F427152

General Info

Members Datasets Scaffolds Average Seq Length
375 205 750 198

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0102004|Ga0495667_0102004_31_696
Length 221
Sequence LVQPRPAQTGTNGAKLHPSGISDGAPSGPAQPEILTEILSRADIGRTIDRIAHQILERNGDRPVVLLGIPTRGVYLARRLGGRLTAFTGRPTAVGSLDITLYRDDLRRHPPRALEETRLPVGGVDDAIVVLVDDVLYSGRTIRAALDALRDHGRPAVVQLAVLVDRGHRQLPIRADYVGKNIPTAFGDDVAVHLVEIDSVDSVELARAVPTSAAPLHEGAS

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
191 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
192 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
193 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
194 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
195 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
196 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
197 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
198 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
199 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
200 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
201 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
202 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
203 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
204 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
205 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.93
Metatranscriptomes 0.8
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 5.33
Rhizosphere 88.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0102004 3300046559 Bacteria 1856
2 JGI25406J46586_10003562 3300003203 Bacteria 7301
3 JGI25405J52794_10010092 3300003911 Bacteria 1791
4 Ga0070658_10007141 3300005327 Bacteria 9018
5 Ga0070658_10141137 3300005327 Bacteria 2013
6 Ga0070658_10479123 3300005327 Bacteria 1074
7 Ga0070683_100426929 3300005329 Bacteria 1265
8 Ga0070683_100778623 3300005329 Bacteria 917
9 Ga0070670_100378348 3300005331 Bacteria 1247
10 Ga0068869_100007529 3300005334 Bacteria 6966
11 Ga0070682_100045393 3300005337 Bacteria 2724
12 Ga0070682_100624848 3300005337 Bacteria 854
13 Ga0068868_100008993 3300005338 Bacteria 7169
14 Ga0068868_100181625 3300005338 Bacteria 1746
15 Ga0070660_100035169 3300005339 Bacteria 3791
16 Ga0070689_101005669 3300005340 Bacteria 742
17 Ga0070687_100118924 3300005343 Bacteria 1508
18 Ga0070692_10010169 3300005345 Bacteria 4272
19 Ga0070692_10164492 3300005345 Bacteria 1274
20 Ga0070668_100064405 3300005347 Bacteria 2842
21 Ga0070668_100516189 3300005347 Bacteria 1036
22 Ga0070668_100661233 3300005347 Bacteria 919
23 Ga0070669_100074521 3300005353 Bacteria 2516
24 Ga0070675_100007831 3300005354 Bacteria 8280
25 Ga0070671_100011593 3300005355 Bacteria 7093
26 Ga0070671_100732418 3300005355 Bacteria 859
27 Ga0070674_101013523 3300005356 Bacteria 729
28 Ga0070659_100013501 3300005366 Bacteria 6081
29 Ga0070667_100274425 3300005367 Bacteria 1512
30 Ga0070714_100003398 3300005435 Bacteria 11863
31 Ga0070714_101104701 3300005435 Bacteria 773
32 Ga0070713_100288047 3300005436 Bacteria 1508
33 Ga0070700_100019325 3300005441 Bacteria 3930
34 Ga0070663_100112675 3300005455 Bacteria 2046
35 Ga0070663_100253822 3300005455 Bacteria 1393
36 Ga0070678_100155633 3300005456 Bacteria 1846
37 Ga0070678_100163772 3300005456 Bacteria 1804
38 Ga0070662_100006428 3300005457 Bacteria 7573
39 Ga0070662_100159274 3300005457 Bacteria 1765
40 Ga0070662_100248555 3300005457 Bacteria 1429
41 Ga0070685_10252430 3300005466 Bacteria 1169
42 Ga0070679_100037798 3300005530 Bacteria 4797
43 Ga0070679_100127105 3300005530 Bacteria 2531
44 Ga0070679_100470228 3300005530 Bacteria 1201
45 Ga0070679_100535800 3300005530 Bacteria 1115
46 Ga0070684_100064651 3300005535 Bacteria 3210
