 3300009147 Bacteria 1908
83 Ga0114129_10448309 3300009147 Bacteria 1693
84 Ga0114129_10730616 3300009147 Bacteria 1269
85 Ga0105243_10085638 3300009148 Bacteria 2583
86 Ga0105243_10117158 3300009148 Bacteria 2239
87 Ga0105243_10132121 3300009148 Bacteria 2119
88 Ga0105242_10071822 3300009176 Bacteria 2873
89 Ga0105249_10035260 3300009553 Bacteria 4537
90 Ga0105249_10149065 3300009553 Bacteria 2250
91 Ga0105246_10210873 3300011119 Bacteria 1516
92 Ga0163161_10032658 3300017792 Bacteria 3718
93 Ga0207692_10022486 3300025898 Bacteria 2902
94 Ga0207647_10080984 3300025904 Bacteria 1946
95 Ga0207643_10100143 3300025908 Bacteria 1699
96 Ga0207684_10213271 3300025910 Bacteria 1665
97 Ga0207707_10071376 3300025912 Bacteria 3026
98 Ga0207657_10263830 3300025919 Bacteria 1370
99 Ga0207646_10089404 3300025922 Bacteria 2756
100 Ga0207646_10282965 3300025922 Bacteria 1499
101 Ga0207659_10079532 3300025926 Bacteria 2419
102 Ga0207687_10087461 3300025927 Bacteria 2265
103 Ga0207690_10055452 3300025932 Bacteria 2669
104 Ga0207690_10339259 3300025932 Bacteria 1185
105 Ga0207706_10057140 3300025933 Bacteria 3439
106 Ga0207709_10091876 3300025935 Bacteria 1986
107 Ga0207709_10259204 3300025935 Bacteria 1274
108 Ga0207709_10281891 3300025935 Bacteria 1228
109 Ga0207704_10290869 3300025938 Bacteria 1247
110 Ga0207689_10020952 3300025942 Bacteria 5495
111 Ga0207667_10131927 3300025949 Bacteria 2573
112 Ga0207712_10087668 3300025961 Bacteria 2283
113 Ga0207668_10040289 3300025972 Bacteria 3151
114 Ga0207668_10117610 3300025972 Bacteria 2007
115 Ga0207640_10097401 3300025981 Bacteria 2053
116 Ga0207677_10216373 3300026023 Bacteria 1533
117 Ga0207708_10050435 3300026075 Bacteria 3168
118 Ga0207648_10304896 3300026089 Bacteria 1429
119 Ga0207675_100010493 3300026118 Bacteria 8678
120 Ga0207675_100029181 3300026118 Bacteria 5141
121 Ga0207675_100076285 3300026118 Bacteria 3139
122 Ga0207428_10169640 3300027907 Bacteria 1653
123 Ga0268266_10078447 3300028379 Bacteria 2874
124 Ga0268265_10027326 3300028380 Bacteria 4072
125 Ga0268265_10218691 3300028380 Bacteria 1665
126 Ga0265319_1029173 3300028563 Bacteria 1938
127 Ga0265338_10041622 3300028800 Bacteria 4295
128 Ga0265320_10006031 3300031240 Bacteria 7695
129 Ga0307514_10003316 3300031649 Bacteria 15604
130 Ga0316579_10015381 3300031691 Bacteria 3322
131 Ga0265314_10014461 3300031711 Bacteria 6314
132 Ga0307405_10021778 3300031731 Bacteria 3610
133 Ga0307405_10025322 3300031731 Bacteria 3404
134 Ga0316577_10000609 3300031733 Bacteria 14759
135 Ga0316577_10001664 3300031733 Bacteria 10640
136 Ga0307413_10188872 3300031824 Bacteria 1477
137 Ga0307410_10042886 3300031852 Bacteria 2993
138 Ga0307406_10020728 3300031901 Bacteria 3877
139 Ga0307412_10267546 3300031911 Bacteria 1336
140 Ga0307409_100030810 3300031995 Bacteria 3860
141 Ga0307416_100014032 3300032002 Bacteria 5468
142 Ga0307416_100282633 3300032002 Bacteria 1637
143 Ga0307414_10057728 3300032004 Bacteria 2730
144 Ga0307411_10025531 3300032005 Bacteria 3542
145 Ga0307415_100045724 3300032126 Bacteria 2937
