F426469

General Info

Members Datasets Scaffolds Average Seq Length
373 238 742 326

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0000059|Ga0495636_0000059_43698_44822
Length 374
Sequence LEPTPALVANGRWCAEFVVLGKNLGRSGKRPPTARPTLATSNHSQELHSMKHISIGGLEVSRIGLGAMSMSGYYNIGAGSDAESIRAIHRALDLGVTHLDTAEIYGPYANEELVGRAIKGRRDQVVLATKFGIVSHAGGGPGVLDSSPVNIRTAVEGSLKRLGTDHIDLYYQHRVDPDTPIEDTVGALAELVSEGKVRFLGLSEAGPATIRRAHAVHPIAALQTEYSLWTRDPEAELLPLLRELGIGFVPYSPLGHGFLTGDIRSPEQLSDDDWRKTNPRFAGENFQKNLRIVDEVKAVAFEAGATPAQVALAWLLAQGNDIAPIPGTKRVARVEENSAADGIELSVVQIDRLNRLTPAAGERHDEGNMAVIDR

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
234 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
235 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
236 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
237 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
238 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.48
Nodule 0.27
Rhizoplane 4.83
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0000059 3300047318 Bacteria 47988
2 JGI25152J39213_1016703 3300002773 Bacteria 1407
3 JGI25151J46595_10000224 3300003187 Bacteria 67033
4 Ga0065707_10085953 3300005295 Bacteria 5771
5 Ga0065707_10094536 3300005295 Bacteria 3485
6 Ga0070658_10011030 3300005327 Bacteria 7244
7 Ga0070683_100035103 3300005329 Bacteria 4584
8 Ga0070690_100045833 3300005330 Bacteria 2779
9 Ga0068869_100064304 3300005334 Bacteria 2698
10 Ga0070682_100093649 3300005337 Bacteria 1970
11 Ga0070691_10057699 3300005341 Bacteria 1863
12 Ga0070669_100018940 3300005353 Bacteria 4920
13 Ga0070674_100155506 3300005356 Bacteria 1730
14 Ga0070673_100037370 3300005364 Bacteria 3699
15 Ga0070667_100375456 3300005367 Bacteria 1291
16 Ga0070709_10016262 3300005434 Bacteria 4244
17 Ga0070709_10137792 3300005434 Bacteria 1673
18 Ga0070714_100094335 3300005435 Bacteria 2626
19 Ga0070713_100179785 3300005436 Bacteria 1900
20 Ga0070711_100236062 3300005439 Bacteria 1428
21 Ga0070705_100012076 3300005440 Bacteria 4378
22 Ga0070694_100002558 3300005444 Bacteria 10748
23 Ga0070708_100000474 3300005445 Bacteria 30352
24 Ga0070708_100006266 3300005445 Bacteria 9465
25 Ga0070708_100091696 3300005445 Bacteria 2767
26 Ga0070708_100131588 3300005445 Bacteria 2316
27 Ga0070708_100177289 3300005445 Bacteria 1992
28 Ga0070681_10001831 3300005458 Bacteria 19173
29 Ga0070681_10018144 3300005458 Bacteria 7036
30 Ga0070681_10275291 3300005458 Bacteria 1594
31 Ga0070706_100084346 3300005467 Bacteria 2943
32 Ga0070706_100152720 3300005467 Bacteria 2155
33 Ga0070707_100008404 3300005468 Bacteria 9587
34 Ga0070707_100132580 3300005468 Bacteria 2423
35 Ga0070707_100358985 3300005468 Bacteria 1415
36 Ga0070698_100078964 3300005471 Bacteria 3288
37 Ga0070698_100150797 3300005471 Bacteria 2272
38 Ga0070698_100207225 3300005471 Bacteria 1896
39 Ga0070698_100390893 3300005471 Bacteria 1324
40 Ga0070699_100000002 3300005518 Bacteria 423451
41 Ga0070699_100000036 3300005518 Bacteria 133816
42 Ga0070699_100043428 3300005518 Bacteria 3891
43 Ga0070699_100064486 3300005518 Bacteria 3177
44 Ga0070699_100136759 3300005518 Bacteria 2162
45 Ga0070699_100204676 3300005518 Bacteria 1756
46 Ga0070679_100017613 3300005530 Bacteria 6916
47 Ga0070679_100111831 3300005530 Bacteria 2717
48 Ga0070684_100028264 3300005535 Bacteria 4743
49 Ga0070684_100257045 3300005535 Bacteria 1597
50 Ga0070697_100008430 3300005536 Bacteria 8042
51 Ga0070697_100021681 3300005536 Bacteria 5092
52 Ga0070697_100257741 3300005536 Bacteria 1493
