F427050

General Info

Members Datasets Scaffolds Average Seq Length
375 201 750 89

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10136825|Ga0207688_101368253
Length 83
Sequence MTDSDVIDIALQTMLVALKLSAPVLVPSISLFQSMTQIQEFTLAFVPKAIGVAIALLVCGHWMLTTLVTFTTQLFDAIPKLAG

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
200 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
201 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 1.87
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 4
Rhizosphere 88.27
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10136825 3300025901 Bacteria 1439
2 JGI24736J21556_1070703 3300001904 Bacteria 544
3 JGI24737J22298_10014140 3300001990 Bacteria 2593
4 JGI24735J21928_10258762 3300002067 Bacteria 508
5 rootH2_10077495 3300003320 Bacteria 1005
6 Ga0070658_10153896 3300005327 Bacteria 1927
7 Ga0070658_10689997 3300005327 Bacteria 886
8 Ga0070683_100562391 3300005329 Bacteria 1091
9 Ga0070683_101891351 3300005329 Bacteria 573
10 Ga0068869_100599736 3300005334 Bacteria 930
11 Ga0070666_10914140 3300005335 Bacteria 649
12 Ga0070666_11084136 3300005335 Bacteria 595
13 Ga0068868_100014572 3300005338 Bacteria 5799
14 Ga0068868_100497691 3300005338 Bacteria 1067
15 Ga0070660_100094803 3300005339 Bacteria 2358
16 Ga0070660_100388924 3300005339 Bacteria 1152
17 Ga0070660_100466110 3300005339 Bacteria 1049
18 Ga0070687_100035506 3300005343 Bacteria 2476
19 Ga0070661_100512809 3300005344 Bacteria 961
20 Ga0070692_10042158 3300005345 Bacteria 2342
21 Ga0070692_10703083 3300005345 Bacteria 680
22 Ga0070669_100078220 3300005353 Bacteria 2458
23 Ga0070675_100012698 3300005354 Bacteria 6606
24 Ga0070659_100015951 3300005366 Bacteria 5635
25 Ga0070667_101486949 3300005367 Bacteria 636
26 Ga0070714_100708375 3300005435 Bacteria 972
27 Ga0070700_100002862 3300005441 Bacteria 8854
28 Ga0070663_100030822 3300005455 Bacteria 3680
29 Ga0070663_100436171 3300005455 Bacteria 1077
30 Ga0070663_100627026 3300005455 Bacteria 907
31 Ga0070662_100071162 3300005457 Bacteria 2564
32 Ga0070662_100856879 3300005457 Bacteria 774
33 Ga0070681_10360407 3300005458 Bacteria 1364
34 Ga0070679_100636171 3300005530 Bacteria 1010
35 Ga0070684_100004682 3300005535 Bacteria 10444
36 Ga0070684_100005375 3300005535 Bacteria 9812
37 Ga0070684_100111202 3300005535 Bacteria 2457
38 Ga0070684_100688382 3300005535 Bacteria 953
39 Ga0068853_100491965 3300005539 Bacteria 1157
40 Ga0068853_101601707 3300005539 Bacteria 631
41 Ga0070672_100358640 3300005543 Bacteria 1244
42 Ga0070672_100428358 3300005543 Bacteria 1137
43 Ga0070696_100735286 3300005546 Bacteria 807
44 Ga0070693_100753255 3300005547 Bacteria 718
45 Ga0068855_100048170 3300005563 Bacteria 5032
46 Ga0068855_100175679 3300005563 Bacteria 2424
47 Ga0068855_100421142 3300005563 Bacteria 1461
48 Ga0068855_100616132 3300005563 Bacteria 1169
49 Ga0070664_100001707 3300005564 Bacteria 17586
50 Ga0068857_100039003 3300005577 Bacteria 4206
51 Ga0068857_100317084 3300005577 Bacteria 1439
52 Ga0068857_100813441 3300005577 Bacteria 893
53 Ga0068854_100112084 3300005578 Bacteria 2059
54 Ga0068854_101323845 3300005578 Bacteria 649
55 Ga0068856_100463857 3300005614 Bacteria 1287
56 Ga0068856_101931609 3300005614 Bacteria 601
57 Ga0068852_100305697 3300005616 Bacteria 1541
58 Ga0068852_100308966 3300005616 Bacteria 1532
59 Ga0068852_100825546 3300005616 Bacteria 942
60 Ga0068852_101103287 3300005616 Bacteria 814
61 Ga0068859_101881182 3300005617 Bacteria 661
62 Ga0068861_102006574 3300005719 Bacteria 577
63 Ga0068870_10210773 3300005840 Bacteria 1183