47 Ga0070684_100077749 3300005535 Bacteria 2931
48 Ga0070684_100140336 3300005535 Bacteria 2185
49 Ga0070684_100183484 3300005535 Bacteria 1903
50 Ga0070684_100614661 3300005535 Bacteria 1011
51 Ga0068853_100794749 3300005539 Bacteria 906
52 Ga0070693_100101616 3300005547 Bacteria 1753
53 Ga0070665_100001013 3300005548 Bacteria 35403
54 Ga0070665_100022861 3300005548 Bacteria 6294
55 Ga0070665_100309301 3300005548 Bacteria 1584
56 Ga0070664_100003880 3300005564 Bacteria 12066
57 Ga0070664_100089516 3300005564 Bacteria 2663
58 Ga0068857_100230492 3300005577 Bacteria 1694
59 Ga0068857_100448655 3300005577 Bacteria 1206
60 Ga0068857_100898957 3300005577 Bacteria 849
61 Ga0068854_100058583 3300005578 Bacteria 2781
62 Ga0068852_100186514 3300005616 Bacteria 1954
63 Ga0068852_100685666 3300005616 Bacteria 1034
64 Ga0068852_101209524 3300005616 Bacteria 777
65 Ga0068864_100144213 3300005618 Bacteria 2151
66 Ga0068864_100154317 3300005618 Bacteria 2083
67 Ga0068864_100185712 3300005618 Bacteria 1903
68 Ga0068864_100316890 3300005618 Bacteria 1464
69 Ga0068851_10173391 3300005834 Bacteria 1191
70 Ga0068851_10321079 3300005834 Bacteria 895
71 Ga0068870_10153181 3300005840 Bacteria 1360
72 Ga0068863_100010187 3300005841 Bacteria 9141
73 Ga0068863_100031788 3300005841 Bacteria 5036
74 Ga0068858_100079755 3300005842 Bacteria 3041
75 Ga0068858_100394194 3300005842 Bacteria 1330
76 Ga0068860_100100492 3300005843 Bacteria 2759
77 Ga0068862_100019122 3300005844 Bacteria 5712
78 Ga0081455_10002532 3300005937 Bacteria 21716
79 Ga0081455_10003790 3300005937 Bacteria 17256
80 Ga0081455_10171149 3300005937 Bacteria 1654
81 Ga0081455_10211090 3300005937 Bacteria 1446
82 Ga0081539_10000806 3300005985 Bacteria 61012
83 Ga0081539_10057894 3300005985 Bacteria 2141
84 Ga0081539_10064117 3300005985 Bacteria 2001
85 Ga0070717_10019897 3300006028 Bacteria 5271
86 Ga0075365_10246294 3300006038 Bacteria 1255
87 Ga0075369_10017405 3300006186 Bacteria 2912
88 Ga0097621_100330580 3300006237 Bacteria 1352
89 Ga0075370_10021573 3300006353 Bacteria 3529
90 Ga0075428_100170470 3300006844 Bacteria 2360
91 Ga0075428_100922506 3300006844 Bacteria 926
92 Ga0075430_100000139 3300006846 Bacteria 46337
93 Ga0075430_100002154 3300006846 Bacteria 16297
94 Ga0075431_100029946 3300006847 Bacteria 5605
95 Ga0111539_10333615 3300009094 Bacteria 1765
96 Ga0105245_10020207 3300009098 Bacteria 5838
97 Ga0114129_10007033 3300009147 Bacteria 16019
98 Ga0105243_10157484 3300009148 Bacteria 1955
99 Ga0105243_11328944 3300009148 Bacteria 737
100 Ga0105237_11308965 3300009545 Bacteria 731
101 Ga0105239_10804564 3300010375 Bacteria 1077
102 Ga0105246_10081023 3300011119 Bacteria 2312
103 Ga0105246_10327241 3300011119 Bacteria 1248
104 Ga0157316_1029970 3300012510 Bacteria 653
105 Ga0157371_10612812 3300013102 Bacteria 810
106 Ga0157374_10068217 3300013296 Bacteria 3345
107 Ga0157378_10672942 3300013297 Bacteria 1052
108 Ga0163162_11208927 3300013306 Bacteria 858
109 Ga0157372_11213467 3300013307 Bacteria 871
110 Ga0157375_10103252 3300013308 Bacteria 2937
111 Ga0157375_11738524 3300013308 Bacteria 739
112 Ga0163163_10363423 3300014325 Bacteria 1504
113 Ga0163163_10643523 3300014325 Bacteria 1124
114 Ga0157377_10588524 3300014745 Bacteria 792
115 Ga0157379_10013934 3300014968 Bacteria 7047
116 Ga0197907_10454703 3300020069 Bacteria 2472
117 Ga0197907_10618641 3300020069 Bacteria 1923
118 Ga0206354_11059424 3300020081 Bacteria 2526
119 Ga0207688_10045554 3300025901 Bacteria 2447
120 Ga0207705_10019550 3300025909 Bacteria 4842
121 Ga0207705_10116653 3300025909 Bacteria 1977
122 Ga0207660_10001142 3300025917 Bacteria 17698
123 Ga0207660_10790937 3300025917 Bacteria 774