53 Ga0068853_100511467 3300005539 Bacteria 1134
54 Ga0070695_100022838 3300005545 Bacteria 3840
55 Ga0070695_100032104 3300005545 Bacteria 3282
56 Ga0070695_100116038 3300005545 Bacteria 1825
57 Ga0070696_100070822 3300005546 Bacteria 2453
58 Ga0070696_100079414 3300005546 Bacteria 2321
59 Ga0070696_100250922 3300005546 Bacteria 1338
60 Ga0070704_100006481 3300005549 Bacteria 6903
61 Ga0070704_100089783 3300005549 Bacteria 2287
62 Ga0068855_100212253 3300005563 Bacteria 2174
63 Ga0068854_100036176 3300005578 Bacteria 3460
64 Ga0068854_100187088 3300005578 Bacteria 1621
65 Ga0068856_100016751 3300005614 Bacteria 7100
66 Ga0068856_100579066 3300005614 Bacteria 1144
67 Ga0070702_100095608 3300005615 Bacteria 1811
68 Ga0070702_100273608 3300005615 Bacteria 1156
69 Ga0068859_100000167 3300005617 Bacteria 63385
70 Ga0068859_100005639 3300005617 Bacteria 12761
71 Ga0068859_100158253 3300005617 Bacteria 2343
72 Ga0068861_100169205 3300005719 Bacteria 1810
73 Ga0068861_100292097 3300005719 Bacteria 1408
74 Ga0068863_100026558 3300005841 Bacteria 5522
75 Ga0068863_100115339 3300005841 Bacteria 2559
76 Ga0068860_100000138 3300005843 Bacteria 119368
77 Ga0068860_100037201 3300005843 Bacteria 4659
78 Ga0068862_100000225 3300005844 Bacteria 62775
79 Ga0070717_10033954 3300006028 Bacteria 4120
80 Ga0075365_10020070 3300006038 Bacteria 4136
81 Ga0075368_10001588 3300006042 Bacteria 7294
82 Ga0075363_100022917 3300006048 Bacteria 3161
83 Ga0075364_10051177 3300006051 Bacteria 2697
84 Ga0075364_10053982 3300006051 Bacteria 2627
85 Ga0070715_10115416 3300006163 Bacteria 1273
86 Ga0070712_100084885 3300006175 Bacteria 2303
87 Ga0070712_100235744 3300006175 Bacteria 1455
88 Ga0075362_10013720 3300006177 Bacteria 3250
89 Ga0075362_10016296 3300006177 Bacteria 3041
90 Ga0075367_10001111 3300006178 Bacteria 11151
91 Ga0075367_10015476 3300006178 Bacteria 4148
92 Ga0075369_10001139 3300006186 Bacteria 8962
93 Ga0097621_100081227 3300006237 Bacteria 2697
94 Ga0068871_100308104 3300006358 Bacteria 1391
95 Ga0075428_100008840 3300006844 Bacteria 11176
96 Ga0075428_100228686 3300006844 Bacteria 2007
97 Ga0075428_100317298 3300006844 Bacteria 1675
98 Ga0075428_100323752 3300006844 Bacteria 1656
99 Ga0075430_100104889 3300006846 Bacteria 2359
100 Ga0075431_100001739 3300006847 Bacteria 20484
101 Ga0075431_100091838 3300006847 Bacteria 3133
102 Ga0075433_10035082 3300006852 Bacteria 4311
103 Ga0075434_100000999 3300006871 Bacteria 22949
104 Ga0075434_100080343 3300006871 Bacteria 3257
105 Ga0075434_100431064 3300006871 Bacteria 1340
106 Ga0097620_100000167 3300006931 Bacteria 63385
107 Ga0097620_100005639 3300006931 Bacteria 12761
108 Ga0097620_100158249 3300006931 Bacteria 2343
109 Ga0099795_10061931 3300007788 Bacteria 1391
110 Ga0105240_10029221 3300009093 Bacteria 7188
111 Ga0111539_10000053 3300009094 Bacteria 115976
112 Ga0111539_10042721 3300009094 Bacteria 5441
113 Ga0111539_10128723 3300009094 Bacteria 2965
114 Ga0105245_10009857 3300009098 Bacteria 8321
115 Ga0105245_10442381 3300009098 Bacteria 1307
116 Ga0105247_10055797 3300009101 Bacteria 2438
117 Ga0114129_10478301 3300009147 Bacteria 1630
118 Ga0114129_10483692 3300009147 Bacteria 1619
119 Ga0114129_10853646 3300009147 Bacteria 1157
120 Ga0105241_10176212 3300009174 Bacteria 1770
121 Ga0105242_10005412 3300009176 Bacteria 9875
122 Ga0105248_10015683 3300009177 Bacteria 8351
123 Ga0105248_10123876 3300009177 Bacteria 2915
124 Ga0105237_10002675 3300009545 Bacteria 21859
