F426728

General Info

Members Datasets Scaffolds Average Seq Length
374 267 748 106

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_11629422|Ga0207694_116294221
Length 129
Sequence MRILPSRAPPGRRARRLANGLTHMEWMILASAGLLEIGFAFGMKWSAGFTRLIPALFTAATGLSSVFLLSLALRTLPVGTGYAVWTGIGAAGTAVLGIAVLGDSASPGRILCIALIVAGVIGLKLVSAN

Samples

Sample ID Description Type Environment
1 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.43
Nodule 0
Rhizoplane 5.35
Rhizosphere 77.81
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207694_11629422 3300025924 Bacteria 544
2 JGI25153J46596_10084187 3300003215 Bacteria 785
3 rootH1_10256815 3300003323 Bacteria 2899
4 Ga0055542_1012097 3300003762 Bacteria 1504
5 Ga0055529_1006435 3300003763 Bacteria 1643
6 Ga0065707_11172946 3300005295 Bacteria 500
7 Ga0070658_10013838 3300005327 Bacteria 6474
8 Ga0070658_10204975 3300005327 Bacteria 1665
9 Ga0070683_100003724 3300005329 Bacteria 12434
10 Ga0070670_100005991 3300005331 Bacteria 10288
11 Ga0070670_100459472 3300005331 Bacteria 1129
12 Ga0070666_10262364 3300005335 Bacteria 1225
13 Ga0070680_100444444 3300005336 Bacteria 1107
14 Ga0070682_100181083 3300005337 Bacteria 1472
15 Ga0070682_100219592 3300005337 Bacteria 1352
16 Ga0070660_100237335 3300005339 Bacteria 1484
17 Ga0070660_100788277 3300005339 Bacteria 799
18 Ga0070661_100211332 3300005344 Bacteria 1485
19 Ga0070661_100882358 3300005344 Bacteria 737
20 Ga0070668_100653417 3300005347 Bacteria 924
21 Ga0070669_100017577 3300005353 Bacteria 5100
22 Ga0070675_100017393 3300005354 Bacteria 5713
23 Ga0070671_100470939 3300005355 Bacteria 1079
24 Ga0070673_101067903 3300005364 Bacteria 753
25 Ga0070673_101094615 3300005364 Bacteria 744
26 Ga0070659_100128347 3300005366 Bacteria 2058
27 Ga0070659_100615701 3300005366 Bacteria 934
28 Ga0070659_101170046 3300005366 Bacteria 679
29 Ga0070713_100276197 3300005436 Bacteria 1540
30 Ga0070711_100035079 3300005439 Bacteria 3351
31 Ga0070663_100044776 3300005455 Bacteria 3123
32 Ga0070663_100526704 3300005455 Bacteria 985
33 Ga0070663_101349462 3300005455 Bacteria 630
34 Ga0070663_102016509 3300005455 Bacteria 519
35 Ga0070678_101878403 3300005456 Bacteria 565
36 Ga0070662_100481988 3300005457 Bacteria 1033
37 Ga0068867_101831254 3300005459 Bacteria 571
38 Ga0070679_100253342 3300005530 Bacteria 1716
39 Ga0070679_100652334 3300005530 Archaea 995
40 Ga0070684_100000930 3300005535 Bacteria 20819
41 Ga0070684_100600939 3300005535 Bacteria 1023
42 Ga0068853_100479368 3300005539 Bacteria 1173
43 Ga0068853_100579379 3300005539 Bacteria 1065
44 Ga0070672_100048569 3300005543 Unclassified 3298
45 Ga0070672_101114188 3300005543 Bacteria 702
46 Ga0070665_100072314 3300005548 Bacteria 3456
47 Ga0070665_100128927 3300005548 Bacteria 2532
48 Ga0070665_100626757 3300005548 Bacteria 1088
49 Ga0070665_101565605 3300005548 Bacteria 667
50 Ga0068855_100345393 3300005563 Bacteria 1640
51 Ga0070664_100008362 3300005564 Bacteria 8365
52 Ga0070664_100108057 3300005564 Bacteria 2426
53 Ga0070664_100132234 3300005564 Bacteria 2192
54 Ga0068857_100118240 3300005577 Bacteria 2385
55 Ga0068857_100454336 3300005577 Bacteria 1198
56 Ga0068856_100419781 3300005614 Bacteria 1358
57 Ga0068856_101088226 3300005614 Bacteria 817
58 Ga0068852_100720214 3300005616 Bacteria 1009
59 Ga0068852_100778152 3300005616 Bacteria 970
60 Ga0068852_101501068 3300005616 Bacteria 696
61 Ga0068859_100489785 3300005617 Bacteria 1325
62 Ga0068859_102355524 3300005617 Bacteria 587
63 Ga0068864_100027235 3300005618 Bacteria 4825