124 Ga0207657_10046575 3300025919 Bacteria 3798
125 Ga0207657_10154747 3300025919 Bacteria 1865
126 Ga0207657_10170674 3300025919 Bacteria 1762
127 Ga0207649_10010494 3300025920 Bacteria 5091
128 Ga0207652_10000155 3300025921 Bacteria 74494
129 Ga0207652_10101726 3300025921 Bacteria 2539
130 Ga0207652_10137044 3300025921 Bacteria 2186
131 Ga0207652_10278187 3300025921 Bacteria 1510
132 Ga0207652_10325960 3300025921 Bacteria 1386
133 Ga0207652_10448994 3300025921 Bacteria 1162
134 Ga0207650_10214545 3300025925 Bacteria 1547
135 Ga0207659_10006750 3300025926 Bacteria 7053
136 Ga0207687_10011996 3300025927 Bacteria 5667
137 Ga0207687_10036352 3300025927 Bacteria 3355
138 Ga0207664_10000958 3300025929 Bacteria 19466
139 Ga0207664_10016907 3300025929 Bacteria 5335
140 Ga0207644_10004297 3300025931 Bacteria 9248
141 Ga0207706_10003670 3300025933 Bacteria 14655
142 Ga0207706_10232912 3300025933 Bacteria 1611
143 Ga0207669_10171829 3300025937 Bacteria 1543
144 Ga0207669_10367380 3300025937 Bacteria 1117
145 Ga0207669_10412368 3300025937 Bacteria 1061
146 Ga0207669_10508649 3300025937 Bacteria 965
147 Ga0207691_10116445 3300025940 Bacteria 2372
148 Ga0207689_10004048 3300025942 Bacteria 13319
149 Ga0207661_10035044 3300025944 Bacteria 3908
150 Ga0207661_10320435 3300025944 Bacteria 1393
151 Ga0207661_10373825 3300025944 Bacteria 1289
152 Ga0207661_10398094 3300025944 Bacteria 1248
153 Ga0207679_10009140 3300025945 Bacteria 6336
154 Ga0207679_10315640 3300025945 Bacteria 1352
155 Ga0207712_10037859 3300025961 Bacteria 3294
156 Ga0207712_10887958 3300025961 Bacteria 787
157 Ga0207668_10156602 3300025972 Bacteria 1770
158 Ga0207668_10285186 3300025972 Bacteria 1356
159 Ga0207668_10765294 3300025972 Bacteria 853
160 Ga0207658_10013297 3300025986 Bacteria 5621
161 Ga0207677_10028012 3300026023 Bacteria 3557
162 Ga0207677_10168688 3300026023 Bacteria 1709
163 Ga0207677_10182792 3300026023 Bacteria 1650
164 Ga0207677_10222018 3300026023 Bacteria 1516
165 Ga0207677_10633056 3300026023 Bacteria 942
166 Ga0207703_10438560 3300026035 Bacteria 1218
167 Ga0207703_10599100 3300026035 Bacteria 1042
168 Ga0207639_10406854 3300026041 Bacteria 1227
169 Ga0207678_10058420 3300026067 Bacteria 3319
170 Ga0207708_10024609 3300026075 Bacteria 4553
171 Ga0207641_10028583 3300026088 Bacteria 4608
172 Ga0207641_10420839 3300026088 Bacteria 1286
173 Ga0207648_10326547 3300026089 Bacteria 1379
174 Ga0207676_10050014 3300026095 Bacteria 3256
175 Ga0207674_10267837 3300026116 Bacteria 1656
176 Ga0207683_10108196 3300026121 Bacteria 2488
177 Ga0207683_10124484 3300026121 Bacteria 2316
178 Ga0207683_10143294 3300026121 Bacteria 2154
179 Ga0207683_10451363 3300026121 Bacteria 1185
180 Ga0207683_10491996 3300026121 Bacteria 1132
181 Ga0207683_10970231 3300026121 Bacteria 789
182 Ga0207698_10065483 3300026142 Bacteria 2854
183 Ga0207428_10057759 3300027907 Bacteria 3080
184 Ga0268266_10009814 3300028379 Bacteria 8416
185 Ga0268266_10867894 3300028379 Bacteria 872
186 Ga0268265_10033459 3300028380 Bacteria 3738
187 Ga0307512_10011978 3300030522 Bacteria 8199
188 Ga0307512_10018842 3300030522 Bacteria 6299
189 Ga0307513_10030491 3300031456 Bacteria 6126
190 Ga0307408_100178479 3300031548 Bacteria 1701
191 Ga0307408_100265406 3300031548 Bacteria 1423
192 Ga0307508_10132231 3300031616 Bacteria 2099
193 Ga0307405_10055029 3300031731 Bacteria 2488
194 Ga0307405_10131731 3300031731 Bacteria 1729
195 Ga0307405_10642328 3300031731 Bacteria 872
196 Ga0307413_10303294 3300031824 Bacteria 1212
197 Ga0307518_10036366 3300031838 Bacteria 3579
198 Ga0307410_10030867 3300031852 Bacteria 3430
199 Ga0307410_10060195 3300031852 Bacteria 2595