125 Ga0105237_10004581 3300009545 Bacteria 15959
126 Ga0105237_10052359 3300009545 Bacteria 4098
127 Ga0105237_10474273 3300009545 Bacteria 1257
128 Ga0105238_10024327 3300009551 Bacteria 6173
129 Ga0105249_10127030 3300009553 Bacteria 2429
130 Ga0105249_10487557 3300009553 Bacteria 1276
131 Ga0105239_10000714 3300010375 Bacteria 47078
132 Ga0105239_10235609 3300010375 Bacteria 2054
133 Ga0105239_10323943 3300010375 Bacteria 1738
134 Ga0157373_10024463 3300013100 Bacteria 4373
135 Ga0157371_10272366 3300013102 Bacteria 1222
136 Ga0157369_10050990 3300013105 Bacteria 4480
137 Ga0157374_10057349 3300013296 Bacteria 3637
138 Ga0157374_10118229 3300013296 Bacteria 2556
139 Ga0157378_10070208 3300013297 Bacteria 3144
140 Ga0157378_10079603 3300013297 Bacteria 2959
141 Ga0163162_10000246 3300013306 Bacteria 48982
142 Ga0163162_10020141 3300013306 Bacteria 6550
143 Ga0163162_10110457 3300013306 Bacteria 2846
144 Ga0163162_10309522 3300013306 Bacteria 1712
145 Ga0157375_10000373 3300013308 Bacteria 40703
146 Ga0157375_10035171 3300013308 Bacteria 4780
147 Ga0157375_10222078 3300013308 Bacteria 2048
148 Ga0163163_10098212 3300014325 Bacteria 2949
149 Ga0157379_10001234 3300014968 Bacteria 20742
150 Ga0157379_10284760 3300014968 Bacteria 1504
151 Ga0157376_10000044 3300014969 Bacteria 110557
152 Ga0157376_10016603 3300014969 Bacteria 5594
153 Ga0157376_10073709 3300014969 Bacteria 2908
154 Ga0209129_1000265 3300025258 Bacteria 51980
155 Ga0209129_1001166 3300025258 Bacteria 15152
156 Ga0209455_1000261 3300025272 Bacteria 60720
157 Ga0209025_1000204 3300025294 Bacteria 142193
158 Ga0207699_10000032 3300025906 Bacteria 137608
159 Ga0207699_10026691 3300025906 Bacteria 3188
160 Ga0207705_10009047 3300025909 Bacteria 7257
161 Ga0207684_10227638 3300025910 Bacteria 1609
162 Ga0207707_10013761 3300025912 Bacteria 7055
163 Ga0207707_10019901 3300025912 Bacteria 5859
164 Ga0207695_10039157 3300025913 Bacteria 5097
165 Ga0207671_10000560 3300025914 Bacteria 49995
166 Ga0207671_10032078 3300025914 Bacteria 3910
167 Ga0207671_10259289 3300025914 Bacteria 1368
168 Ga0207693_10013516 3300025915 Bacteria 6580
169 Ga0207663_10125534 3300025916 Bacteria 1765
170 Ga0207660_10109074 3300025917 Bacteria 2080
171 Ga0207652_10012273 3300025921 Bacteria 6919
172 Ga0207652_10183399 3300025921 Bacteria 1881
173 Ga0207646_10009303 3300025922 Bacteria 9716
174 Ga0207646_10026377 3300025922 Bacteria 5303
175 Ga0207646_10281039 3300025922 Bacteria 1504
176 Ga0207681_10009044 3300025923 Bacteria 6086
177 Ga0207681_10209946 3300025923 Bacteria 1500
178 Ga0207694_10057583 3300025924 Bacteria 3021
179 Ga0207694_10194041 3300025924 Bacteria 1651
180 Ga0207687_10076377 3300025927 Bacteria 2406
181 Ga0207700_10161045 3300025928 Bacteria 1864
182 Ga0207706_10006665 3300025933 Bacteria 10677
183 Ga0207686_10006322 3300025934 Bacteria 6371
184 Ga0207686_10081434 3300025934 Bacteria 2113
185 Ga0207669_10173572 3300025937 Bacteria 1537
186 Ga0207669_10189973 3300025937 Bacteria 1481
187 Ga0207704_10115073 3300025938 Bacteria 1827
188 Ga0207711_10152262 3300025941 Bacteria 2088
189 Ga0207689_10044613 3300025942 Bacteria 3666
190 Ga0207661_10008027 3300025944 Bacteria 7524
191 Ga0207651_10285300 3300025960 Bacteria 1366
192 Ga0207712_10321688 3300025961 Bacteria 1276
193 Ga0207640_10028463 3300025981 Bacteria 3417
194 Ga0207658_10115727 3300025986 Bacteria 2129
195 Ga0207708_10142759 3300026075 Bacteria 1880
196 Ga0207702_10030082 3300026078 Bacteria 4524