146 Ga0307415_100055904 3300032126 Bacteria 2703
147 Ga0307415_100181554 3300032126 Bacteria 1651
148 Ga0373923_0150850 3300035111 Bacteria 1056
149 Ga0373943_0311477 3300035170 Bacteria 896
150 Ga0316574_0003210 3300035398 Bacteria 8379
151 Ga0316582_0230065 3300036647 Bacteria 1269
152 Ga0316584_0010166 3300036712 Bacteria 6569
153 Ga0316584_0092949 3300036712 Bacteria 2258
154 Ga0316581_0020470 3300037588 Bacteria 1937
155 Ga0316581_0024873 3300037588 Bacteria 1778
156 Ga0395901_0005334 3300038443 Bacteria 12987
157 Ga0400483_007036 3300039062 Bacteria 33110
158 Ga0400483_239710 3300039062 Bacteria 13274
159 Ga0439466_0021987 3300041411 Bacteria 2255
160 Ga0451577_0001504 3300042876 Bacteria 30802
161 Ga0451577_0090181 3300042876 Bacteria 2736
162 Ga0453683_0001344 3300044673 Bacteria 21563
163 Ga0466966_0035347 3300044684 Bacteria 3228
164 Ga0466966_0065896 3300044684 Bacteria 2277
165 Ga0466961_0137069 3300044693 Bacteria 1533
166 Ga0466963_0034924 3300044694 Bacteria 3274
167 Ga0466963_0045410 3300044694 Bacteria 2894
168 Ga0466963_0089990 3300044694 Bacteria 2089
169 Ga0466963_0140260 3300044694 Bacteria 1674
170 Ga0453684_0001416 3300044712 Bacteria 69082
171 Ga0453684_0005812 3300044712 Bacteria 24031
172 Ga0453684_0007643 3300044712 Bacteria 19791
173 Ga0453684_0009141 3300044712 Bacteria 17440
174 Ga0453684_0018718 3300044712 Bacteria 10605
175 Ga0453684_0036874 3300044712 Bacteria 6727
176 Ga0453684_0083767 3300044712 Bacteria 3968
177 Ga0453684_0162739 3300044712 Bacteria 2638
178 Ga0453684_0325259 3300044712 Bacteria 1740
179 Ga0453684_0474319 3300044712 Bacteria 1389
180 Ga0466971_0100610 3300044719 Bacteria 1328
181 Ga0466957_0035297 3300044842 Bacteria 3001
182 Ga0466960_0017427 3300044901 Bacteria 3131
183 Ga0466959_0000607 3300045049 Bacteria 20899
184 Ga0451576_0022853 3300045051 Bacteria 6775
185 Ga0451576_0323481 3300045051 Bacteria 1614
186 Ga0451576_0472044 3300045051 Bacteria 1318
187 Ga0466958_0008765 3300045836 Bacteria 5617
188 Ga0466958_0036008 3300045836 Bacteria 2960
189 Ga0466958_0116525 3300045836 Bacteria 1670
190 Ga0466967_0017989 3300045976 Bacteria 5634
191 Ga0466967_0091627 3300045976 Bacteria 2763
192 Ga0466967_0117048 3300045976 Bacteria 2456
193 Ga0466967_0188288 3300045976 Bacteria 1949
194 Ga0466967_0330749 3300045976 Bacteria 1471
195 Ga0466967_0330937 3300045976 Bacteria 1471
196 Ga0495618_0000121 3300046514 Bacteria 57296
197 Ga0495630_0131860 3300046517 Bacteria 1898
198 Ga0495647_0017746 3300046681 Bacteria 2523
199 Ga0495613_0282647 3300046689 Bacteria 1152
200 Ga0495581_0072274 3300047315 Bacteria 1996
201 Ga0495604_0000079 3300047317 Bacteria 83218
202 Ga0496106_0328156 3300048909 Bacteria 1228
203 Ga0496106_0374657 3300048909 Bacteria 1144
204 Ga0496108_0105161 3300048911 Bacteria 2410
205 Ga0496109_0163482 3300048912 Bacteria 2086
206 Ga0496114_0001004 3300048917 Bacteria 21162
207 Ga0501031_0005736 3300049568 Bacteria 8092
208 Ga0501031_0051717 3300049568 Bacteria 2676
209 Ga0501032_0018780 3300049569 Bacteria 4838
210 Ga0501033_0008272 3300049570 Bacteria 8057