200 Ga0307410_10090228 3300031852 Bacteria 2173
201 Ga0307410_10376520 3300031852 Bacteria 1141
202 Ga0307410_10534382 3300031852 Bacteria 969
203 Ga0307410_10789919 3300031852 Bacteria 807
204 Ga0307406_10003320 3300031901 Bacteria 8773
205 Ga0307406_10847840 3300031901 Bacteria 774
206 Ga0307407_10061236 3300031903 Bacteria 2199
207 Ga0307407_10132472 3300031903 Bacteria 1597
208 Ga0307407_10391878 3300031903 Bacteria 994
209 Ga0307412_10023133 3300031911 Bacteria 3820
210 Ga0307412_10393315 3300031911 Bacteria 1126
211 Ga0307409_100000105 3300031995 Bacteria 30290
212 Ga0307409_100046218 3300031995 Bacteria 3294
213 Ga0307409_100155911 3300031995 Bacteria 1989
214 Ga0307409_100308250 3300031995 Bacteria 1476
215 Ga0307409_100312727 3300031995 Bacteria 1467
216 Ga0307409_100390337 3300031995 Bacteria 1326
217 Ga0307409_100771099 3300031995 Bacteria 967
218 Ga0307409_101428693 3300031995 Bacteria 718
219 Ga0307409_101739726 3300031995 Bacteria 652
220 Ga0307416_100001135 3300032002 Bacteria 14305
221 Ga0307416_100096623 3300032002 Bacteria 2555
222 Ga0307416_100286031 3300032002 Bacteria 1629
223 Ga0307416_100291244 3300032002 Bacteria 1616
224 Ga0307416_100515039 3300032002 Bacteria 1263
225 Ga0307416_101119889 3300032002 Bacteria 892
226 Ga0307416_101158591 3300032002 Bacteria 878
227 Ga0307414_10209157 3300032004 Bacteria 1593
228 Ga0307411_10067145 3300032005 Bacteria 2412
229 Ga0307411_10079319 3300032005 Bacteria 2254
230 Ga0307415_100000023 3300032126 Bacteria 64440
231 Ga0307415_100005410 3300032126 Bacteria 6779
232 Ga0307415_100034378 3300032126 Bacteria 3300
233 Ga0307415_100056161 3300032126 Bacteria 2698
234 Ga0307415_100106841 3300032126 Bacteria 2067
235 Ga0307415_100193509 3300032126 Bacteria 1607
236 Ga0307415_100253599 3300032126 Bacteria 1431
237 Ga0307415_100343700 3300032126 Bacteria 1253
238 Ga0307415_100460265 3300032126 Bacteria 1102
239 Ga0307415_100650955 3300032126 Bacteria 945
240 Ga0307510_10041234 3300033180 Bacteria 5052
241 Ga0373938_0057196 3300034957 Bacteria 904
242 Ga0373952_0018791 3300035092 Bacteria 1433
243 Ga0373960_0067095 3300035121 Bacteria 1101
244 Ga0373931_0104380 3300035691 Bacteria 1599
245 Ga0373947_0144705 3300035725 Bacteria 1527
246 Ga0395900_0020059 3300037418 Bacteria 6817
247 Ga0395900_0210345 3300037418 Bacteria 1964
248 Ga0395900_0310552 3300037418 Bacteria 1560
249 Ga0395898_0022567 3300037466 Bacteria 6373
250 Ga0395898_0212029 3300037466 Bacteria 1847
251 Ga0395905_0018472 3300037471 Bacteria 6617
252 Ga0395901_0009293 3300038443 Bacteria 9964
253 Ga0395901_0034422 3300038443 Bacteria 5231
254 Ga0439465_0002907 3300041413 Bacteria 5615
255 Ga0451853_3113363 3300041512 Bacteria 1477
256 Ga0439464_0007788 3300042439 Bacteria 2803
257 Ga0466969_0045928 3300044656 Bacteria 2167
258 Ga0466972_0001831 3300044658 Bacteria 10413
259 Ga0466972_0002867 3300044658 Bacteria 8535
260 Ga0466965_0045994 3300044683 Bacteria 2159
261 Ga0466961_0055739 3300044693 Bacteria 2519
262 Ga0466961_0109571 3300044693 Bacteria 1738
263 Ga0466963_0019378 3300044694 Bacteria 4266
264 Ga0466963_0034962 3300044694 Bacteria 3272
265 Ga0466963_0082309 3300044694 Bacteria 2182
266 Ga0466963_0085751 3300044694 Bacteria 2138
267 Ga0466963_0247021 3300044694 Bacteria 1252
268 Ga0466963_0336689 3300044694 Bacteria 1062
269 Ga0466964_0014656 3300044706 Bacteria 2982
270 Ga0466964_0156819 3300044706 Bacteria 1060
271 Ga0466964_0391646 3300044706 Bacteria 724
272 Ga0453684_0331847 3300044712 Bacteria 1720
273 Ga0466971_0011135 3300044719 Bacteria 3938
274 Ga0466971_0037003 3300044719 Bacteria 2188
275 Ga0466971_0069069 3300044719 Bacteria 1603
276 Ga0466968_0124974 3300044735 Bacteria 1167