197 Ga0207702_10152170 3300026078 Bacteria 2105
198 Ga0207641_10016201 3300026088 Bacteria 6104
199 Ga0207675_100064024 3300026118 Bacteria 3436
200 Ga0207698_10041443 3300026142 Bacteria 3431
201 Ga0207428_10000061 3300027907 Bacteria 155152
202 Ga0207428_10057333 3300027907 Bacteria 3092
203 Ga0268266_10163203 3300028379 Bacteria 2017
204 Ga0268265_10000878 3300028380 Bacteria 28113
205 Ga0268264_10000109 3300028381 Bacteria 208477
206 Ga0268264_10550403 3300028381 Bacteria 1132
207 Ga0265337_1004625 3300028556 Bacteria 5668
208 Ga0307515_10012154 3300028794 Bacteria 16235
209 Ga0307511_10000151 3300030521 Bacteria 66032
210 Ga0265320_10000103 3300031240 Bacteria 72829
211 Ga0307513_10000001 3300031456 Bacteria 1660464
212 Ga0307509_10000027 3300031507 Bacteria 228470
213 Ga0307509_10054443 3300031507 Bacteria 4260
214 Ga0307509_10063023 3300031507 Bacteria 3906
215 Ga0307509_10112905 3300031507 Bacteria 2716
216 Ga0307408_100045035 3300031548 Bacteria 3149
217 Ga0307508_10002159 3300031616 Bacteria 21065
218 Ga0307508_10237101 3300031616 Bacteria 1422
219 Ga0265314_10010201 3300031711 Bacteria 7866
220 Ga0307516_10001314 3300031730 Bacteria 34482
221 Ga0307516_10182006 3300031730 Bacteria 1834
222 Ga0307405_10002387 3300031731 Bacteria 8272
223 Ga0307413_10002171 3300031824 Bacteria 7882
224 Ga0307413_10035944 3300031824 Bacteria 2847
225 Ga0307410_10035457 3300031852 Bacteria 3240
226 Ga0307406_10012194 3300031901 Bacteria 4897
227 Ga0307407_10008005 3300031903 Bacteria 4822
228 Ga0307412_10103490 3300031911 Bacteria 2018
229 Ga0307409_100003652 3300031995 Bacteria 8418
230 Ga0307416_100002624 3300032002 Bacteria 10394
231 Ga0307416_100047638 3300032002 Bacteria 3394
232 Ga0307414_10143011 3300032004 Bacteria 1875
233 Ga0307411_10009394 3300032005 Bacteria 5137
234 Ga0307415_100000247 3300032126 Bacteria 23410
235 Ga0307415_100001436 3300032126 Bacteria 11402
236 Ga0307510_10000011 3300033180 Bacteria 355464
237 Ga0373959_0003639 3300034820 Bacteria 2465
238 Ga0373954_0066187 3300035118 Bacteria 1711
239 Ga0373943_0006159 3300035170 Bacteria 5384
240 Ga0373943_0024241 3300035170 Bacteria 2828
241 Ga0373946_0005339 3300035171 Bacteria 4627
242 Ga0373924_0004666 3300035410 Bacteria 4806
243 Ga0373931_0044267 3300035691 Bacteria 2347
244 Ga0373935_0027261 3300035692 Bacteria 3531
245 Ga0373927_0108205 3300035695 Bacteria 1811
246 Ga0373933_0067426 3300035724 Bacteria 2171
247 Ga0373925_0000043 3300037068 Bacteria 134268
248 Ga0373925_0050011 3300037068 Bacteria 3117
249 Ga0395898_0091624 3300037466 Bacteria 2924
250 Ga0395898_0388283 3300037466 Bacteria 1331
251 Ga0395905_0409087 3300037471 Bacteria 1252
252 Ga0395901_0389195 3300038443 Bacteria 1434
253 Ga0242420_000640 3300038996 Bacteria 4100
254 Ga0451576_0209297 3300045051 Bacteria 2037
255 Ga0495627_010759 3300046453 Bacteria 3309
256 Ga0495603_0049631 3300046455 Bacteria 2498
257 Ga0495590_0005183 3300046457 Bacteria 5184
258 Ga0495638_0001880 3300046460 Bacteria 18161
259 Ga0495638_0003301 3300046460 Bacteria 12725
260 Ga0495638_0006694 3300046460 Bacteria 8351
261 Ga0495638_0096241 3300046460 Bacteria 1777
262 Ga0495641_0032054 3300046461 Bacteria 2505
263 Ga0495650_0082138 3300046471 Bacteria 1240
264 Ga0495580_0002047 3300046472 Bacteria 17696
265 Ga0495639_0016504 3300046475 Bacteria 3207
266 Ga0495594_0014225 3300046499 Bacteria 4166
267 Ga0495594_0060559 3300046499 Bacteria 2094
268 Ga0495648_0004494 3300046524 Bacteria 11907
269 Ga0495633_0000383 3300046558 Bacteria 46815