211 Ga0501033_0084039 3300049570 Bacteria 2333
212 Ga0501034_0003963 3300049571 Bacteria 16637
213 Ga0501036_0006578 3300049572 Bacteria 9441
214 Ga0501036_0013498 3300049572 Bacteria 6789
215 Ga0501036_0014501 3300049572 Bacteria 6564
216 Ga0501036_0064175 3300049572 Bacteria 3109
217 Ga0501036_0281731 3300049572 Bacteria 1391
218 Ga0501037_0025778 3300049573 Bacteria 4342
219 Ga0501038_0006245 3300049574 Bacteria 11013
220 Ga0501038_0020416 3300049574 Bacteria 5955
221 Ga0501038_0064657 3300049574 Bacteria 3119
222 Ga0501039_0000422 3300049575 Bacteria 30466
223 Ga0501039_0002726 3300049575 Bacteria 13174
224 Ga0501039_0015946 3300049575 Bacteria 5753
225 Ga0501039_0045521 3300049575 Bacteria 3390
226 Ga0501039_0179696 3300049575 Bacteria 1664
227 Ga0501040_0001679 3300049576 Bacteria 14174
228 Ga0501040_0022978 3300049576 Bacteria 4178
229 Ga0501040_0023360 3300049576 Bacteria 4146
230 Ga0501040_0029361 3300049576 Bacteria 3711
231 Ga0501040_0066148 3300049576 Bacteria 2490
232 Ga0501041_0001417 3300049577 Bacteria 13236
233 Ga0501041_0011139 3300049577 Bacteria 5310
234 Ga0501041_0011275 3300049577 Bacteria 5283
235 Ga0501041_0037408 3300049577 Bacteria 2941
236 Ga0501042_0001250 3300049578 Bacteria 14799
237 Ga0501042_0012252 3300049578 Bacteria 5803
238 Ga0501042_0015118 3300049578 Bacteria 5277
239 Ga0501042_0020549 3300049578 Bacteria 4597
240 Ga0501042_0049218 3300049578 Bacteria 3006
241 Ga0501042_0065911 3300049578 Bacteria 2588
242 Ga0501042_0082403 3300049578 Bacteria 2306
243 Ga0501043_0008116 3300049579 Bacteria 8286
244 Ga0501046_0004036 3300049580 Bacteria 13397
245 Ga0501046_0004619 3300049580 Bacteria 12438
246 Ga0501046_0005910 3300049580 Bacteria 10904
247 Ga0501046_0088103 3300049580 Bacteria 2391
248 Ga0501046_0157672 3300049580 Bacteria 1709
249 Ga0501048_0000524 3300049582 Bacteria 26977
250 Ga0501048_0002853 3300049582 Bacteria 13192
251 Ga0501048_0004335 3300049582 Bacteria 10803
252 Ga0501048_0042335 3300049582 Bacteria 3261
253 Ga0501048_0088818 3300049582 Bacteria 2180
254 Ga0501068_0005264 3300049584 Bacteria 7064
255 Ga0501068_0024131 3300049584 Bacteria 3569
256 Ga0501068_0034775 3300049584 Bacteria 3007
257 Ga0501069_0013168 3300049585 Bacteria 4407
258 Ga0501070_0058830 3300049586 Bacteria 3186
259 Ga0501071_0001875 3300049587 Bacteria 12478
260 Ga0501071_0004204 3300049587 Bacteria 9114
261 Ga0501071_0008068 3300049587 Bacteria 6947
262 Ga0501071_0021428 3300049587 Bacteria 4500
263 Ga0501071_0022103 3300049587 Bacteria 4432
264 Ga0501071_0022188 3300049587 Bacteria 4425
265 Ga0501071_0133414 3300049587 Bacteria 1846
266 Ga0501071_0172975 3300049587 Bacteria 1617
267 Ga0501071_0204934 3300049587 Bacteria 1482
268 Ga0501071_0226377 3300049587 Bacteria 1408
269 Ga0501071_0347017 3300049587 Bacteria 1129
270 Ga0501072_0000925 3300049588 Bacteria 21583
271 Ga0501072_0002462 3300049588 Bacteria 13855
272 Ga0501072_0013854 3300049588 Bacteria 6177
273 Ga0501072_0023950 3300049588 Bacteria 4745
274 Ga0501072_0044975 3300049588 Bacteria 3471
275 Ga0501072_0053985 3300049588 Bacteria 3165