64 Ga0068864_100081216 3300005618 Bacteria 2842
65 Ga0068864_100272449 3300005618 Bacteria 1578
66 Ga0068866_10308573 3300005718 Bacteria 991
67 Ga0068861_100506945 3300005719 Bacteria 1092
68 Ga0068861_101289906 3300005719 Bacteria 710
69 Ga0068851_10222680 3300005834 Bacteria 1061
70 Ga0068870_10138334 3300005840 Bacteria 1422
71 Ga0068870_10139900 3300005840 Bacteria 1415
72 Ga0068863_100142823 3300005841 Bacteria 2288
73 Ga0068858_100134062 3300005842 Bacteria 2323
74 Ga0068858_101743104 3300005842 Bacteria 615
75 Ga0068860_100155622 3300005843 Bacteria 2203
76 Ga0075365_10382025 3300006038 Bacteria 994
77 Ga0075363_100259912 3300006048 Bacteria 1001
78 Ga0075363_100652786 3300006048 Bacteria 633
79 Ga0075363_100931410 3300006048 Bacteria 533
80 Ga0070712_100275223 3300006175 Bacteria 1354
81 Ga0075362_10237372 3300006177 Bacteria 894
82 Ga0075369_10205632 3300006186 Bacteria 909
83 Ga0075366_10469713 3300006195 Bacteria 777
84 Ga0097621_100075856 3300006237 Bacteria 2788
85 Ga0097621_100298605 3300006237 Bacteria 1422
86 Ga0097621_100341617 3300006237 Bacteria 1330
87 Ga0068871_100139892 3300006358 Bacteria 2058
88 Ga0068871_101304673 3300006358 Bacteria 683
89 Ga0075433_10001101 3300006852 Bacteria 19508
90 Ga0075434_100065393 3300006871 Bacteria 3621
91 Ga0068865_101148162 3300006881 Bacteria 686
92 Ga0097620_100489784 3300006931 Bacteria 1325
93 Ga0097620_102356171 3300006931 Bacteria 587
94 Ga0075435_100007578 3300007076 Bacteria 7749
95 Ga0105244_10000019 3300009036 Bacteria 242333
96 Ga0105245_10804368 3300009098 Bacteria 978
97 Ga0105245_11890864 3300009098 Bacteria 650
98 Ga0105247_10022484 3300009101 Bacteria 3797
99 Ga0105241_10002471 3300009174 Bacteria 13899
100 Ga0105242_10749444 3300009176 Bacteria 961
101 Ga0105242_11386596 3300009176 Bacteria 730
102 Ga0105248_10094068 3300009177 Bacteria 3375
103 Ga0105248_10498570 3300009177 Bacteria 1373
104 Ga0105238_11227718 3300009551 Bacteria 774
105 Ga0105249_10331278 3300009553 Bacteria 1536
106 Ga0105239_10259508 3300010375 Bacteria 1953
107 Ga0157373_10779496 3300013100 Bacteria 704
108 Ga0157373_11045649 3300013100 Bacteria 611
109 Ga0157373_11176884 3300013100 Bacteria 577
110 Ga0157369_10265788 3300013105 Bacteria 1788
111 Ga0157374_10966861 3300013296 Bacteria 870
112 Ga0157374_11270881 3300013296 Bacteria 758
113 Ga0157378_10359536 3300013297 Bacteria 1424
114 Ga0163162_10548375 3300013306 Bacteria 1284
115 Ga0163162_11393956 3300013306 Bacteria 797
116 Ga0157372_10087577 3300013307 Bacteria 3534
117 Ga0157375_10149598 3300013308 Bacteria 2469
118 Ga0157375_10190284 3300013308 Bacteria 2207
119 Ga0157375_11623800 3300013308 Bacteria 765
120 Ga0163163_10195512 3300014325 Bacteria 2070
121 Ga0163163_12172531 3300014325 Bacteria 614
122 Ga0157376_10460745 3300014969 Bacteria 1242
123 Ga0209258_110279 3300025242 Bacteria 1221
124 Ga0207425_1000208 3300025245 Bacteria 46700
125 Ga0209148_1002481 3300025254 Bacteria 6278
126 Ga0209455_1001489 3300025272 Bacteria 10492
127 Ga0209025_1006863 3300025294 Bacteria 8686
128 Ga0209758_1001162 3300025297 Bacteria 33454
129 Ga0209758_1001601 3300025297 Bacteria 25859
130 Ga0207656_10014120 3300025321 Bacteria 3069
131 Ga0207655_1000025 3300025728 Bacteria 449261
132 Ga0207692_10450953 3300025898 Bacteria 810
133 Ga0207642_10229638 3300025899 Bacteria 1042
134 Ga0207710_10119828 3300025900 Bacteria 1256
135 Ga0207710_10301809 3300025900 Bacteria 809
136 Ga0207680_10212579 3300025903 Bacteria 1323
137 Ga0207647_10420889 3300025904 Bacteria 751