270 Ga0495656_0056988 3300046615 Bacteria 1690
271 Ga0495668_0214428 3300046616 Bacteria 1054
272 Ga0495625_0003426 3300046660 Bacteria 15826
273 Ga0495625_0116514 3300046660 Bacteria 1822
274 Ga0495588_0138946 3300046674 Bacteria 1283
275 Ga0495624_0036233 3300046690 Bacteria 3183
276 Ga0495604_0282345 3300047317 Bacteria 1121
277 Ga0495636_0118491 3300047318 Bacteria 1170
278 Ga0495672_0077028 3300047320 Bacteria 1871
279 Ga0495672_0126426 3300047320 Bacteria 1351
280 Ga0495680_0116457 3300047322 Bacteria 1976
281 Ga0495687_000014 3300047443 Bacteria 366896
282 Ga0495679_013997 3300047446 Bacteria 2990
283 Ga0496100_0003114 3300048903 Bacteria 8584
284 Ga0496101_0286891 3300048904 Bacteria 1287
285 Ga0496102_0062195 3300048905 Bacteria 3418
286 Ga0496103_0019905 3300048906 Bacteria 4030
287 Ga0496104_0057489 3300048907 Bacteria 3680
288 Ga0496105_0013252 3300048908 Bacteria 6542
289 Ga0496105_0156825 3300048908 Bacteria 1869
290 Ga0496107_0137847 3300048910 Bacteria 1803
291 Ga0496109_0000753 3300048912 Bacteria 26958
292 Ga0496109_0059711 3300048912 Bacteria 3484
293 Ga0496110_0088401 3300048913 Bacteria 2767
294 Ga0496110_0127999 3300048913 Bacteria 2292
295 Ga0496111_0078681 3300048914 Bacteria 2404
296 Ga0496112_0112756 3300048915 Bacteria 2690
297 Ga0496112_0235109 3300048915 Bacteria 1786
298 Ga0496115_0000002 3300048918 Bacteria 365286
299 Ga0496115_0013030 3300048918 Bacteria 6276
300 Ga0496115_0102760 3300048918 Bacteria 2344
301 Ga0496126_0000052 3300048929 Bacteria 312383
302 Ga0496126_0129176 3300048929 Bacteria 2185
303 Ga0495682_0102793 3300049460 Bacteria 1025
304 Ga0501072_0035085 3300049588 Bacteria 3931
305 Ga0501073_0036438 3300049589 Bacteria 3495
306 nmdc:mga03683_25048_c1 3300050489 Bacteria 2339
307 nmdc:mga00v17_15765_c1 3300050491 Bacteria 4248
308 nmdc:mga00v17_24327_c1 3300050491 Bacteria 3512
309 nmdc:mga00v17_25130_c1 3300050491 Bacteria 3460
310 nmdc:mga00v17_26212_c1 3300050491 Bacteria 3395
311 nmdc:mga00v17_39712_c1 3300050491 Bacteria 2820
312 nmdc:mga0yw44_1452_c1 3300050492 Bacteria 9414
313 nmdc:mga06z11_152320_c1 3300050494 Bacteria 1316
314 nmdc:mga04h51_918_c1 3300050495 Bacteria 6808
315 nmdc:mga07m45_6473_c1 3300050496 Bacteria 5922
316 nmdc:mga05p37_194915_c1 3300050507 Bacteria 2457
317 nmdc:mga05p37_222545_c1 3300050507 Bacteria 2277
318 nmdc:mga05p37_246_c1 3300050507 Bacteria 55408
319 nmdc:mga05p37_370865_c1 3300050507 Bacteria 1680
320 nmdc:mga05p37_73369_c1 3300050507 Bacteria 4212
321 nmdc:mga09592_24201_c1 3300050508 Bacteria 5020
322 nmdc:mga0qj67_58218_c1 3300050509 Bacteria 3063
323 nmdc:mga0qj67_93035_c1 3300050509 Bacteria 2424
324 nmdc:mga06r32_183027_c1 3300050510 Bacteria 2081
325 nmdc:mga06r32_29803_c1 3300050510 Bacteria 5118
326 nmdc:mga06r32_62460_c1 3300050510 Bacteria 3589
327 nmdc:mga06r32_873_c1 3300050510 Bacteria 26832
328 nmdc:mga06r32_99225_c1 3300050510 Bacteria 2856
329 nmdc:mga08y16_32988_c1 3300050511 Bacteria 5441
330 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
331 nmdc:mga08y16_68470_c1 3300050511 Bacteria 3701
332 nmdc:mga0n895_221075_c1 3300050512 Bacteria 1923
333 nmdc:mga0n895_40279_c1 3300050512 Bacteria 4538
334 nmdc:mga0n895_4048_c1 3300050512 Bacteria 11929
335 nmdc:mga0n895_55945_c1 3300050512 Bacteria 3885
336 nmdc:mga0rr50_24309_c1 3300050513 Bacteria 4195
337 nmdc:mga08x19_58641_c1 3300050514 Bacteria 2491
338 nmdc:mga0a205_210416_c1 3300050515 Bacteria 1833
339 nmdc:mga0a205_78917_c1 3300050515 Bacteria 3181