276 Ga0501072_0071712 3300049588 Bacteria 2737
277 Ga0501072_0222117 3300049588 Bacteria 1505
278 Ga0501073_0032830 3300049589 Bacteria 3700
279 Ga0501074_0003461 3300049590 Bacteria 11201
280 Ga0501074_0018175 3300049590 Bacteria 5106
281 Ga0501074_0031505 3300049590 Bacteria 3841
282 Ga0501074_0124133 3300049590 Bacteria 1846
283 Ga0501074_0173835 3300049590 Bacteria 1537
284 Ga0501075_0003096 3300049591 Bacteria 11110
285 Ga0501075_0008368 3300049591 Bacteria 7214
286 Ga0501075_0009258 3300049591 Bacteria 6888
287 Ga0501075_0025107 3300049591 Bacteria 4376
288 Ga0501075_0040707 3300049591 Bacteria 3481
289 Ga0501075_0046212 3300049591 Bacteria 3270
290 Ga0501076_0002989 3300049592 Bacteria 11742
291 Ga0501076_0005117 3300049592 Bacteria 9385
292 Ga0501076_0008761 3300049592 Bacteria 7433
293 Ga0501076_0013549 3300049592 Bacteria 6113
294 Ga0501076_0022298 3300049592 Bacteria 4866
295 Ga0501076_0050914 3300049592 Bacteria 3277
296 Ga0501076_0058071 3300049592 Bacteria 3074
297 Ga0501076_0067326 3300049592 Bacteria 2859
298 Ga0501076_0077215 3300049592 Bacteria 2672
299 Ga0501076_0081837 3300049592 Bacteria 2592
300 Ga0501076_0098839 3300049592 Bacteria 2351
301 Ga0501077_0002555 3300049593 Bacteria 10911
302 Ga0501077_0068328 3300049593 Bacteria 2252
303 Ga0501077_0173575 3300049593 Bacteria 1370
304 Ga0501079_0000791 3300049741 Bacteria 21538
305 Ga0501079_0003792 3300049741 Bacteria 11162
306 Ga0501079_0014984 3300049741 Bacteria 5909
307 Ga0501079_0047871 3300049741 Bacteria 3299
308 Ga0501079_0248034 3300049741 Bacteria 1391
309 Ga0501080_0007559 3300049742 Bacteria 9823
310 Ga0501080_0120231 3300049742 Bacteria 2435
311 Ga0501081_0002098 3300049743 Bacteria 12454
312 Ga0501081_0004516 3300049743 Bacteria 8935
313 Ga0501081_0010918 3300049743 Bacteria 5937
314 Ga0501081_0047491 3300049743 Bacteria 2953
315 Ga0501081_0119923 3300049743 Bacteria 1872
316 Ga0501081_0124148 3300049743 Bacteria 1841
317 Ga0501081_0134681 3300049743 Bacteria 1768
318 Ga0501081_0249143 3300049743 Bacteria 1296
319 Ga0501083_0013512 3300049744 Bacteria 5708
320 Ga0501083_0181947 3300049744 Bacteria 1372
321 Ga0501035_0001788 3300049822 Bacteria 21722
322 Ga0501044_0294437 3300049823 Bacteria 1554
323 Ga0501045_0001078 3300049824 Bacteria 18021
324 Ga0501045_0001578 3300049824 Bacteria 15191
325 Ga0501045_0019368 3300049824 Bacteria 4850
326 Ga0501045_0037038 3300049824 Bacteria 3545
327 Ga0501045_0163219 3300049824 Bacteria 1659
328 Ga0501045_0236085 3300049824 Bacteria 1361
329 nmdc:mga03683_12723_c1 3300050489 Bacteria 2495
330 nmdc:mga03n38_68351_c1 3300050490 Bacteria 1638
331 nmdc:mga00v17_11183_c1 3300050491 Bacteria 4929
332 nmdc:mga00v17_7402_c1 3300050491 Bacteria 5856
333 nmdc:mga0yw44_37166_c1 3300050492 Bacteria 2874
334 nmdc:mga06z11_83438_c1 3300050494 Bacteria 1720
335 nmdc:mga05p37_12628_c1 3300050507 Bacteria 10087
336 nmdc:mga05p37_583639_c1 3300050507 Bacteria 1265
337 nmdc:mga05p37_61295_c1 3300050507 Bacteria 4631
338 nmdc:mga09592_16573_c1 3300050508 Bacteria 6030
339 nmdc:mga09592_3031_c1 3300050508 Bacteria 13624