64 Ga0068870_11154306 3300005840 Bacteria 559
65 Ga0068863_100474003 3300005841 Bacteria 1230
66 Ga0068863_101013555 3300005841 Bacteria 833
67 Ga0068862_101444100 3300005844 Bacteria 692
68 Ga0068862_102063772 3300005844 Bacteria 581
69 Ga0070717_11182645 3300006028 Bacteria 696
70 Ga0097621_101456223 3300006237 Bacteria 649
71 Ga0075430_100093642 3300006846 Bacteria 2512
72 Ga0075429_100249648 3300006880 Bacteria 1554
73 Ga0097620_101880501 3300006931 Bacteria 661
74 Ga0105240_10032505 3300009093 Bacteria 6755
75 Ga0105240_11069267 3300009093 Bacteria 860
76 Ga0105240_12476258 3300009093 Bacteria 537
77 Ga0111539_10056376 3300009094 Bacteria 4670
78 Ga0105245_10289149 3300009098 Bacteria 1605
79 Ga0105245_11220023 3300009098 Bacteria 800
80 Ga0105245_11479291 3300009098 Bacteria 730
81 Ga0105247_10009392 3300009101 Bacteria 5937
82 Ga0114129_13253409 3300009147 Bacteria 527
83 Ga0105243_10380829 3300009148 Bacteria 1305
84 Ga0105241_10076169 3300009174 Bacteria 2615
85 Ga0105241_10141234 3300009174 Bacteria 1961
86 Ga0105242_11347539 3300009176 Bacteria 739
87 Ga0105242_12069000 3300009176 Bacteria 613
88 Ga0105237_10130455 3300009545 Bacteria 2508
89 Ga0105238_10025759 3300009551 Bacteria 5997
90 Ga0105238_10316006 3300009551 Bacteria 1547
91 Ga0105238_10437503 3300009551 Bacteria 1304
92 Ga0105238_10963571 3300009551 Bacteria 873
93 Ga0105249_10262989 3300009553 Bacteria 1715
94 Ga0105239_10423433 3300010375 Bacteria 1508
95 Ga0105239_10613268 3300010375 Bacteria 1241
96 Ga0105239_12332548 3300010375 Bacteria 623
97 Ga0105246_10141596 3300011119 Bacteria 1809
98 Ga0105246_10199192 3300011119 Bacteria 1556
99 Ga0157370_10053822 3300013104 Bacteria 3837
100 Ga0157369_10096673 3300013105 Bacteria 3150
101 Ga0157369_10169967 3300013105 Bacteria 2297
102 Ga0157369_10300527 3300013105 Bacteria 1670
103 Ga0157369_10956062 3300013105 Bacteria 878
104 Ga0157369_11039834 3300013105 Bacteria 838
105 Ga0157374_10571103 3300013296 Bacteria 1139
106 Ga0157374_10592422 3300013296 Bacteria 1118
107 Ga0163162_10581392 3300013306 Bacteria 1247
108 Ga0157372_10000023 3300013307 Bacteria 198536
109 Ga0157372_10311061 3300013307 Bacteria 1834
110 Ga0157372_12754197 3300013307 Bacteria 564
111 Ga0157375_11030324 3300013308 Bacteria 961
112 Ga0163163_10281870 3300014325 Bacteria 1713
113 Ga0163163_11478061 3300014325 Bacteria 741
114 Ga0163163_11652318 3300014325 Bacteria 701
115 Ga0157380_10224922 3300014326 Bacteria 1681
116 Ga0157380_10391295 3300014326 Bacteria 1315
117 Ga0157377_10239907 3300014745 Bacteria 1169
118 Ga0157377_11279350 3300014745 Bacteria 572
119 Ga0157377_11432437 3300014745 Bacteria 546
120 Ga0157376_12809125 3300014969 Bacteria 527
121 Ga0197907_10339705 3300020069 Bacteria 932
122 Ga0197907_11446442 3300020069 Bacteria 923
123 Ga0206356_10428722 3300020070 Bacteria 965
124 Ga0206354_10296470 3300020081 Bacteria 1310
125 Ga0206354_10714835 3300020081 Bacteria 759
126 Ga0206353_10481786 3300020082 Bacteria 655
127 Ga0206353_12068318 3300020082 Bacteria 1460
128 Ga0213875_10020122 3300021388 Bacteria 3202
129 Ga0209563_130505 3300025230 Bacteria 517
130 Ga0207692_10116404 3300025898 Bacteria 1490
131 Ga0207710_10004681 3300025900 Bacteria 5937
132 Ga0207688_10071285 3300025901 Bacteria 1972
133 Ga0207647_10038740 3300025904 Bacteria 3012
134 Ga0207647_10061644 3300025904 Bacteria 2288
135 Ga0207647_10244071 3300025904 Bacteria 1031
136 Ga0207699_10785798 3300025906 Bacteria 699
137 Ga0207645_10130891 3300025907 Bacteria 1633
138 Ga0207643_10305204 3300025908 Bacteria 991