138 Ga0207685_10043877 3300025905 Bacteria 1688
139 Ga0207645_10089091 3300025907 Bacteria 1984
140 Ga0207643_10079652 3300025908 Bacteria 1896
141 Ga0207705_10017509 3300025909 Bacteria 5130
142 Ga0207654_10021980 3300025911 Bacteria 3398
143 Ga0207693_10055814 3300025915 Bacteria 3098
144 Ga0207693_10929861 3300025915 Bacteria 666
145 Ga0207663_10109893 3300025916 Bacteria 1869
146 Ga0207663_10942131 3300025916 Bacteria 691
147 Ga0207660_10254146 3300025917 Bacteria 1388
148 Ga0207657_10057060 3300025919 Bacteria 3367
149 Ga0207657_10481148 3300025919 Bacteria 973
150 Ga0207657_10629658 3300025919 Bacteria 836
151 Ga0207649_10940481 3300025920 Bacteria 679
152 Ga0207652_10246974 3300025921 Bacteria 1609
153 Ga0207652_11270225 3300025921 Unclassified 639
154 Ga0207681_10072829 3300025923 Bacteria 2401
155 Ga0207681_11399661 3300025923 Bacteria 587
156 Ga0207694_10903820 3300025924 Bacteria 747
157 Ga0207650_10009347 3300025925 Bacteria 6700
158 Ga0207650_10088638 3300025925 Bacteria 2360
159 Ga0207659_10003630 3300025926 Bacteria 9295
160 Ga0207687_10130637 3300025927 Bacteria 1893
161 Ga0207687_10900361 3300025927 Bacteria 757
162 Ga0207700_11414332 3300025928 Bacteria 618
163 Ga0207690_10207951 3300025932 Bacteria 1490
164 Ga0207690_10341018 3300025932 Bacteria 1183
165 Ga0207690_11272779 3300025932 Bacteria 614
166 Ga0207686_10922236 3300025934 Bacteria 706
167 Ga0207709_10504238 3300025935 Bacteria 945
168 Ga0207670_10775058 3300025936 Bacteria 798
169 Ga0207704_10291783 3300025938 Bacteria 1245
170 Ga0207665_10233989 3300025939 Bacteria 1351
171 Ga0207691_10048791 3300025940 Bacteria 3880
172 Ga0207691_10083333 3300025940 Unclassified 2871
173 Ga0207711_10793212 3300025941 Bacteria 882
174 Ga0207661_10196653 3300025944 Bacteria 1770
175 Ga0207679_10066967 3300025945 Bacteria 2693
176 Ga0207679_10255874 3300025945 Bacteria 1491
177 Ga0207679_10903060 3300025945 Bacteria 808
178 Ga0207667_10354069 3300025949 Bacteria 1497
179 Ga0207667_11483579 3300025949 Bacteria 650
180 Ga0207651_10961643 3300025960 Bacteria 762
181 Ga0207668_10316556 3300025972 Bacteria 1293
182 Ga0207668_10638180 3300025972 Bacteria 931
183 Ga0207640_10366759 3300025981 Bacteria 1162
184 Ga0207677_10184805 3300026023 Bacteria 1643
185 Ga0207703_11206074 3300026035 Bacteria 727
186 Ga0207639_10035522 3300026041 Bacteria 3689
187 Ga0207639_10100494 3300026041 Bacteria 2336
188 Ga0207678_10045019 3300026067 Bacteria 3816
189 Ga0207678_10049772 3300026067 Bacteria 3621
190 Ga0207678_10058886 3300026067 Bacteria 3305
191 Ga0207678_10502712 3300026067 Bacteria 1057
192 Ga0207678_11359010 3300026067 Bacteria 628
193 Ga0207678_11459745 3300026067 Bacteria 604
194 Ga0207702_10173785 3300026078 Bacteria 1978
195 Ga0207702_11823200 3300026078 Bacteria 600
196 Ga0207641_10939198 3300026088 Bacteria 860
197 Ga0207648_10054954 3300026089 Bacteria 3476
198 Ga0207676_10032354 3300026095 Bacteria 3941
199 Ga0207676_10156225 3300026095 Bacteria 1971
200 Ga0207676_10688988 3300026095 Bacteria 989
201 Ga0207676_11228979 3300026095 Bacteria 743
202 Ga0207674_10019570 3300026116 Bacteria 7331
203 Ga0207675_100340633 3300026118 Bacteria 1468
204 Ga0207683_10721673 3300026121 Bacteria 924
205 Ga0207683_11954441 3300026121 Bacteria 535
206 Ga0207698_10383036 3300026142 Bacteria 1338
207 Ga0207698_10473158 3300026142 Bacteria 1214
208 Ga0209974_10269850 3300027876 Bacteria 645
209 Ga0268266_10248396 3300028379 Bacteria 1645
210 Ga0268266_10688522 3300028379 Bacteria 985