340 nmdc:mga09592_49933_c1 3300050508 Bacteria 3528
341 nmdc:mga09592_85630_c1 3300050508 Bacteria 2688
342 nmdc:mga0qj67_126510_c1 3300050509 Bacteria 2068
343 nmdc:mga0qj67_54051_c1 3300050509 Bacteria 3180
344 nmdc:mga06r32_163157_c1 3300050510 Bacteria 2211
345 nmdc:mga06r32_19750_c1 3300050510 Bacteria 6192
346 nmdc:mga06r32_267985_c1 3300050510 Unclassified 1695
347 nmdc:mga08y16_94841_c1 3300050511 Bacteria 3108
348 nmdc:mga0rr50_113647_c1 3300050513 Bacteria 2146
349 nmdc:mga08x19_161478_c1 3300050514 Bacteria 1522
350 nmdc:mga0a205_14206_c1 3300050515 Bacteria 7426
351 Ga0495619_0040944 3300053085 Bacteria 3029
352 Ga0500568_0006549 3300053139 Bacteria 5831
353 Ga0500616_0000455 3300053153 Bacteria 53577
354 Ga0501084_0001189 3300054114 Bacteria 20370
355 Ga0501084_0024651 3300054114 Bacteria 5020
356 Ga0501084_0026383 3300054114 Bacteria 4848
357 Ga0501084_0069326 3300054114 Bacteria 2952
358 Ga0501084_0118517 3300054114 Bacteria 2225
359 Ga0501084_0365987 3300054114 Bacteria 1218
360 Ga0501082_0005822 3300060353 Bacteria 10702
361 Ga0501082_0007198 3300060353 Bacteria 9590
362 Ga0501082_0012655 3300060353 Bacteria 7252
363 Ga0501082_0031746 3300060353 Bacteria 4555
364 Ga0501082_0269872 3300060353 Bacteria 1481
365 Ga0501082_0421977 3300060353 Bacteria 1165
366 Ga0466962_0031839 3300061719 Bacteria 2525
367 Ga0530510_0002311 3300061734 Bacteria 13064
368 Ga0530510_0003749 3300061734 Bacteria 10465
369 Ga0530510_0011747 3300061734 Bacteria 6146
370 Ga0530510_0021592 3300061734 Bacteria 4580
371 Ga0530510_0041719 3300061734 Bacteria 3313
372 Ga0530510_0056722 3300061734 Bacteria 2830
373 Ga0530510_0166392 3300061734 Bacteria 1632
374 Ga0530510_0166971 3300061734 Bacteria 1629
375 Ga0530510_0189399 3300061734 Bacteria 1527
376 Ga0530510_0500270 3300061734 Bacteria 921
377 2939658909 2939657138 Bacteria 3740283
378 Ga0453683_0034802
379 SwRhRL2b_contig_532328
380 rootL2_10254616
381 Ga0065707_10082710
382 Ga0070683_100399085
383 Ga0068869_100167832
384 Ga0068868_100120612
385 Ga0068868_100204275
386 Ga0070675_100125208
387 Ga0070710_10043020
388 Ga0070705_100157863
389 Ga0070708_100018467
390 Ga0070681_10074920
391 Ga0070681_10107802
392 Ga0070706_100036742
393 Ga0070706_100037484
394 Ga0070706_100056817
395 Ga0070706_100135974
396 Ga0070707_100151067
397 Ga0070707_100198105
398 Ga0070698_100050020
399 Ga0070698_100057620
400 Ga0070699_100146917
401 Ga0070699_100164213
402 Ga0070695_100027055
403 Ga0070696_100289650
404 Ga0070696_100298034
405 Ga0070704_100010583
406 Ga0068855_100070014
407 Ga0068854_100058929
408 Ga0068859_100074851
409 Ga0068859_100198327
410 Ga0068866_10027229
411 Ga0068861_100008968
412 Ga0068861_100036264
413 Ga0068861_100308836
414 Ga0068862_100026336
415 Ga0068862_100104419
416 Ga0068862_100276847
417 Ga0081455_10063165
418 Ga0081455_10077360
419 Ga0081538_10000030
420 Ga0081538_10000163
421 Ga0081538_10056751
422 Ga0081539_10000599
423 Ga0081539_10004394
424 Ga0081539_10005121
425 Ga0081539_10021086
426 Ga0075365_10113073
427 Ga0075363_100108544
428 Ga0075364_10014168