139 Ga0207643_10316812 3300025908 Bacteria 973
140 Ga0207643_10821517 3300025908 Bacteria 602
141 Ga0207705_10027629 3300025909 Bacteria 4047
142 Ga0207705_10214709 3300025909 Bacteria 1460
143 Ga0207654_10224322 3300025911 Bacteria 1248
144 Ga0207707_10908042 3300025912 Bacteria 728
145 Ga0207695_10055143 3300025913 Bacteria 4144
146 Ga0207671_11132928 3300025914 Bacteria 614
147 Ga0207660_11326416 3300025917 Bacteria 584
148 Ga0207657_10099740 3300025919 Bacteria 2412
149 Ga0207657_10200372 3300025919 Bacteria 1606
150 Ga0207649_10035108 3300025920 Bacteria 3010
151 Ga0207649_11198570 3300025920 Bacteria 600
152 Ga0207652_10151628 3300025921 Bacteria 2076
153 Ga0207694_10591880 3300025924 Bacteria 933
154 Ga0207694_10841286 3300025924 Bacteria 775
155 Ga0207659_10125213 3300025926 Bacteria 1975
156 Ga0207687_10072389 3300025927 Bacteria 2465
157 Ga0207687_10185849 3300025927 Bacteria 1613
158 Ga0207687_11095309 3300025927 Bacteria 684
159 Ga0207690_10027264 3300025932 Bacteria 3609
160 Ga0207706_10089361 3300025933 Bacteria 2708
161 Ga0207706_11416733 3300025933 Bacteria 570
162 Ga0207686_10987571 3300025934 Bacteria 683
163 Ga0207709_10458661 3300025935 Bacteria 987
164 Ga0207669_10080159 3300025937 Bacteria 2087
165 Ga0207691_10368100 3300025940 Bacteria 1228
166 Ga0207711_11271311 3300025941 Bacteria 678
167 Ga0207689_10008001 3300025942 Bacteria 9232
168 Ga0207689_10225168 3300025942 Bacteria 1550
169 Ga0207689_10676411 3300025942 Bacteria 870
170 Ga0207689_10792018 3300025942 Bacteria 800
171 Ga0207689_11523965 3300025942 Bacteria 558
172 Ga0207661_10002206 3300025944 Bacteria 13436
173 Ga0207661_10072918 3300025944 Bacteria 2810
174 Ga0207661_10197226 3300025944 Bacteria 1768
175 Ga0207679_10049555 3300025945 Bacteria 3065
176 Ga0207679_10332561 3300025945 Bacteria 1319
177 Ga0207667_10053333 3300025949 Bacteria 4256
178 Ga0207667_10337733 3300025949 Bacteria 1538
179 Ga0207667_10768276 3300025949 Bacteria 962
180 Ga0207667_11462553 3300025949 Bacteria 655
181 Ga0207712_10161354 3300025961 Bacteria 1742
182 Ga0207668_10146383 3300025972 Bacteria 1823
183 Ga0207668_11086248 3300025972 Bacteria 717
184 Ga0207640_10081940 3300025981 Bacteria 2208
185 Ga0207677_10049475 3300026023 Bacteria 2837
186 Ga0207677_10644282 3300026023 Bacteria 934
187 Ga0207639_10608908 3300026041 Bacteria 1008
188 Ga0207639_11285633 3300026041 Bacteria 687
189 Ga0207639_11684890 3300026041 Bacteria 594
190 Ga0207678_10047201 3300026067 Bacteria 3725
191 Ga0207678_10620676 3300026067 Bacteria 948
192 Ga0207708_10005686 3300026075 Bacteria 9214
193 Ga0207708_10988622 3300026075 Bacteria 731
194 Ga0207702_10329838 3300026078 Bacteria 1455
195 Ga0207702_12454863 3300026078 Bacteria 508
196 Ga0207641_10504495 3300026088 Bacteria 1175
197 Ga0207676_10329865 3300026095 Bacteria 1404
198 Ga0207674_10032585 3300026116 Bacteria 5464
199 Ga0207674_10330909 3300026116 Bacteria 1473
200 Ga0207674_10446104 3300026116 Bacteria 1251
201 Ga0207674_10505320 3300026116 Bacteria 1168
202 Ga0207675_100377878 3300026118 Bacteria 1393
203 Ga0207675_102031227 3300026118 Bacteria 592
204 Ga0207698_10188177 3300026142 Bacteria 1836
205 Ga0207698_10279530 3300026142 Bacteria 1543
206 Ga0207428_10040691 3300027907 Bacteria 3767
207 Ga0307515_10050214 3300028794 Bacteria 6253
208 Ga0307512_10016380 3300030522 Bacteria 6843
209 Ga0307509_10138294 3300031507 Bacteria 2376
210 Ga0307508_10229692 3300031616 Bacteria 1454
211 Ga0307508_10273124 3300031616 Bacteria 1284
212 Ga0307514_10365228 3300031649 Bacteria 760
213 Ga0307516_10000364 3300031730 Bacteria 59025