340 nmdc:mga0sz30_1330_c1 3300050516 Bacteria 8804
341 nmdc:mga0sz30_91774_c1 3300050516 Bacteria 1322
342 Ga0500610_0094998 3300053079 Bacteria 1546
343 Ga0500651_0029700 3300053093 Bacteria 3439
344 Ga0500555_000407 3300053103 Bacteria 17915
345 Ga0500556_0029814 3300053104 Bacteria 1843
346 Ga0500557_050513 3300053105 Unclassified 1332
347 Ga0500569_011294 3300053109 Bacteria 2128
348 Ga0500607_000248 3300053121 Bacteria 50460
349 Ga0500608_003563 3300053122 Bacteria 5864
350 Ga0500618_014885 3300053125 Bacteria 1976
351 Ga0500642_0029706 3300053130 Bacteria 2267
352 Ga0500652_010438 3300053131 Bacteria 3183
353 Ga0500658_0002418 3300053134 Bacteria 7227
354 Ga0500561_0014080 3300053137 Bacteria 1748
355 Ga0500568_0003903 3300053139 Bacteria 8117
356 Ga0500568_0009816 3300053139 Bacteria 4522
357 Ga0500577_0001319 3300053142 Bacteria 6351
358 Ga0500588_0004506 3300053146 Bacteria 3027
359 Ga0500616_0000066 3300053153 Bacteria 237304
360 Ga0500616_0001318 3300053153 Bacteria 24495
361 Ga0500616_0041901 3300053153 Bacteria 2454
362 Ga0500622_0002132 3300053156 Bacteria 14733
363 Ga0500639_118732 3300053163 Bacteria 1274
364 Ga0500637_0058509 3300053178 Bacteria 2206
365 Ga0500645_000218 3300053730 Bacteria 43808
366 2812354866 2811994879 Bacteria 9313447
367 2857737863 2857737099 Bacteria 3104305
368 2902816480 2902810491 Bacteria 6794147
369 2929926477 2929921140 Bacteria 8649150
370 2954382931 2954380949 Bacteria 10050426
371 8002783379 8002775197 Bacteria 10728764
372 Ga0495636_0000059
373 JGI25152J39213_1016703
374 JGI25151J46595_10000224
375 Ga0065707_10085953
376 Ga0065707_10094536
377 Ga0070658_10011030
378 Ga0070683_100035103
379 Ga0070690_100045833
380 Ga0068869_100064304
381 Ga0070682_100093649
382 Ga0070691_10057699
383 Ga0070669_100018940
384 Ga0070674_100155506
385 Ga0070673_100037370
386 Ga0070667_100375456
387 Ga0070709_10016262
388 Ga0070709_10137792
389 Ga0070714_100094335
390 Ga0070713_100179785
391 Ga0070711_100236062
392 Ga0070705_100012076
393 Ga0070694_100002558
394 Ga0070708_100000474
395 Ga0070708_100006266
396 Ga0070708_100091696
397 Ga0070708_100131588
398 Ga0070708_100177289
399 Ga0070681_10001831
400 Ga0070681_10018144
401 Ga0070681_10275291
402 Ga0070706_100084346
403 Ga0070706_100152720
404 Ga0070707_100008404
405 Ga0070707_100132580
406 Ga0070707_100358985
407 Ga0070698_100078964
408 Ga0070698_100150797
409 Ga0070698_100207225
410 Ga0070698_100390893
411 Ga0070699_100000002
412 Ga0070699_100000036
413 Ga0070699_100043428
414 Ga0070699_100064486
415 Ga0070699_100136759
416 Ga0070699_100204676
417 Ga0070679_100017613
418 Ga0070679_100111831
419 Ga0070684_100028264
420 Ga0070684_100257045
421 Ga0070697_100008430
422 Ga0070697_100021681
423 Ga0070697_100257741
424 Ga0068853_100511467
425 Ga0070695_100022838
426 Ga0070695_100032104
427 Ga0070695_100116038
428 Ga0070696_100070822
429 Ga0070696_100079414
430 Ga0070696_100250922
431 Ga0070704_100006481
432 Ga0070704_100089783
433 Ga0068855_100212253
434 Ga0068854_100036176
435 Ga0068854_100187088
436 Ga0068856_100016751
437 Ga0068856_100579066
438 Ga0070702_100095608
439 Ga0070702_100273608
440 Ga0068859_100000167
441 Ga0068859_100005639
442 Ga0068859_100158253
443 Ga0068861_100169205
444 Ga0068861_100292097
445 Ga0068863_100026558
446 Ga0068863_100115339
447 Ga0068860_100000138
448 Ga0068860_100037201
449 Ga0068862_100000225
450 Ga0070717_10033954
451 Ga0075365_10020070
452 Ga0075368_10001588
453 Ga0075363_100022917
454 Ga0075364_10051177