211 Ga0268266_11043217 3300028379 Bacteria 791
212 Ga0268266_12372291 3300028379 Bacteria 501
213 Ga0307517_10163630 3300028786 Bacteria 1485
214 Ga0307517_10422356 3300028786 Bacteria 699
215 Ga0307515_10018388 3300028794 Bacteria 12655
216 Ga0307405_10135558 3300031731 Bacteria 1709
217 Ga0307410_10206812 3300031852 Bacteria 1502
218 Ga0307407_10834955 3300031903 Bacteria 703
219 Ga0307412_10503088 3300031911 Bacteria 1009
220 Ga0307416_101222455 3300032002 Bacteria 857
221 Ga0307411_11074117 3300032005 Unclassified 724
222 Ga0307415_100263852 3300032126 Unclassified 1407
223 Ga0307510_10089756 3300033180 Bacteria 2924
224 Ga0373943_0249817 3300035170 Bacteria 996
225 Ga0373924_0251806 3300035410 Bacteria 782
226 Ga0373937_0166089 3300036401 Bacteria 2070
227 Ga0373925_0119992 3300037068 Bacteria 2041
228 Ga0395900_1513095 3300037418 Bacteria 583
229 Ga0395898_0456158 3300037466 Bacteria 1217
230 Ga0395905_0287107 3300037471 Bacteria 1532
231 Ga0395901_1966107 3300038443 Bacteria 531
232 Ga0451802_1063897 3300041460 Bacteria 500
233 Ga0451837_1575149 3300041494 Bacteria 1364
234 Ga0451841_1030003 3300041498 Bacteria 645
235 Ga0451849_0925173 3300041505 Bacteria 1201
236 Ga0451853_1424976 3300041512 Bacteria 1823
237 Ga0451577_0013933 3300042876 Bacteria 7504
238 Ga0453684_0491383 3300044712 Bacteria 1360
239 Ga0466968_0421305 3300044735 Unclassified 657
240 Ga0495592_0912364 3300046454 Bacteria 516
241 Ga0495603_0544746 3300046455 Bacteria 664
242 Ga0495590_0070985 3300046457 Bacteria 1222
243 Ga0495629_0393157 3300046459 Bacteria 943
244 Ga0495638_0000617 3300046460 Bacteria 39602
245 Ga0495638_0007589 3300046460 Bacteria 7760
246 Ga0495638_0658787 3300046460 Bacteria 508
247 Ga0495650_0113964 3300046471 Bacteria 1001
248 Ga0495580_0426914 3300046472 Bacteria 891
249 Ga0495605_0092073 3300046474 Bacteria 1404
250 Ga0495639_0195977 3300046475 Bacteria 987
251 Ga0495585_0632159 3300046492 Bacteria 502
252 Ga0495596_0246666 3300046500 Bacteria 693
253 Ga0495583_0450824 3300046506 Bacteria 504
254 Ga0495606_0288982 3300046507 Bacteria 893
255 Ga0495608_0552376 3300046511 Bacteria 694
256 Ga0495610_0055589 3300046512 Bacteria 1907
257 Ga0495616_0163142 3300046513 Bacteria 1001
258 Ga0495616_0197131 3300046513 Bacteria 887
259 Ga0495616_0256919 3300046513 Bacteria 749
260 Ga0495620_0075457 3300046515 Bacteria 1372
261 Ga0495620_0151293 3300046515 Bacteria 905
262 Ga0495628_0891636 3300046516 Bacteria 618
263 Ga0495630_1360847 3300046517 Bacteria 534
264 Ga0495631_0061931 3300046518 Bacteria 1622
265 Ga0495632_0200296 3300046519 Bacteria 909
266 Ga0495637_0039984 3300046520 Bacteria 2021
267 Ga0495644_0386249 3300046523 Bacteria 553
268 Ga0495648_0029291 3300046524 Bacteria 3656
269 Ga0495648_0029383 3300046524 Bacteria 3649
270 Ga0495663_0003374 3300046525 Bacteria 4617
271 Ga0495642_0146745 3300046528 Bacteria 1019
272 Ga0495654_0199685 3300046530 Bacteria 856
273 Ga0495598_0060001 3300046537 Bacteria 1171
274 Ga0495609_0063575 3300046538 Bacteria 1629
275 Ga0495645_0595805 3300046543 Bacteria 680
276 Ga0495633_0013469 3300046558 Bacteria 4308
277 Ga0495668_0294649 3300046616 Bacteria 889
278 Ga0495625_0400899 3300046660 Bacteria 857
279 Ga0495635_1054880 3300046663 Bacteria 516
280 Ga0495659_0189341 3300046664 Bacteria 840
281 Ga0495661_0127760 3300046665 Bacteria 1397
282 Ga0495588_0065484 3300046674 Bacteria 1885
283 Ga0495588_0177653 3300046674 Bacteria 1125
284 Ga0495647_0277036 3300046681 Bacteria 752
285 Ga0495647_0611394 3300046681 Bacteria 512