214 Ga0307405_10750780 3300031731 Bacteria 813
215 Ga0307413_10085496 3300031824 Bacteria 2037
216 Ga0307413_10968615 3300031824 Bacteria 727
217 Ga0307410_10859192 3300031852 Bacteria 775
218 Ga0307410_11091591 3300031852 Bacteria 691
219 Ga0326468_10001094 3300031889 Bacteria 2510
220 Ga0307406_10013454 3300031901 Bacteria 4688
221 Ga0307406_10106347 3300031901 Bacteria 1922
222 Ga0307416_100816356 3300032002 Bacteria 1029
223 Ga0307414_11494209 3300032004 Bacteria 629
224 Ga0307414_11665744 3300032004 Bacteria 595
225 Ga0307415_100167482 3300032126 Bacteria 1710
226 Ga0307415_100267261 3300032126 Bacteria 1399
227 Ga0307415_100341878 3300032126 Bacteria 1256
228 Ga0373956_0007122 3300035119 Bacteria 4498
229 Ga0373933_0268945 3300035724 Bacteria 1100
230 Ga0395900_0124322 3300037418 Bacteria 2646
231 Ga0436364_0781240 3300037853 Bacteria 5413
232 Ga0395901_0494771 3300038443 Bacteria 1245
233 Ga0451791_1586526 3300041451 Bacteria 753
234 Ga0451797_0640345 3300041453 Bacteria 621
235 Ga0451797_0723997 3300041453 Bacteria 613
236 Ga0451800_1260688 3300041459 Bacteria 567
237 Ga0451807_0205630 3300041486 Bacteria 516
238 Ga0451843_1271226 3300041509 Bacteria 724
239 Ga0451853_3371784 3300041512 Bacteria 785
240 Ga0439463_037847 3300042016 Bacteria 1224
241 Ga0466969_0197972 3300044656 Bacteria 917
242 Ga0466972_0089732 3300044658 Bacteria 1458
243 Ga0466972_0113385 3300044658 Bacteria 1280
244 Ga0466972_0227822 3300044658 Bacteria 872
245 Ga0466965_0013415 3300044683 Bacteria 3867
246 Ga0466965_0092880 3300044683 Bacteria 1537
247 Ga0466966_0144448 3300044684 Bacteria 1453
248 Ga0466966_0154296 3300044684 Bacteria 1399
249 Ga0466966_0183085 3300044684 Bacteria 1271
250 Ga0466966_0479929 3300044684 Bacteria 747
251 Ga0466966_0628213 3300044684 Bacteria 647
252 Ga0466966_0631691 3300044684 Bacteria 645
253 Ga0466966_0781416 3300044684 Bacteria 576
254 Ga0466961_0049326 3300044693 Bacteria 2691
255 Ga0466961_0097332 3300044693 Bacteria 1855
256 Ga0466961_0125997 3300044693 Bacteria 1607
257 Ga0466961_0142437 3300044693 Bacteria 1500
258 Ga0466961_0185648 3300044693 Bacteria 1290
259 Ga0466961_0222520 3300044693 Bacteria 1163
260 Ga0466961_0285958 3300044693 Bacteria 1009
261 Ga0466961_0630568 3300044693 Bacteria 644
262 Ga0466963_0004650 3300044694 Bacteria 8007
263 Ga0466963_0012115 3300044694 Bacteria 5270
264 Ga0466963_0070423 3300044694 Bacteria 2352
265 Ga0466963_0137067 3300044694 Bacteria 1694
266 Ga0466963_0278751 3300044694 Bacteria 1175
267 Ga0466964_0014652 3300044706 Bacteria 2982
268 Ga0466964_0028940 3300044706 Bacteria 2185
269 Ga0466964_0270317 3300044706 Bacteria 846
270 Ga0466964_0561451 3300044706 Bacteria 621
271 Ga0466971_0074073 3300044719 Bacteria 1548
272 Ga0466971_0118959 3300044719 Bacteria 1222
273 Ga0466971_0153863 3300044719 Bacteria 1074
274 Ga0466971_0204767 3300044719 Bacteria 932
275 Ga0466968_0040749 3300044735 Bacteria 1959
276 Ga0466968_0226061 3300044735 Bacteria 883
277 Ga0466970_0016179 3300044765 Bacteria 3843
278 Ga0466970_0019587 3300044765 Bacteria 3509
279 Ga0466970_0041593 3300044765 Bacteria 2442
280 Ga0466970_0073805 3300044765 Bacteria 1836
281 Ga0466970_0171534 3300044765 Bacteria 1202
282 Ga0466970_0660473 3300044765 Bacteria 608
283 Ga0466957_0050148 3300044842 Bacteria 2539
284 Ga0466957_0226653 3300044842 Bacteria 1236
285 Ga0466957_0279587 3300044842 Bacteria 1117
286 Ga0466957_0280365 3300044842 Bacteria 1115
287 Ga0466960_0026579 3300044901 Bacteria 2631
288 Ga0466960_0169838 3300044901 Bacteria 1176