277 Ga0466968_0230496 3300044735 Bacteria 875
278 Ga0466970_0003340 3300044765 Bacteria 7798
279 Ga0466970_0081426 3300044765 Bacteria 1750
280 Ga0466970_0376113 3300044765 Bacteria 808
281 Ga0466970_0450463 3300044765 Bacteria 738
282 Ga0466957_0142300 3300044842 Bacteria 1546
283 Ga0466957_0147685 3300044842 Bacteria 1518
284 Ga0466957_0201081 3300044842 Bacteria 1309
285 Ga0466957_0241255 3300044842 Bacteria 1199
286 Ga0466957_0347705 3300044842 Bacteria 1005
287 Ga0466957_0597580 3300044842 Bacteria 772
288 Ga0466960_0000929 3300044901 Bacteria 10359
289 Ga0466960_0145919 3300044901 Bacteria 1260
290 Ga0466960_0323244 3300044901 Bacteria 874
291 Ga0466959_0051354 3300045049 Bacteria 3024
292 Ga0466958_0027566 3300045836 Bacteria 3362
293 Ga0466958_0074657 3300045836 Bacteria 2078
294 Ga0466958_0123638 3300045836 Bacteria 1621
295 Ga0466958_0127231 3300045836 Bacteria 1598
296 Ga0466967_0009721 3300045976 Bacteria 7162
297 Ga0466967_0194951 3300045976 Bacteria 1916
298 Ga0466967_0377805 3300045976 Bacteria 1375
299 Ga0495603_0079010 3300046455 Bacteria 1929
300 Ga0495629_0010135 3300046459 Bacteria 6873
301 Ga0495641_0013188 3300046461 Bacteria 4562
302 Ga0495641_0042050 3300046461 Bacteria 2120
303 Ga0495582_0053053 3300046473 Bacteria 2236
304 Ga0495608_0318486 3300046511 Bacteria 961
305 Ga0495640_0094476 3300046533 Bacteria 1969
306 Ga0495624_0087729 3300046690 Bacteria 1921
307 Ga0495581_0025974 3300047315 Bacteria 3397
308 Ga0495674_0017992 3300047319 Bacteria 6578
309 Ga0495593_0002380 3300047673 Bacteria 11300
310 Ga0495614_0108951 3300048089 Bacteria 1215
311 Ga0496100_0592332 3300048903 Bacteria 860
312 Ga0496102_0522741 3300048905 Bacteria 1109
313 Ga0496105_0489057 3300048908 Bacteria 967
314 Ga0496108_0001328 3300048911 Bacteria 19430
315 Ga0496108_0020824 3300048911 Bacteria 5393
316 Ga0496108_0036111 3300048911 Bacteria 4110
317 Ga0496108_0144924 3300048911 Bacteria 2047
318 Ga0496108_0190644 3300048911 Bacteria 1777
319 Ga0496108_0800766 3300048911 Bacteria 813
320 Ga0496109_0004301 3300048912 Bacteria 11896
321 Ga0496109_0138617 3300048912 Bacteria 2274
322 Ga0496109_0352818 3300048912 Bacteria 1389
323 Ga0496109_0391641 3300048912 Bacteria 1313
324 Ga0496110_0058938 3300048913 Bacteria 3382
325 Ga0496110_0062539 3300048913 Bacteria 3288
326 Ga0496110_0215723 3300048913 Bacteria 1745
327 Ga0496112_0075132 3300048915 Bacteria 3342
328 Ga0496112_0865610 3300048915 Bacteria 827
329 Ga0496113_0016598 3300048916 Bacteria 5090
330 Ga0496114_0179437 3300048917 Bacteria 1849
331 Ga0501033_0040236 3300049570 Bacteria 3490
332 Ga0501034_0265349 3300049571 Bacteria 1659
333 Ga0501034_0412362 3300049571 Bacteria 1273
334 Ga0501036_0238100 3300049572 Bacteria 1527
335 Ga0501038_0473005 3300049574 Bacteria 961
336 Ga0501046_0460466 3300049580 Bacteria 914
337 Ga0501047_0026257 3300049581 Bacteria 5603
338 Ga0501069_0041894 3300049585 Bacteria 2532
339 Ga0501080_0002916 3300049742 Bacteria 15025
340 Ga0501035_0000162 3300049822 Bacteria 81903
341 Ga0501044_0000166 3300049823 Bacteria 81728
342 Ga0501044_0360199 3300049823 Bacteria 1373
343 Ga0501044_0547722 3300049823 Bacteria 1054
344 nmdc:mga03n38_21301_c1 3300050490 Bacteria 2607
345 nmdc:mga05p37_61571_c1 3300050507 Bacteria 4619
346 nmdc:mga05p37_704524_c1 3300050507 Bacteria 1121
347 nmdc:mga05p37_7864_c1 3300050507 Bacteria 12588
348 nmdc:mga09592_15483_c1 3300050508 Bacteria 6233
349 nmdc:mga09592_834729_c1 3300050508 Bacteria 778
350 nmdc:mga0qj67_1440_c1 3300050509 Bacteria 16662
351 nmdc:mga0qj67_562_c1 3300050509 Bacteria 25304
352 nmdc:mga06r32_121077_c1 3300050510 Bacteria 2582
353 nmdc:mga06r32_314470_c1 3300050510 Bacteria 1552