286 Ga0495669_0044253 3300046684 Bacteria 1983
287 Ga0495671_0062417 3300046692 Bacteria 1836
288 Ga0495671_0130566 3300046692 Bacteria 1225
289 Ga0495649_0188949 3300046694 Bacteria 1073
290 Ga0495600_0692885 3300046809 Bacteria 613
291 Ga0495581_0422986 3300047315 Bacteria 776
292 Ga0495604_0758630 3300047317 Bacteria 613
293 Ga0495674_0597232 3300047319 Bacteria 875
294 Ga0495672_0448569 3300047320 Bacteria 582
295 Ga0495676_0405492 3300047321 Bacteria 904
296 Ga0495673_0086635 3300047469 Bacteria 1287
297 Ga0495686_0005885 3300047472 Bacteria 9560
298 Ga0495686_0183256 3300047472 Bacteria 1212
299 Ga0495686_0608713 3300047472 Bacteria 565
300 Ga0495593_0695758 3300047673 Bacteria 510
301 Ga0495593_0702845 3300047673 Bacteria 508
302 Ga0495614_0528544 3300048089 Bacteria 563
303 Ga0496100_0046402 3300048903 Bacteria 2793
304 Ga0496100_0341411 3300048903 Bacteria 1129
305 Ga0496100_0759602 3300048903 Bacteria 758
306 Ga0496101_0083687 3300048904 Bacteria 2362
307 Ga0496101_0153915 3300048904 Bacteria 1760
308 Ga0496103_0394467 3300048906 Bacteria 889
309 Ga0496105_0057509 3300048908 Bacteria 3211
310 Ga0496105_0354576 3300048908 Bacteria 1171
311 Ga0496106_0262670 3300048909 Bacteria 1381
312 Ga0496107_0024121 3300048910 Bacteria 4302
313 Ga0496107_0929833 3300048910 Bacteria 633
314 Ga0496108_0663838 3300048911 Bacteria 906
315 Ga0496109_1203463 3300048912 Bacteria 694
316 Ga0496110_0665625 3300048913 Bacteria 941
317 Ga0496112_0318630 3300048915 Bacteria 1499
318 Ga0496113_0017016 3300048916 Bacteria 5037
319 Ga0496114_0275634 3300048917 Bacteria 1482
320 Ga0496114_0374712 3300048917 Bacteria 1260
321 Ga0496115_0117333 3300048918 Bacteria 2189
322 Ga0496116_0167187 3300048919 Bacteria 1197
323 Ga0496116_0208858 3300048919 Bacteria 1014
324 Ga0496117_0370717 3300048920 Bacteria 732
325 Ga0496118_0073793 3300048921 Bacteria 2442
326 Ga0496119_0318996 3300048922 Bacteria 761
327 Ga0496121_0155010 3300048924 Bacteria 1681
328 Ga0496121_0251422 3300048924 Bacteria 1226
329 Ga0496122_0090981 3300048925 Bacteria 2079
330 Ga0496123_0137437 3300048926 Bacteria 1342
331 Ga0496124_0690644 3300048927 Bacteria 648
332 Ga0496125_0031940 3300048928 Bacteria 4683
333 Ga0496125_0109258 3300048928 Bacteria 2008
334 Ga0496125_0271207 3300048928 Bacteria 1057
335 Ga0496126_0092626 3300048929 Bacteria 2655
336 Ga0496126_0153900 3300048929 Bacteria 1969
337 Ga0501046_1085650 3300049580 Bacteria 553
338 Ga0501047_1244674 3300049581 Bacteria 558
339 Ga0501069_0625721 3300049585 Bacteria 647
340 Ga0501070_0095961 3300049586 Bacteria 2453
341 Ga0501076_0610484 3300049592 Bacteria 900
342 Ga0501077_0045589 3300049593 Bacteria 2785
343 Ga0501080_0258076 3300049742 Bacteria 1588
344 Ga0501081_0160257 3300049743 Bacteria 1621
345 Ga0501083_0136758 3300049744 Bacteria 1605
346 Ga0501044_0483639 3300049823 Bacteria 1141
347 nmdc:mga03683_234185_c1 3300050489 Bacteria 850
348 nmdc:mga03n38_111064_c1 3300050490 Bacteria 1335
349 nmdc:mga03n38_326130_c1 3300050490 Bacteria 830
350 nmdc:mga03n38_480054_c1 3300050490 Bacteria 695
351 nmdc:mga03n38_852023_c1 3300050490 Bacteria 533
352 nmdc:mga0yw44_163119_c1 3300050492 Bacteria 1460
353 nmdc:mga0yw44_759611_c1 3300050492 Bacteria 658
354 nmdc:mga0k408_274918_c1 3300050493 Bacteria 1005
355 nmdc:mga0n895_12336_c1 3300050512 Bacteria 7663
356 nmdc:mga0rr50_11356_c1 3300050513 Bacteria 3990
357 nmdc:mga08x19_594244_c1 3300050514 Bacteria 784
358 nmdc:mga0a205_12012_c1 3300050515 Bacteria 7999
359 nmdc:mga0sz30_430864_c1 3300050516 Bacteria 591