289 Ga0466960_0321440 3300044901 Bacteria 876
290 Ga0466959_0334671 3300045049 Bacteria 1033
291 Ga0466959_0368448 3300045049 Bacteria 978
292 Ga0466959_0521427 3300045049 Bacteria 802
293 Ga0466959_0630055 3300045049 Bacteria 720
294 Ga0466958_0028442 3300045836 Bacteria 3314
295 Ga0466958_0159617 3300045836 Bacteria 1424
296 Ga0466958_0168803 3300045836 Unclassified 1385
297 Ga0466958_0306314 3300045836 Bacteria 1020
298 Ga0466958_0338711 3300045836 Bacteria 968
299 Ga0466958_0641757 3300045836 Bacteria 691
300 Ga0466958_0704027 3300045836 Bacteria 658
301 Ga0466958_0723345 3300045836 Bacteria 649
302 Ga0466967_0007442 3300045976 Bacteria 7898
303 Ga0466967_0101134 3300045976 Bacteria 2634
304 Ga0466967_0169566 3300045976 Bacteria 2053
305 Ga0466967_0171506 3300045976 Bacteria 2041
306 Ga0466967_0191253 3300045976 Bacteria 1934
307 Ga0466967_0401090 3300045976 Bacteria 1334
308 Ga0466967_0408706 3300045976 Bacteria 1322
309 Ga0466967_0582953 3300045976 Bacteria 1103
310 Ga0466967_0745200 3300045976 Bacteria 971
311 Ga0466967_1290485 3300045976 Bacteria 727
312 Ga0466967_1614430 3300045976 Bacteria 646
313 Ga0495675_0723189 3300047444 Bacteria 556
314 Ga0496100_0110753 3300048903 Bacteria 1907
315 Ga0496101_0623667 3300048904 Bacteria 852
316 Ga0496102_0000029 3300048905 Bacteria 222195
317 Ga0496102_0008425 3300048905 Bacteria 8837
318 Ga0496102_1685621 3300048905 Bacteria 552
319 Ga0496103_0000446 3300048906 Bacteria 35410
320 Ga0496109_0156863 3300048912 Bacteria 2132
321 Ga0496113_0064625 3300048916 Bacteria 2767
322 Ga0496113_1103532 3300048916 Bacteria 622
323 Ga0496114_1787752 3300048917 Bacteria 503
324 Ga0496117_0070112 3300048920 Bacteria 2357
325 Ga0496118_0024317 3300048921 Bacteria 5233
326 Ga0496119_0000061 3300048922 Bacteria 171442
327 Ga0496119_0114405 3300048922 Bacteria 1492
328 Ga0496120_0007974 3300048923 Bacteria 7798
329 Ga0496120_0048012 3300048923 Bacteria 2459
330 Ga0496121_0073326 3300048924 Bacteria 2744
331 Ga0496122_0002446 3300048925 Bacteria 26294
332 Ga0496123_0000972 3300048926 Bacteria 44223
333 Ga0496123_0178505 3300048926 Bacteria 1112
334 Ga0496124_0009947 3300048927 Bacteria 9717
335 Ga0501031_0012317 3300049568 Bacteria 5576
336 Ga0501032_0014197 3300049569 Bacteria 5643
337 Ga0501032_0401156 3300049569 Bacteria 881
338 Ga0501033_0287708 3300049570 Bacteria 1159
339 Ga0501034_0141605 3300049571 Bacteria 2384
340 Ga0501036_0508480 3300049572 Bacteria 1002
341 Ga0501037_0573649 3300049573 Bacteria 760
342 Ga0501038_0020123 3300049574 Bacteria 6005
343 Ga0501038_0399668 3300049574 Bacteria 1063
344 Ga0501043_0032356 3300049579 Bacteria 4112
345 Ga0501047_0000066 3300049581 Bacteria 132744
346 Ga0501047_0001104 3300049581 Bacteria 26810
347 Ga0501048_0001767 3300049582 Bacteria 16448
348 Ga0501069_0721745 3300049585 Bacteria 602
349 Ga0501070_0026330 3300049586 Bacteria 4881
350 Ga0501070_0279228 3300049586 Bacteria 1363
351 Ga0501070_0791721 3300049586 Bacteria 745
352 Ga0501073_0747792 3300049589 Bacteria 674
353 Ga0501073_0792769 3300049589 Bacteria 653
354 Ga0501074_0554506 3300049590 Bacteria 813
355 Ga0501074_0748386 3300049590 Bacteria 689
356 Ga0501074_0786895 3300049590 Bacteria 670
357 Ga0501074_1315475 3300049590 Bacteria 506
358 Ga0501081_0214395 3300049743 Bacteria 1399
359 Ga0501035_0095534 3300049822 Bacteria 2613
360 Ga0501044_0006847 3300049823 Bacteria 12562
361 nmdc:mga09592_416382_c1 3300050508 Bacteria 1161
362 nmdc:mga0qj67_205387_c1 3300050509 Bacteria 1600
363 nmdc:mga08y16_5269_c1 3300050511 Bacteria 13512
364 nmdc:mga0n895_877686_c1 3300050512 Bacteria 883