354 nmdc:mga08y16_1063562_c1 3300050511 Bacteria 786
355 nmdc:mga08y16_387433_c1 3300050511 Bacteria 1432
356 Ga0500646_0020509 3300053090 Bacteria 1756
357 Ga0500577_0002577 3300053142 Bacteria 4644
358 Ga0466962_0030638 3300061719 Bacteria 2577
359 Ga0466962_0097756 3300061719 Bacteria 1408
360 2586062337 2585427649 Bacteria 9053857
361 2623500202 2622736605 Bacteria 4992138
362 2744955350 2744054611 Bacteria 5611514
363 2795792632 2795385472 Bacteria 6627535
364 2809588491 2808606522 Bacteria 9488490
365 2812375164 2811994882 Bacteria 4688362
366 2819666785 2818991458 Bacteria 4794049
367 2819691912 2818991462 Bacteria 4320267
368 2819729304 2818991469 Bacteria 4644110
369 2842889324 2842888712 Bacteria 4279094
370 2866556873 2866552031 Bacteria 5824618
371 2899366847 2899359706 Bacteria 10940472
372 2915360527 2915358134 Bacteria 6050864
373 2915770362 2915768154 Bacteria 8424322
374 8003323935 8003314358 Bacteria 10575343
375 8056212834 8056207758 Bacteria 8639239
376 Ga0495667_0102004
377 JGI25406J46586_10003562
378 JGI25405J52794_10010092
379 Ga0070658_10007141
380 Ga0070658_10141137
381 Ga0070658_10479123
382 Ga0070683_100426929
383 Ga0070683_100778623
384 Ga0070670_100378348
385 Ga0068869_100007529
386 Ga0070682_100045393
387 Ga0070682_100624848
388 Ga0068868_100008993
389 Ga0068868_100181625
390 Ga0070660_100035169
391 Ga0070689_101005669
392 Ga0070687_100118924
393 Ga0070692_10010169
394 Ga0070692_10164492
395 Ga0070668_100064405
396 Ga0070668_100516189
397 Ga0070668_100661233
398 Ga0070669_100074521
399 Ga0070675_100007831
400 Ga0070671_100011593
401 Ga0070671_100732418
402 Ga0070674_101013523
403 Ga0070659_100013501
404 Ga0070667_100274425
405 Ga0070714_100003398
406 Ga0070714_101104701
407 Ga0070713_100288047
408 Ga0070700_100019325
409 Ga0070663_100112675
410 Ga0070663_100253822
411 Ga0070678_100155633
412 Ga0070678_100163772
413 Ga0070662_100006428
414 Ga0070662_100159274
415 Ga0070662_100248555
416 Ga0070685_10252430
417 Ga0070679_100037798
418 Ga0070679_100127105
419 Ga0070679_100470228
420 Ga0070679_100535800
421 Ga0070684_100064651
422 Ga0070684_100077749
423 Ga0070684_100140336
424 Ga0070684_100183484
425 Ga0070684_100614661
426 Ga0068853_100794749
427 Ga0070693_100101616
428 Ga0070665_100001013
429 Ga0070665_100022861
430 Ga0070665_100309301
431 Ga0070664_100003880
432 Ga0070664_100089516
433 Ga0068857_100230492
434 Ga0068857_100448655
435 Ga0068857_100898957
436 Ga0068854_100058583
437 Ga0068852_100186514
438 Ga0068852_100685666
439 Ga0068852_101209524
440 Ga0068864_100144213
441 Ga0068864_100154317
442 Ga0068864_100185712
443 Ga0068864_100316890
444 Ga0068851_10173391
445 Ga0068851_10321079
446 Ga0068870_10153181
447 Ga0068863_100010187
448 Ga0068863_100031788
449 Ga0068858_100079755
450 Ga0068858_100394194
451 Ga0068860_100100492
452 Ga0068862_100019122
453 Ga0081455_10002532
454 Ga0081455_10003790
455 Ga0081455_10171149
456 Ga0081455_10211090
457 Ga0081539_10000806
458 Ga0081539_10057894
459 Ga0081539_10064117
460 Ga0070717_10019897
461 Ga0075365_10246294
462 Ga0075369_10017405
463 Ga0097621_100330580
464 Ga0075370_10021573
465 Ga0075428_100170470
466 Ga0075428_100922506
467 Ga0075430_100000139
468 Ga0075430_100002154
469 Ga0075431_100029946
470 Ga0111539_10333615
471 Ga0105245_10020207
472 Ga0114129_10007033
473 Ga0105243_10157484
474 Ga0105243_11328944
475 Ga0105237_11308965
476 Ga0105239_10804564
477 Ga0105246_10081023
478 Ga0105246_10327241
479 Ga0157316_1029970
480 Ga0157371_10612812
481 Ga0157374_10068217
482 Ga0157378_10672942
483 Ga0163162_11208927
484 Ga0157372_11213467
485 Ga0157375_10103252
486 Ga0157375_11738524
487 Ga0163163_10363423
488 Ga0163163_10643523