455 Ga0075364_10053982
456 Ga0070715_10115416
457 Ga0070712_100084885
458 Ga0070712_100235744
459 Ga0075362_10013720
460 Ga0075362_10016296
461 Ga0075367_10001111
462 Ga0075367_10015476
463 Ga0075369_10001139
464 Ga0097621_100081227
465 Ga0068871_100308104
466 Ga0075428_100008840
467 Ga0075428_100228686
468 Ga0075428_100317298
469 Ga0075428_100323752
470 Ga0075430_100104889
471 Ga0075431_100001739
472 Ga0075431_100091838
473 Ga0075433_10035082
474 Ga0075434_100000999
475 Ga0075434_100080343
476 Ga0075434_100431064
477 Ga0097620_100000167
478 Ga0097620_100005639
479 Ga0097620_100158249
480 Ga0099795_10061931
481 Ga0105240_10029221
482 Ga0111539_10000053
483 Ga0111539_10042721
484 Ga0111539_10128723
485 Ga0105245_10009857
486 Ga0105245_10442381
487 Ga0105247_10055797
488 Ga0114129_10478301
489 Ga0114129_10483692
490 Ga0114129_10853646
491 Ga0105241_10176212
492 Ga0105242_10005412
493 Ga0105248_10015683
494 Ga0105248_10123876
495 Ga0105237_10002675
496 Ga0105237_10004581
497 Ga0105237_10052359
498 Ga0105237_10474273
499 Ga0105238_10024327
500 Ga0105249_10127030
501 Ga0105249_10487557
502 Ga0105239_10000714
503 Ga0105239_10235609
504 Ga0105239_10323943
505 Ga0157373_10024463
506 Ga0157371_10272366
507 Ga0157369_10050990
508 Ga0157374_10057349
509 Ga0157374_10118229
510 Ga0157378_10070208
511 Ga0157378_10079603
512 Ga0163162_10000246
513 Ga0163162_10020141
514 Ga0163162_10110457
515 Ga0163162_10309522
516 Ga0157375_10000373
517 Ga0157375_10035171
518 Ga0157375_10222078
519 Ga0163163_10098212
520 Ga0157379_10001234
521 Ga0157379_10284760
522 Ga0157376_10000044
523 Ga0157376_10016603
524 Ga0157376_10073709
525 Ga0209129_1000265
526 Ga0209129_1001166
527 Ga0209455_1000261
528 Ga0209025_1000204
529 Ga0207699_10000032
530 Ga0207699_10026691
531 Ga0207705_10009047
532 Ga0207684_10227638
533 Ga0207707_10013761
534 Ga0207707_10019901
535 Ga0207695_10039157
536 Ga0207671_10000560
537 Ga0207671_10032078
538 Ga0207671_10259289
539 Ga0207693_10013516
540 Ga0207663_10125534
541 Ga0207660_10109074
542 Ga0207652_10012273
543 Ga0207652_10183399
544 Ga0207646_10009303
545 Ga0207646_10026377
546 Ga0207646_10281039
547 Ga0207681_10009044
548 Ga0207681_10209946
549 Ga0207694_10057583
550 Ga0207694_10194041
551 Ga0207687_10076377
552 Ga0207700_10161045
553 Ga0207706_10006665
554 Ga0207686_10006322
555 Ga0207686_10081434
556 Ga0207669_10173572
557 Ga0207669_10189973
558 Ga0207704_10115073
559 Ga0207711_10152262
560 Ga0207689_10044613
561 Ga0207661_10008027
562 Ga0207651_10285300
563 Ga0207712_10321688
564 Ga0207640_10028463
565 Ga0207658_10115727
566 Ga0207708_10142759
567 Ga0207702_10030082
568 Ga0207702_10152170
569 Ga0207641_10016201
570 Ga0207675_100064024
571 Ga0207698_10041443
572 Ga0207428_10000061
573 Ga0207428_10057333
574 Ga0268266_10163203
575 Ga0268265_10000878
576 Ga0268264_10000109
577 Ga0268264_10550403
578 Ga0265337_1004625
579 Ga0307515_10012154
580 Ga0307511_10000151
581 Ga0265320_10000103
582 Ga0307513_10000001
583 Ga0307509_10000027
584 Ga0307509_10054443
585 Ga0307509_10063023
586 Ga0307509_10112905
587 Ga0307408_100045035
588 Ga0307508_10002159
589 Ga0307508_10237101
590 Ga0265314_10010201
591 Ga0307516_10001314
592 Ga0307516_10182006
593 Ga0307405_10002387
594 Ga0307413_10002171
595 Ga0307413_10035944
596 Ga0307410_10035457
597 Ga0307406_10012194
598 Ga0307407_10008005
599 Ga0307412_10103490
600 Ga0307409_100003652
601 Ga0307416_100002624
602 Ga0307416_100047638
603 Ga0307414_10143011
604 Ga0307411_10009394
605 Ga0307415_100000247