360 Ga0495601_0357206 3300053077 Bacteria 950
361 Ga0495655_0244122 3300053083 Unclassified 602
362 Ga0500578_0671273 3300053086 Unclassified 561
363 Ga0500644_0055210 3300053088 Bacteria 1378
364 Ga0500641_0005560 3300053096 Bacteria 4464
365 Ga0500557_261366 3300053105 Bacteria 538
366 Ga0500594_0006714 3300053118 Bacteria 2591
367 Ga0500595_077558 3300053119 Bacteria 977
368 Ga0500559_0094551 3300053136 Bacteria 1372
369 Ga0500586_027711 3300053145 Bacteria 1843
370 Ga0500604_0019312 3300053151 Bacteria 1907
371 Ga0500627_0008771 3300053158 Bacteria 3608
372 Ga0500636_0303553 3300053177 Bacteria 785
373 Ga0500625_003662 3300053729 Bacteria 6118
374 Ga0500645_060078 3300053730 Bacteria 1100
375 Ga0207694_11629422
376 JGI25153J46596_10084187
377 rootH1_10256815
378 Ga0055542_1012097
379 Ga0055529_1006435
380 Ga0065707_11172946
381 Ga0070658_10013838
382 Ga0070658_10204975
383 Ga0070683_100003724
384 Ga0070670_100005991
385 Ga0070670_100459472
386 Ga0070666_10262364
387 Ga0070680_100444444
388 Ga0070682_100181083
389 Ga0070682_100219592
390 Ga0070660_100237335
391 Ga0070660_100788277
392 Ga0070661_100211332
393 Ga0070661_100882358
394 Ga0070668_100653417
395 Ga0070669_100017577
396 Ga0070675_100017393
397 Ga0070671_100470939
398 Ga0070673_101067903
399 Ga0070673_101094615
400 Ga0070659_100128347
401 Ga0070659_100615701
402 Ga0070659_101170046
403 Ga0070713_100276197
404 Ga0070711_100035079
405 Ga0070663_100044776
406 Ga0070663_100526704
407 Ga0070663_101349462
408 Ga0070663_102016509
409 Ga0070678_101878403
410 Ga0070662_100481988
411 Ga0068867_101831254
412 Ga0070679_100253342
413 Ga0070679_100652334
414 Ga0070684_100000930
415 Ga0070684_100600939
416 Ga0068853_100479368
417 Ga0068853_100579379
418 Ga0070672_100048569
419 Ga0070672_101114188
420 Ga0070665_100072314
421 Ga0070665_100128927
422 Ga0070665_100626757
423 Ga0070665_101565605
424 Ga0068855_100345393
425 Ga0070664_100008362
426 Ga0070664_100108057
427 Ga0070664_100132234
428 Ga0068857_100118240
429 Ga0068857_100454336
430 Ga0068856_100419781
431 Ga0068856_101088226
432 Ga0068852_100720214
433 Ga0068852_100778152
434 Ga0068852_101501068
435 Ga0068859_100489785
436 Ga0068859_102355524
437 Ga0068864_100027235
438 Ga0068864_100081216
439 Ga0068864_100272449
440 Ga0068866_10308573
441 Ga0068861_100506945
442 Ga0068861_101289906
443 Ga0068851_10222680
444 Ga0068870_10138334
445 Ga0068870_10139900
446 Ga0068863_100142823
447 Ga0068858_100134062
448 Ga0068858_101743104
449 Ga0068860_100155622
450 Ga0075365_10382025
451 Ga0075363_100259912
452 Ga0075363_100652786
453 Ga0075363_100931410
454 Ga0070712_100275223
455 Ga0075362_10237372
456 Ga0075369_10205632
457 Ga0075366_10469713
458 Ga0097621_100075856
459 Ga0097621_100298605
460 Ga0097621_100341617
461 Ga0068871_100139892
462 Ga0068871_101304673
463 Ga0075433_10001101
464 Ga0075434_100065393
465 Ga0068865_101148162
466 Ga0097620_100489784
467 Ga0097620_102356171
468 Ga0075435_100007578
469 Ga0105244_10000019
470 Ga0105245_10804368
471 Ga0105245_11890864
472 Ga0105247_10022484
473 Ga0105241_10002471
474 Ga0105242_10749444
475 Ga0105242_11386596
476 Ga0105248_10094068
477 Ga0105248_10498570
478 Ga0105238_11227718
479 Ga0105249_10331278
480 Ga0105239_10259508
481 Ga0157373_10779496
482 Ga0157373_11045649
483 Ga0157373_11176884
484 Ga0157369_10265788
485 Ga0157374_10966861
486 Ga0157374_11270881
487 Ga0157378_10359536
488 Ga0163162_10548375
489 Ga0163162_11393956
490 Ga0157372_10087577
491 Ga0157375_10149598
492 Ga0157375_10190284