489 Ga0157377_10588524
490 Ga0157379_10013934
491 Ga0197907_10454703
492 Ga0197907_10618641
493 Ga0206354_11059424
494 Ga0207688_10045554
495 Ga0207705_10019550
496 Ga0207705_10116653
497 Ga0207660_10001142
498 Ga0207660_10790937
499 Ga0207657_10046575
500 Ga0207657_10154747
501 Ga0207657_10170674
502 Ga0207649_10010494
503 Ga0207652_10000155
504 Ga0207652_10101726
505 Ga0207652_10137044
506 Ga0207652_10278187
507 Ga0207652_10325960
508 Ga0207652_10448994
509 Ga0207650_10214545
510 Ga0207659_10006750
511 Ga0207687_10011996
512 Ga0207687_10036352
513 Ga0207664_10000958
514 Ga0207664_10016907
515 Ga0207644_10004297
516 Ga0207706_10003670
517 Ga0207706_10232912
518 Ga0207669_10171829
519 Ga0207669_10367380
520 Ga0207669_10412368
521 Ga0207669_10508649
522 Ga0207691_10116445
523 Ga0207689_10004048
524 Ga0207661_10035044
525 Ga0207661_10320435
526 Ga0207661_10373825
527 Ga0207661_10398094
528 Ga0207679_10009140
529 Ga0207679_10315640
530 Ga0207712_10037859
531 Ga0207712_10887958
532 Ga0207668_10156602
533 Ga0207668_10285186
534 Ga0207668_10765294
535 Ga0207658_10013297
536 Ga0207677_10028012
537 Ga0207677_10168688
538 Ga0207677_10182792
539 Ga0207677_10222018
540 Ga0207677_10633056
541 Ga0207703_10438560
542 Ga0207703_10599100
543 Ga0207639_10406854
544 Ga0207678_10058420
545 Ga0207708_10024609
546 Ga0207641_10028583
547 Ga0207641_10420839
548 Ga0207648_10326547
549 Ga0207676_10050014
550 Ga0207674_10267837
551 Ga0207683_10108196
552 Ga0207683_10124484
553 Ga0207683_10143294
554 Ga0207683_10451363
555 Ga0207683_10491996
556 Ga0207683_10970231
557 Ga0207698_10065483
558 Ga0207428_10057759
559 Ga0268266_10009814
560 Ga0268266_10867894
561 Ga0268265_10033459
562 Ga0307512_10011978
563 Ga0307512_10018842
564 Ga0307513_10030491
565 Ga0307408_100178479
566 Ga0307408_100265406
567 Ga0307508_10132231
568 Ga0307405_10055029
569 Ga0307405_10131731
570 Ga0307405_10642328
571 Ga0307413_10303294
572 Ga0307518_10036366
573 Ga0307410_10030867
574 Ga0307410_10060195
575 Ga0307410_10090228
576 Ga0307410_10376520
577 Ga0307410_10534382
578 Ga0307410_10789919
579 Ga0307406_10003320
580 Ga0307406_10847840
581 Ga0307407_10061236
582 Ga0307407_10132472
583 Ga0307407_10391878
584 Ga0307412_10023133
585 Ga0307412_10393315
586 Ga0307409_100000105
587 Ga0307409_100046218
588 Ga0307409_100155911
589 Ga0307409_100308250
590 Ga0307409_100312727
591 Ga0307409_100390337
592 Ga0307409_100771099
593 Ga0307409_101428693
594 Ga0307409_101739726
595 Ga0307416_100001135
596 Ga0307416_100096623
597 Ga0307416_100286031
598 Ga0307416_100291244
599 Ga0307416_100515039
600 Ga0307416_101119889
601 Ga0307416_101158591
602 Ga0307414_10209157
603 Ga0307411_10067145
604 Ga0307411_10079319
605 Ga0307415_100000023
606 Ga0307415_100005410
607 Ga0307415_100034378
608 Ga0307415_100056161
609 Ga0307415_100106841
610 Ga0307415_100193509
611 Ga0307415_100253599
612 Ga0307415_100343700
613 Ga0307415_100460265
614 Ga0307415_100650955
615 Ga0307510_10041234
616 Ga0373938_0057196
617 Ga0373952_0018791
618 Ga0373960_0067095
619 Ga0373931_0104380
620 Ga0373947_0144705
621 Ga0395900_0020059
622 Ga0395900_0210345
623 Ga0395900_0310552
624 Ga0395898_0022567
625 Ga0395898_0212029
626 Ga0395905_0018472
627 Ga0395901_0009293
628 Ga0395901_0034422
629 Ga0439465_0002907
630 Ga0451853_3113363
631 Ga0439464_0007788
632 Ga0466969_0045928
633 Ga0466972_0001831
634 Ga0466972_0002867
635 Ga0466965_0045994
636 Ga0466961_0055739
637 Ga0466961_0109571
638 Ga0466963_0019378
639 Ga0466963_0034962
640 Ga0466963_0082309
641 Ga0466963_0085751
642 Ga0466963_0247021
643 Ga0466963_0336689
644 Ga0466964_0014656
645 Ga0466964_0156819
646 Ga0466964_0391646
647 Ga0453684_0331847