429 Ga0075364_10016404
430 Ga0075362_10018153
431 Ga0075428_100073252
432 Ga0075428_100177082
433 Ga0075428_100402243
434 Ga0075430_100152452
435 Ga0075430_100275306
436 Ga0075430_100300416
437 Ga0075431_100041013
438 Ga0075431_100054011
439 Ga0075431_100157404
440 Ga0075431_100299988
441 Ga0075433_10016175
442 Ga0075429_100002367
443 Ga0075429_100032678
444 Ga0075429_100055783
445 Ga0075429_100084535
446 Ga0075429_100106427
447 Ga0075429_100152259
448 Ga0068865_100012217
449 Ga0075436_100110239
450 Ga0097620_100074852
451 Ga0097620_100198342
452 Ga0075435_100004822
453 Ga0105240_10006422
454 Ga0105245_10377763
455 Ga0114129_10000864
456 Ga0114129_10038868
457 Ga0114129_10109508
458 Ga0114129_10216830
459 Ga0114129_10365416
460 Ga0114129_10448309
461 Ga0114129_10730616
462 Ga0105243_10085638
463 Ga0105243_10117158
464 Ga0105243_10132121
465 Ga0105242_10071822
466 Ga0105249_10035260
467 Ga0105249_10149065
468 Ga0105246_10210873
469 Ga0163161_10032658
470 Ga0207692_10022486
471 Ga0207647_10080984
472 Ga0207643_10100143
473 Ga0207684_10213271
474 Ga0207707_10071376
475 Ga0207657_10263830
476 Ga0207646_10089404
477 Ga0207646_10282965
478 Ga0207659_10079532
479 Ga0207687_10087461
480 Ga0207690_10055452
481 Ga0207690_10339259
482 Ga0207706_10057140
483 Ga0207709_10091876
484 Ga0207709_10259204
485 Ga0207709_10281891
486 Ga0207704_10290869
487 Ga0207689_10020952
488 Ga0207667_10131927
489 Ga0207712_10087668
490 Ga0207668_10040289
491 Ga0207668_10117610
492 Ga0207640_10097401
493 Ga0207677_10216373
494 Ga0207708_10050435
495 Ga0207648_10304896
496 Ga0207675_100010493
497 Ga0207675_100029181
498 Ga0207675_100076285
499 Ga0207428_10169640
500 Ga0268266_10078447
501 Ga0268265_10027326
502 Ga0268265_10218691
503 Ga0265319_1029173
504 Ga0265338_10041622
505 Ga0265320_10006031
506 Ga0307514_10003316
507 Ga0316579_10015381
508 Ga0265314_10014461
509 Ga0307405_10021778
510 Ga0307405_10025322
511 Ga0316577_10000609
512 Ga0316577_10001664
513 Ga0307413_10188872
514 Ga0307410_10042886
515 Ga0307406_10020728
516 Ga0307412_10267546
517 Ga0307409_100030810
518 Ga0307416_100014032
519 Ga0307416_100282633
520 Ga0307414_10057728
521 Ga0307411_10025531
522 Ga0307415_100045724
523 Ga0307415_100055904
524 Ga0307415_100181554
525 Ga0373923_0150850
526 Ga0373943_0311477
527 Ga0316574_0003210
528 Ga0316582_0230065
529 Ga0316584_0010166
530 Ga0316584_0092949
531 Ga0316581_0020470
532 Ga0316581_0024873
533 Ga0395901_0005334
534 Ga0400483_007036
535 Ga0400483_239710
536 Ga0439466_0021987
537 Ga0451577_0001504
538 Ga0451577_0090181
539 Ga0453683_0001344
540 Ga0466966_0035347
541 Ga0466966_0065896
542 Ga0466961_0137069
543 Ga0466963_0034924
544 Ga0466963_0045410
545 Ga0466963_0089990
546 Ga0466963_0140260
547 Ga0453684_0001416
548 Ga0453684_0005812
549 Ga0453684_0007643
550 Ga0453684_0009141
551 Ga0453684_0018718
552 Ga0453684_0036874
553 Ga0453684_0083767
554 Ga0453684_0162739
555 Ga0453684_0325259
556 Ga0453684_0474319
557 Ga0466971_0100610
558 Ga0466957_0035297
559 Ga0466960_0017427
560 Ga0466959_0000607
561 Ga0451576_0022853