365 Ga0500644_0191748 3300053088 Bacteria 841
366 Ga0500658_0410630 3300053134 Bacteria 619
367 Ga0500658_0503487 3300053134 Bacteria 548
368 Ga0466962_0049785 3300061719 Bacteria 2002
369 Ga0466962_0106587 3300061719 Bacteria 1348
370 Ga0466962_0260880 3300061719 Bacteria 853
371 Ga0466962_0315269 3300061719 Bacteria 775
372 Ga0466962_0449017 3300061719 Bacteria 649
373 2857722959 2857720070 Bacteria 3189373
374 2928093598 2928090899 Bacteria 3158267
375 2984582708 2984580707 Bacteria 3351387
376 Ga0207688_10136825
377 JGI24736J21556_1070703
378 JGI24737J22298_10014140
379 JGI24735J21928_10258762
380 rootH2_10077495
381 Ga0070658_10153896
382 Ga0070658_10689997
383 Ga0070683_100562391
384 Ga0070683_101891351
385 Ga0068869_100599736
386 Ga0070666_10914140
387 Ga0070666_11084136
388 Ga0068868_100014572
389 Ga0068868_100497691
390 Ga0070660_100094803
391 Ga0070660_100388924
392 Ga0070660_100466110
393 Ga0070687_100035506
394 Ga0070661_100512809
395 Ga0070692_10042158
396 Ga0070692_10703083
397 Ga0070669_100078220
398 Ga0070675_100012698
399 Ga0070659_100015951
400 Ga0070667_101486949
401 Ga0070714_100708375
402 Ga0070700_100002862
403 Ga0070663_100030822
404 Ga0070663_100436171
405 Ga0070663_100627026
406 Ga0070662_100071162
407 Ga0070662_100856879
408 Ga0070681_10360407
409 Ga0070679_100636171
410 Ga0070684_100004682
411 Ga0070684_100005375
412 Ga0070684_100111202
413 Ga0070684_100688382
414 Ga0068853_100491965
415 Ga0068853_101601707
416 Ga0070672_100358640
417 Ga0070672_100428358
418 Ga0070696_100735286
419 Ga0070693_100753255
420 Ga0068855_100048170
421 Ga0068855_100175679
422 Ga0068855_100421142
423 Ga0068855_100616132
424 Ga0070664_100001707
425 Ga0068857_100039003
426 Ga0068857_100317084
427 Ga0068857_100813441
428 Ga0068854_100112084
429 Ga0068854_101323845
430 Ga0068856_100463857
431 Ga0068856_101931609
432 Ga0068852_100305697
433 Ga0068852_100308966
434 Ga0068852_100825546
435 Ga0068852_101103287
436 Ga0068859_101881182
437 Ga0068861_102006574
438 Ga0068870_10210773
439 Ga0068870_11154306
440 Ga0068863_100474003
441 Ga0068863_101013555
442 Ga0068862_101444100
443 Ga0068862_102063772
444 Ga0070717_11182645
445 Ga0097621_101456223
446 Ga0075430_100093642
447 Ga0075429_100249648
448 Ga0097620_101880501
449 Ga0105240_10032505
450 Ga0105240_11069267
451 Ga0105240_12476258
452 Ga0111539_10056376
453 Ga0105245_10289149
454 Ga0105245_11220023
455 Ga0105245_11479291
456 Ga0105247_10009392
457 Ga0114129_13253409
458 Ga0105243_10380829
459 Ga0105241_10076169
460 Ga0105241_10141234
461 Ga0105242_11347539
462 Ga0105242_12069000
463 Ga0105237_10130455
464 Ga0105238_10025759
465 Ga0105238_10316006
466 Ga0105238_10437503
467 Ga0105238_10963571
468 Ga0105249_10262989
469 Ga0105239_10423433
470 Ga0105239_10613268
471 Ga0105239_12332548
472 Ga0105246_10141596
473 Ga0105246_10199192
474 Ga0157370_10053822
475 Ga0157369_10096673
476 Ga0157369_10169967
477 Ga0157369_10300527
478 Ga0157369_10956062
479 Ga0157369_11039834
480 Ga0157374_10571103
481 Ga0157374_10592422
482 Ga0163162_10581392
483 Ga0157372_10000023
484 Ga0157372_10311061
485 Ga0157372_12754197
486 Ga0157375_11030324
487 Ga0163163_10281870
488 Ga0163163_11478061
489 Ga0163163_11652318
490 Ga0157380_10224922
491 Ga0157380_10391295
492 Ga0157377_10239907
493 Ga0157377_11279350
494 Ga0157377_11432437
495 Ga0157376_12809125
496 Ga0197907_10339705
497 Ga0197907_11446442
498 Ga0206356_10428722
499 Ga0206354_10296470
500 Ga0206354_10714835
501 Ga0206353_10481786
502 Ga0206353_12068318
503 Ga0213875_10020122
504 Ga0209563_130505