493 Ga0157375_11623800
494 Ga0163163_10195512
495 Ga0163163_12172531
496 Ga0157376_10460745
497 Ga0209258_110279
498 Ga0207425_1000208
499 Ga0209148_1002481
500 Ga0209455_1001489
501 Ga0209025_1006863
502 Ga0209758_1001162
503 Ga0209758_1001601
504 Ga0207656_10014120
505 Ga0207655_1000025
506 Ga0207692_10450953
507 Ga0207642_10229638
508 Ga0207710_10119828
509 Ga0207710_10301809
510 Ga0207680_10212579
511 Ga0207647_10420889
512 Ga0207685_10043877
513 Ga0207645_10089091
514 Ga0207643_10079652
515 Ga0207705_10017509
516 Ga0207654_10021980
517 Ga0207693_10055814
518 Ga0207693_10929861
519 Ga0207663_10109893
520 Ga0207663_10942131
521 Ga0207660_10254146
522 Ga0207657_10057060
523 Ga0207657_10481148
524 Ga0207657_10629658
525 Ga0207649_10940481
526 Ga0207652_10246974
527 Ga0207652_11270225
528 Ga0207681_10072829
529 Ga0207681_11399661
530 Ga0207694_10903820
531 Ga0207650_10009347
532 Ga0207650_10088638
533 Ga0207659_10003630
534 Ga0207687_10130637
535 Ga0207687_10900361
536 Ga0207700_11414332
537 Ga0207690_10207951
538 Ga0207690_10341018
539 Ga0207690_11272779
540 Ga0207686_10922236
541 Ga0207709_10504238
542 Ga0207670_10775058
543 Ga0207704_10291783
544 Ga0207665_10233989
545 Ga0207691_10048791
546 Ga0207691_10083333
547 Ga0207711_10793212
548 Ga0207661_10196653
549 Ga0207679_10066967
550 Ga0207679_10255874
551 Ga0207679_10903060
552 Ga0207667_10354069
553 Ga0207667_11483579
554 Ga0207651_10961643
555 Ga0207668_10316556
556 Ga0207668_10638180
557 Ga0207640_10366759
558 Ga0207677_10184805
559 Ga0207703_11206074
560 Ga0207639_10035522
561 Ga0207639_10100494
562 Ga0207678_10045019
563 Ga0207678_10049772
564 Ga0207678_10058886
565 Ga0207678_10502712
566 Ga0207678_11359010
567 Ga0207678_11459745
568 Ga0207702_10173785
569 Ga0207702_11823200
570 Ga0207641_10939198
571 Ga0207648_10054954
572 Ga0207676_10032354
573 Ga0207676_10156225
574 Ga0207676_10688988
575 Ga0207676_11228979
576 Ga0207674_10019570
577 Ga0207675_100340633
578 Ga0207683_10721673
579 Ga0207683_11954441
580 Ga0207698_10383036
581 Ga0207698_10473158
582 Ga0209974_10269850
583 Ga0268266_10248396
584 Ga0268266_10688522
585 Ga0268266_11043217
586 Ga0268266_12372291
587 Ga0307517_10163630
588 Ga0307517_10422356
589 Ga0307515_10018388
590 Ga0307405_10135558
591 Ga0307410_10206812
592 Ga0307407_10834955
593 Ga0307412_10503088
594 Ga0307416_101222455
595 Ga0307411_11074117
596 Ga0307415_100263852
597 Ga0307510_10089756
598 Ga0373943_0249817
599 Ga0373924_0251806
600 Ga0373937_0166089
601 Ga0373925_0119992
602 Ga0395900_1513095
603 Ga0395898_0456158
604 Ga0395905_0287107
605 Ga0395901_1966107
606 Ga0451802_1063897
607 Ga0451837_1575149
608 Ga0451841_1030003
609 Ga0451849_0925173
610 Ga0451853_1424976
611 Ga0451577_0013933
612 Ga0453684_0491383
613 Ga0466968_0421305
614 Ga0495592_0912364
615 Ga0495603_0544746
616 Ga0495590_0070985
617 Ga0495629_0393157
618 Ga0495638_0000617
619 Ga0495638_0007589
620 Ga0495638_0658787
621 Ga0495650_0113964
622 Ga0495580_0426914
623 Ga0495605_0092073
624 Ga0495639_0195977
625 Ga0495585_0632159
626 Ga0495596_0246666
627 Ga0495583_0450824
628 Ga0495606_0288982
629 Ga0495608_0552376
630 Ga0495610_0055589
631 Ga0495616_0163142
632 Ga0495616_0197131
633 Ga0495616_0256919
634 Ga0495620_0075457
635 Ga0495620_0151293
636 Ga0495628_0891636
637 Ga0495630_1360847
638 Ga0495631_0061931
639 Ga0495632_0200296
640 Ga0495637_0039984
641 Ga0495644_0386249
642 Ga0495648_0029291
643 Ga0495648_0029383
644 Ga0495663_0003374
645 Ga0495642_0146745
646 Ga0495654_0199685