562 Ga0451576_0323481
563 Ga0451576_0472044
564 Ga0466958_0008765
565 Ga0466958_0036008
566 Ga0466958_0116525
567 Ga0466967_0017989
568 Ga0466967_0091627
569 Ga0466967_0117048
570 Ga0466967_0188288
571 Ga0466967_0330749
572 Ga0466967_0330937
573 Ga0495618_0000121
574 Ga0495630_0131860
575 Ga0495647_0017746
576 Ga0495613_0282647
577 Ga0495581_0072274
578 Ga0495604_0000079
579 Ga0496106_0328156
580 Ga0496106_0374657
581 Ga0496108_0105161
582 Ga0496109_0163482
583 Ga0496114_0001004
584 Ga0501031_0005736
585 Ga0501031_0051717
586 Ga0501032_0018780
587 Ga0501033_0008272
588 Ga0501033_0084039
589 Ga0501034_0003963
590 Ga0501036_0006578
591 Ga0501036_0013498
592 Ga0501036_0014501
593 Ga0501036_0064175
594 Ga0501036_0281731
595 Ga0501037_0025778
596 Ga0501038_0006245
597 Ga0501038_0020416
598 Ga0501038_0064657
599 Ga0501039_0000422
600 Ga0501039_0002726
601 Ga0501039_0015946
602 Ga0501039_0045521
603 Ga0501039_0179696
604 Ga0501040_0001679
605 Ga0501040_0022978
606 Ga0501040_0023360
607 Ga0501040_0029361
608 Ga0501040_0066148
609 Ga0501041_0001417
610 Ga0501041_0011139
611 Ga0501041_0011275
612 Ga0501041_0037408
613 Ga0501042_0001250
614 Ga0501042_0012252
615 Ga0501042_0015118
616 Ga0501042_0020549
617 Ga0501042_0049218
618 Ga0501042_0065911
619 Ga0501042_0082403
620 Ga0501043_0008116
621 Ga0501046_0004036
622 Ga0501046_0004619
623 Ga0501046_0005910
624 Ga0501046_0088103
625 Ga0501046_0157672
626 Ga0501048_0000524
627 Ga0501048_0002853
628 Ga0501048_0004335
629 Ga0501048_0042335
630 Ga0501048_0088818
631 Ga0501068_0005264
632 Ga0501068_0024131
633 Ga0501068_0034775
634 Ga0501069_0013168
635 Ga0501070_0058830
636 Ga0501071_0001875
637 Ga0501071_0004204
638 Ga0501071_0008068
639 Ga0501071_0021428
640 Ga0501071_0022103
641 Ga0501071_0022188
642 Ga0501071_0133414
643 Ga0501071_0172975
644 Ga0501071_0204934
645 Ga0501071_0226377
646 Ga0501071_0347017
647 Ga0501072_0000925
648 Ga0501072_0002462
649 Ga0501072_0013854
650 Ga0501072_0023950
651 Ga0501072_0044975
652 Ga0501072_0053985
653 Ga0501072_0071712
654 Ga0501072_0222117
655 Ga0501073_0032830
656 Ga0501074_0003461
657 Ga0501074_0018175
658 Ga0501074_0031505
659 Ga0501074_0124133
660 Ga0501074_0173835
661 Ga0501075_0003096
662 Ga0501075_0008368
663 Ga0501075_0009258
664 Ga0501075_0025107
665 Ga0501075_0040707
666 Ga0501075_0046212
667 Ga0501076_0002989
668 Ga0501076_0005117
669 Ga0501076_0008761
670 Ga0501076_0013549
671 Ga0501076_0022298
672 Ga0501076_0050914
673 Ga0501076_0058071
674 Ga0501076_0067326
675 Ga0501076_0077215
676 Ga0501076_0081837
677 Ga0501076_0098839
678 Ga0501077_0002555
679 Ga0501077_0068328
680 Ga0501077_0173575
681 Ga0501079_0000791
682 Ga0501079_0003792
683 Ga0501079_0014984
684 Ga0501079_0047871
685 Ga0501079_0248034
686 Ga0501080_0007559
687 Ga0501080_0120231
688 Ga0501081_0002098
689 Ga0501081_0004516
690 Ga0501081_0010918
691 Ga0501081_0047491
692 Ga0501081_0119923
693 Ga0501081_0124148
694 Ga0501081_0134681
695 Ga0501081_0249143
696 Ga0501083_0013512
697 Ga0501083_0181947
698 Ga0501035_0001788
699 Ga0501044_0294437
700 Ga0501045_0001078