648 Ga0466971_0011135
649 Ga0466971_0037003
650 Ga0466971_0069069
651 Ga0466968_0124974
652 Ga0466968_0230496
653 Ga0466970_0003340
654 Ga0466970_0081426
655 Ga0466970_0376113
656 Ga0466970_0450463
657 Ga0466957_0142300
658 Ga0466957_0147685
659 Ga0466957_0201081
660 Ga0466957_0241255
661 Ga0466957_0347705
662 Ga0466957_0597580
663 Ga0466960_0000929
664 Ga0466960_0145919
665 Ga0466960_0323244
666 Ga0466959_0051354
667 Ga0466958_0027566
668 Ga0466958_0074657
669 Ga0466958_0123638
670 Ga0466958_0127231
671 Ga0466967_0009721
672 Ga0466967_0194951
673 Ga0466967_0377805
674 Ga0495603_0079010
675 Ga0495629_0010135
676 Ga0495641_0013188
677 Ga0495641_0042050
678 Ga0495582_0053053
679 Ga0495608_0318486
680 Ga0495640_0094476
681 Ga0495624_0087729
682 Ga0495581_0025974
683 Ga0495674_0017992
684 Ga0495593_0002380
685 Ga0495614_0108951
686 Ga0496100_0592332
687 Ga0496102_0522741
688 Ga0496105_0489057
689 Ga0496108_0001328
690 Ga0496108_0020824
691 Ga0496108_0036111
692 Ga0496108_0144924
693 Ga0496108_0190644
694 Ga0496108_0800766
695 Ga0496109_0004301
696 Ga0496109_0138617
697 Ga0496109_0352818
698 Ga0496109_0391641
699 Ga0496110_0058938
700 Ga0496110_0062539
701 Ga0496110_0215723
702 Ga0496112_0075132
703 Ga0496112_0865610
704 Ga0496113_0016598
705 Ga0496114_0179437
706 Ga0501033_0040236
707 Ga0501034_0265349
708 Ga0501034_0412362
709 Ga0501036_0238100
710 Ga0501038_0473005
711 Ga0501046_0460466
712 Ga0501047_0026257
713 Ga0501069_0041894
714 Ga0501080_0002916
715 Ga0501035_0000162
716 Ga0501044_0000166
717 Ga0501044_0360199
718 Ga0501044_0547722
719 nmdc:mga03n38_21301_c1
720 nmdc:mga05p37_61571_c1
721 nmdc:mga05p37_704524_c1
722 nmdc:mga05p37_7864_c1
723 nmdc:mga09592_15483_c1
724 nmdc:mga09592_834729_c1
725 nmdc:mga0qj67_1440_c1
726 nmdc:mga0qj67_562_c1
727 nmdc:mga06r32_121077_c1
728 nmdc:mga06r32_314470_c1
729 nmdc:mga08y16_1063562_c1
730 nmdc:mga08y16_387433_c1
731 Ga0500646_0020509
732 Ga0500577_0002577
733 Ga0466962_0030638
734 Ga0466962_0097756
735 2586062337
736 2623500202
737 2744955350
738 2795792632
739 2809588491
740 2812375164
741 2819666785
742 2819691912
743 2819729304
744 2842889324
745 2866556873
746 2899366847
747 2915360527
748 2915770362
749 8003323935
750 8056212834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

35

199

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w30-assembly1.cif.gz_B-2 pyrr of mycobacterium tuberculosis as a potential drug target 0.9481 13 191
1w30-assembly1.cif.gz_A-2 pyrr of mycobacterium tuberculosis as a potential drug target 0.9442 13 191
1w30-assembly1.cif.gz_B-2 pyrr of mycobacterium tuberculosis as a potential drug target 0.9428 13 191
5iao-assembly1.cif.gz_F structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis 0.9389 13 191
1w30-assembly1.cif.gz_A-2 pyrr of mycobacterium tuberculosis as a potential drug target 0.9389 13 191
ID Description Score Start End Superfamily
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9169 6 191 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8799 6 191 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8795 16 192 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8651 16 192 3.40.50.2020
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.777 18 167 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1F1XIB9-F1-model_v4 deleted 0.9611 11 191
AF-A0A0B6F471-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9591 11 191 GO:0004845
GO:0006355
AF-A0A1E3SJA9-F1-model_v4 deleted 0.9587 18 191
AF-H5TNW2-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9559 14 194 GO:0004845
GO:0006355
AF-A0A0R3FL75-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9548 17 194 GO:0004845
GO:0006355

Map