647 Ga0495598_0060001
648 Ga0495609_0063575
649 Ga0495645_0595805
650 Ga0495633_0013469
651 Ga0495668_0294649
652 Ga0495625_0400899
653 Ga0495635_1054880
654 Ga0495659_0189341
655 Ga0495661_0127760
656 Ga0495588_0065484
657 Ga0495588_0177653
658 Ga0495647_0277036
659 Ga0495647_0611394
660 Ga0495669_0044253
661 Ga0495671_0062417
662 Ga0495671_0130566
663 Ga0495649_0188949
664 Ga0495600_0692885
665 Ga0495581_0422986
666 Ga0495604_0758630
667 Ga0495674_0597232
668 Ga0495672_0448569
669 Ga0495676_0405492
670 Ga0495673_0086635
671 Ga0495686_0005885
672 Ga0495686_0183256
673 Ga0495686_0608713
674 Ga0495593_0695758
675 Ga0495593_0702845
676 Ga0495614_0528544
677 Ga0496100_0046402
678 Ga0496100_0341411
679 Ga0496100_0759602
680 Ga0496101_0083687
681 Ga0496101_0153915
682 Ga0496103_0394467
683 Ga0496105_0057509
684 Ga0496105_0354576
685 Ga0496106_0262670
686 Ga0496107_0024121
687 Ga0496107_0929833
688 Ga0496108_0663838
689 Ga0496109_1203463
690 Ga0496110_0665625
691 Ga0496112_0318630
692 Ga0496113_0017016
693 Ga0496114_0275634
694 Ga0496114_0374712
695 Ga0496115_0117333
696 Ga0496116_0167187
697 Ga0496116_0208858
698 Ga0496117_0370717
699 Ga0496118_0073793
700 Ga0496119_0318996
701 Ga0496121_0155010
702 Ga0496121_0251422
703 Ga0496122_0090981
704 Ga0496123_0137437
705 Ga0496124_0690644
706 Ga0496125_0031940
707 Ga0496125_0109258
708 Ga0496125_0271207
709 Ga0496126_0092626
710 Ga0496126_0153900
711 Ga0501046_1085650
712 Ga0501047_1244674
713 Ga0501069_0625721
714 Ga0501070_0095961
715 Ga0501076_0610484
716 Ga0501077_0045589
717 Ga0501080_0258076
718 Ga0501081_0160257
719 Ga0501083_0136758
720 Ga0501044_0483639
721 nmdc:mga03683_234185_c1
722 nmdc:mga03n38_111064_c1
723 nmdc:mga03n38_326130_c1
724 nmdc:mga03n38_480054_c1
725 nmdc:mga03n38_852023_c1
726 nmdc:mga0yw44_163119_c1
727 nmdc:mga0yw44_759611_c1
728 nmdc:mga0k408_274918_c1
729 nmdc:mga0n895_12336_c1
730 nmdc:mga0rr50_11356_c1
731 nmdc:mga08x19_594244_c1
732 nmdc:mga0a205_12012_c1
733 nmdc:mga0sz30_430864_c1
734 Ga0495601_0357206
735 Ga0495655_0244122
736 Ga0500578_0671273
737 Ga0500644_0055210
738 Ga0500641_0005560
739 Ga0500557_261366
740 Ga0500594_0006714
741 Ga0500595_077558
742 Ga0500559_0094551
743 Ga0500586_027711
744 Ga0500604_0019312
745 Ga0500627_0008771
746 Ga0500636_0303553
747 Ga0500625_003662
748 Ga0500645_060078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

24

116

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8673 1 104
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.8565 1 104
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8382 1 100
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8279 1 100
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.8238 1 102
ID Description Score Start End Superfamily
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9662 3 103 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9325 2 104 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.931 5 102 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9305 3 103 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9187 1 104 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A0S2TEV1-F1-model_v4 Transporter 0.978 2 103 GO:0005886
GO:0022857
AF-A0A495W2Y9-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9779 2 103 GO:0005886
GO:0022857
AF-A0A511Z0N4-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9763 1 102 GO:0005886
GO:0022857
AF-A0A2E8T819-F1-model_v4 deleted 0.9756 2 101
AF-A0A4U0QEJ9-F1-model_v4 Guanidinium exporter 0.9749 1 102 GO:0005886
GO:0022857

Map