701 Ga0501045_0001578
702 Ga0501045_0019368
703 Ga0501045_0037038
704 Ga0501045_0163219
705 Ga0501045_0236085
706 nmdc:mga03683_12723_c1
707 nmdc:mga03n38_68351_c1
708 nmdc:mga00v17_11183_c1
709 nmdc:mga00v17_7402_c1
710 nmdc:mga0yw44_37166_c1
711 nmdc:mga06z11_83438_c1
712 nmdc:mga05p37_12628_c1
713 nmdc:mga05p37_583639_c1
714 nmdc:mga05p37_61295_c1
715 nmdc:mga09592_16573_c1
716 nmdc:mga09592_3031_c1
717 nmdc:mga09592_49933_c1
718 nmdc:mga09592_85630_c1
719 nmdc:mga0qj67_126510_c1
720 nmdc:mga0qj67_54051_c1
721 nmdc:mga06r32_163157_c1
722 nmdc:mga06r32_19750_c1
723 nmdc:mga06r32_267985_c1
724 nmdc:mga08y16_94841_c1
725 nmdc:mga0rr50_113647_c1
726 nmdc:mga08x19_161478_c1
727 nmdc:mga0a205_14206_c1
728 Ga0495619_0040944
729 Ga0500568_0006549
730 Ga0500616_0000455
731 Ga0501084_0001189
732 Ga0501084_0024651
733 Ga0501084_0026383
734 Ga0501084_0069326
735 Ga0501084_0118517
736 Ga0501084_0365987
737 Ga0501082_0005822
738 Ga0501082_0007198
739 Ga0501082_0012655
740 Ga0501082_0031746
741 Ga0501082_0269872
742 Ga0501082_0421977
743 Ga0466962_0031839
744 Ga0530510_0002311
745 Ga0530510_0003749
746 Ga0530510_0011747
747 Ga0530510_0021592
748 Ga0530510_0041719
749 Ga0530510_0056722
750 Ga0530510_0166392
751 Ga0530510_0166971
752 Ga0530510_0189399
753 Ga0530510_0500270
754 2939658909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03320

FBPase_glpX

Bacterial fructose-1,6-bisphosphatase, glpX-encoded

74

381

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
7txb-assembly2.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp 0.9783 16 319
7txb-assembly2.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp 0.972 16 319
2r8t-assembly1.cif.gz_A crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate 0.9616 10 319
3bih-assembly1.cif.gz_A crystal structure of fructose-1,6-bisphosphatase from e.coli glpx 0.959 10 319
3d1r-assembly1.cif.gz_A structure of e. coli glpx with its substrate fructose 1,6-bisphosphate 0.9577 10 317
ID Description Score Start End Superfamily
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9755 117 271 3.40.190.90
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9694 117 271 3.40.190.90
1ni9A01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9359 10 320 3.30.540.10
2r8tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9325 117 270 3.40.190.90
3rplA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9208 117 271 3.40.190.90
ID Description Score Start End GO Terms
AF-A0A2M7PVF3-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9946 129 215 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-H0URJ6-F1-model_v4 Fructose-1,6-bisphosphatase 0.9896 12 330 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
GO:0046872
AF-A0A7K0PPN2-F1-model_v4 Fructose-1,6-bisphosphatase 0.989 6 319 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
GO:0046872
AF-A0A094S830-F1-model_v4 Fructose-bisphosphatase 0.9882 35 319 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A6J6A0T0-F1-model_v4 Unannotated protein 0.988 72 318 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132

Map