505 Ga0207692_10116404
506 Ga0207710_10004681
507 Ga0207688_10071285
508 Ga0207647_10038740
509 Ga0207647_10061644
510 Ga0207647_10244071
511 Ga0207699_10785798
512 Ga0207645_10130891
513 Ga0207643_10305204
514 Ga0207643_10316812
515 Ga0207643_10821517
516 Ga0207705_10027629
517 Ga0207705_10214709
518 Ga0207654_10224322
519 Ga0207707_10908042
520 Ga0207695_10055143
521 Ga0207671_11132928
522 Ga0207660_11326416
523 Ga0207657_10099740
524 Ga0207657_10200372
525 Ga0207649_10035108
526 Ga0207649_11198570
527 Ga0207652_10151628
528 Ga0207694_10591880
529 Ga0207694_10841286
530 Ga0207659_10125213
531 Ga0207687_10072389
532 Ga0207687_10185849
533 Ga0207687_11095309
534 Ga0207690_10027264
535 Ga0207706_10089361
536 Ga0207706_11416733
537 Ga0207686_10987571
538 Ga0207709_10458661
539 Ga0207669_10080159
540 Ga0207691_10368100
541 Ga0207711_11271311
542 Ga0207689_10008001
543 Ga0207689_10225168
544 Ga0207689_10676411
545 Ga0207689_10792018
546 Ga0207689_11523965
547 Ga0207661_10002206
548 Ga0207661_10072918
549 Ga0207661_10197226
550 Ga0207679_10049555
551 Ga0207679_10332561
552 Ga0207667_10053333
553 Ga0207667_10337733
554 Ga0207667_10768276
555 Ga0207667_11462553
556 Ga0207712_10161354
557 Ga0207668_10146383
558 Ga0207668_11086248
559 Ga0207640_10081940
560 Ga0207677_10049475
561 Ga0207677_10644282
562 Ga0207639_10608908
563 Ga0207639_11285633
564 Ga0207639_11684890
565 Ga0207678_10047201
566 Ga0207678_10620676
567 Ga0207708_10005686
568 Ga0207708_10988622
569 Ga0207702_10329838
570 Ga0207702_12454863
571 Ga0207641_10504495
572 Ga0207676_10329865
573 Ga0207674_10032585
574 Ga0207674_10330909
575 Ga0207674_10446104
576 Ga0207674_10505320
577 Ga0207675_100377878
578 Ga0207675_102031227
579 Ga0207698_10188177
580 Ga0207698_10279530
581 Ga0207428_10040691
582 Ga0307515_10050214
583 Ga0307512_10016380
584 Ga0307509_10138294
585 Ga0307508_10229692
586 Ga0307508_10273124
587 Ga0307514_10365228
588 Ga0307516_10000364
589 Ga0307405_10750780
590 Ga0307413_10085496
591 Ga0307413_10968615
592 Ga0307410_10859192
593 Ga0307410_11091591
594 Ga0326468_10001094
595 Ga0307406_10013454
596 Ga0307406_10106347
597 Ga0307416_100816356
598 Ga0307414_11494209
599 Ga0307414_11665744
600 Ga0307415_100167482
601 Ga0307415_100267261
602 Ga0307415_100341878
603 Ga0373956_0007122
604 Ga0373933_0268945
605 Ga0395900_0124322
606 Ga0436364_0781240
607 Ga0395901_0494771
608 Ga0451791_1586526
609 Ga0451797_0640345
610 Ga0451797_0723997
611 Ga0451800_1260688
612 Ga0451807_0205630
613 Ga0451843_1271226
614 Ga0451853_3371784
615 Ga0439463_037847
616 Ga0466969_0197972
617 Ga0466972_0089732
618 Ga0466972_0113385
619 Ga0466972_0227822
620 Ga0466965_0013415
621 Ga0466965_0092880
622 Ga0466966_0144448
623 Ga0466966_0154296
624 Ga0466966_0183085
625 Ga0466966_0479929
626 Ga0466966_0628213
627 Ga0466966_0631691
628 Ga0466966_0781416
629 Ga0466961_0049326
630 Ga0466961_0097332
631 Ga0466961_0125997
632 Ga0466961_0142437
633 Ga0466961_0185648
634 Ga0466961_0222520
635 Ga0466961_0285958
636 Ga0466961_0630568
637 Ga0466963_0004650
638 Ga0466963_0012115
639 Ga0466963_0070423
640 Ga0466963_0137067
641 Ga0466963_0278751
642 Ga0466964_0014652
643 Ga0466964_0028940
644 Ga0466964_0270317
645 Ga0466964_0561451
646 Ga0466971_0074073
647 Ga0466971_0118959
648 Ga0466971_0153863
649 Ga0466971_0204767
650 Ga0466968_0040749
651 Ga0466968_0226061
652 Ga0466970_0016179
653 Ga0466970_0019587
654 Ga0466970_0041593
655 Ga0466970_0073805
656 Ga0466970_0171534
657 Ga0466970_0660473
658 Ga0466957_0050148
659 Ga0466957_0226653
660 Ga0466957_0279587
661 Ga0466957_0280365
662 Ga0466960_0026579
663 Ga0466960_0169838
664 Ga0466960_0321440
665 Ga0466959_0334671
666 Ga0466959_0368448
667 Ga0466959_0521427
668 Ga0466959_0630055
669 Ga0466958_0028442
670 Ga0466958_0159617
671 Ga0466958_0168803
672 Ga0466958_0306314
673 Ga0466958_0338711
674 Ga0466958_0641757
675 Ga0466958_0704027
676 Ga0466958_0723345
677 Ga0466967_0007442
678 Ga0466967_0101134
679 Ga0466967_0169566
680 Ga0466967_0171506
681 Ga0466967_0191253
682 Ga0466967_0401090
683 Ga0466967_0408706
684 Ga0466967_0582953
685 Ga0466967_0745200
686 Ga0466967_1290485
687 Ga0466967_1614430
688 Ga0495675_0723189
689 Ga0496100_0110753
690 Ga0496101_0623667
691 Ga0496102_0000029
692 Ga0496102_0008425
693 Ga0496102_1685621
694 Ga0496103_0000446
695 Ga0496109_0156863
696 Ga0496113_0064625
697 Ga0496113_1103532
698 Ga0496114_1787752
699 Ga0496117_0070112
700 Ga0496118_0024317
701 Ga0496119_0000061
702 Ga0496119_0114405
703 Ga0496120_0007974
704 Ga0496120_0048012
705 Ga0496121_0073326
706 Ga0496122_0002446
707 Ga0496123_0000972
708 Ga0496123_0178505
709 Ga0496124_0009947
710 Ga0501031_0012317
711 Ga0501032_0014197
712 Ga0501032_0401156
713 Ga0501033_0287708
714 Ga0501034_0141605
715 Ga0501036_0508480
716 Ga0501037_0573649
717 Ga0501038_0020123
718 Ga0501038_0399668
719 Ga0501043_0032356
720 Ga0501047_0000066
721 Ga0501047_0001104
722 Ga0501048_0001767
723 Ga0501069_0721745
724 Ga0501070_0026330
725 Ga0501070_0279228
726 Ga0501070_0791721
727 Ga0501073_0747792
728 Ga0501073_0792769
729 Ga0501074_0554506
730 Ga0501074_0748386
731 Ga0501074_0786895
732 Ga0501074_1315475
733 Ga0501081_0214395
734 Ga0501035_0095534
735 Ga0501044_0006847
736 nmdc:mga09592_416382_c1
737 nmdc:mga0qj67_205387_c1
738 nmdc:mga08y16_5269_c1
739 nmdc:mga0n895_877686_c1
740 Ga0500644_0191748
741 Ga0500658_0410630
742 Ga0500658_0503487
743 Ga0466962_0049785
744 Ga0466962_0106587
745 Ga0466962_0260880
746 Ga0466962_0315269
747 Ga0466962_0449017
748 2857722959
749 2928093598
750 2984582708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

5

72

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fbo-assembly1.cif.gz_C improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains 0.9336 13 82
5j0j-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9273 11 80
3k9a-assembly1.cif.gz_A crystal structure of hiv gp41 with mper 0.9211 16 86
6msr-assembly1.cif.gz_A crystal structure of pro-2.5 0.9191 11 84
6wa9-assembly1.cif.gz_L structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.915 6 79
ID Description Score Start End Superfamily
3k9aA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9211 16 86 1.10.287.210
af_A0A0R4IXA4_11_237_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9094 12 86 1.20.1270.60
af_I1NAF3_145_216_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9087 17 71 1.10.287.660
af_Q3UIA2_1_242_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9059 12 86 1.20.1270.60
af_F1R7M1_1_245_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9055 12 86 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A2D4J4N3-F1-model_v4 Uncharacterized protein 0.9438 6 87 GO:0000124
GO:0035064
AF-A0A1Z5LDJ9-F1-model_v4 SGF29 C-terminal domain-containing protein 0.9356 11 82 GO:0000124
GO:0035064
AF-A0A131Z5V2-F1-model_v4 SAGA-associated factor 29 0.932 11 82 GO:0000124
GO:0005634
GO:0035064
AF-A0A7K8GGL1-F1-model_v4 SGF29 factor 0.9296 3 87 GO:0000124
GO:0035064
AF-A0A816MXW6-F1-model_v4 DNA 3'-5' helicase (EC 5.6.2.4) 0.9215 11 82 GO:0003676
GO:0003735
GO:0004386
GO:0005524
GO:0005840
GO:0006310
GO:0006412
GO:0016787

Map