606 Ga0307415_100001436
607 Ga0307510_10000011
608 Ga0373959_0003639
609 Ga0373954_0066187
610 Ga0373943_0006159
611 Ga0373943_0024241
612 Ga0373946_0005339
613 Ga0373924_0004666
614 Ga0373931_0044267
615 Ga0373935_0027261
616 Ga0373927_0108205
617 Ga0373933_0067426
618 Ga0373925_0000043
619 Ga0373925_0050011
620 Ga0395898_0091624
621 Ga0395898_0388283
622 Ga0395905_0409087
623 Ga0395901_0389195
624 Ga0242420_000640
625 Ga0451576_0209297
626 Ga0495627_010759
627 Ga0495603_0049631
628 Ga0495590_0005183
629 Ga0495638_0001880
630 Ga0495638_0003301
631 Ga0495638_0006694
632 Ga0495638_0096241
633 Ga0495641_0032054
634 Ga0495650_0082138
635 Ga0495580_0002047
636 Ga0495639_0016504
637 Ga0495594_0014225
638 Ga0495594_0060559
639 Ga0495648_0004494
640 Ga0495633_0000383
641 Ga0495656_0056988
642 Ga0495668_0214428
643 Ga0495625_0003426
644 Ga0495625_0116514
645 Ga0495588_0138946
646 Ga0495624_0036233
647 Ga0495604_0282345
648 Ga0495636_0118491
649 Ga0495672_0077028
650 Ga0495672_0126426
651 Ga0495680_0116457
652 Ga0495687_000014
653 Ga0495679_013997
654 Ga0496100_0003114
655 Ga0496101_0286891
656 Ga0496102_0062195
657 Ga0496103_0019905
658 Ga0496104_0057489
659 Ga0496105_0013252
660 Ga0496105_0156825
661 Ga0496107_0137847
662 Ga0496109_0000753
663 Ga0496109_0059711
664 Ga0496110_0088401
665 Ga0496110_0127999
666 Ga0496111_0078681
667 Ga0496112_0112756
668 Ga0496112_0235109
669 Ga0496115_0000002
670 Ga0496115_0013030
671 Ga0496115_0102760
672 Ga0496126_0000052
673 Ga0496126_0129176
674 Ga0495682_0102793
675 Ga0501072_0035085
676 Ga0501073_0036438
677 nmdc:mga03683_25048_c1
678 nmdc:mga00v17_15765_c1
679 nmdc:mga00v17_24327_c1
680 nmdc:mga00v17_25130_c1
681 nmdc:mga00v17_26212_c1
682 nmdc:mga00v17_39712_c1
683 nmdc:mga0yw44_1452_c1
684 nmdc:mga06z11_152320_c1
685 nmdc:mga04h51_918_c1
686 nmdc:mga07m45_6473_c1
687 nmdc:mga05p37_194915_c1
688 nmdc:mga05p37_222545_c1
689 nmdc:mga05p37_246_c1
690 nmdc:mga05p37_370865_c1
691 nmdc:mga05p37_73369_c1
692 nmdc:mga09592_24201_c1
693 nmdc:mga0qj67_58218_c1
694 nmdc:mga0qj67_93035_c1
695 nmdc:mga06r32_183027_c1
696 nmdc:mga06r32_29803_c1
697 nmdc:mga06r32_62460_c1
698 nmdc:mga06r32_873_c1
699 nmdc:mga06r32_99225_c1
700 nmdc:mga08y16_32988_c1
701 nmdc:mga08y16_4_c1
702 nmdc:mga08y16_68470_c1
703 nmdc:mga0n895_221075_c1
704 nmdc:mga0n895_40279_c1
705 nmdc:mga0n895_4048_c1
706 nmdc:mga0n895_55945_c1
707 nmdc:mga0rr50_24309_c1
708 nmdc:mga08x19_58641_c1
709 nmdc:mga0a205_210416_c1
710 nmdc:mga0a205_78917_c1
711 nmdc:mga0sz30_1330_c1
712 nmdc:mga0sz30_91774_c1
713 Ga0500610_0094998
714 Ga0500651_0029700
715 Ga0500555_000407
716 Ga0500556_0029814
717 Ga0500557_050513
718 Ga0500569_011294
719 Ga0500607_000248
720 Ga0500608_003563
721 Ga0500618_014885
722 Ga0500642_0029706
723 Ga0500652_010438
724 Ga0500658_0002418
725 Ga0500561_0014080
726 Ga0500568_0003903
727 Ga0500568_0009816
728 Ga0500577_0001319
729 Ga0500588_0004506
730 Ga0500616_0000066
731 Ga0500616_0001318
732 Ga0500616_0041901
733 Ga0500622_0002132
734 Ga0500639_118732
735 Ga0500637_0058509
736 Ga0500645_000218
737 2812354866
738 2857737863
739 2902816480
740 2929926477
741 2954382931
742 8002783379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

62

357

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8992 14 328
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8972 16 317
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.893 14 328
6ovx-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+, p422 form 0.8909 14 319
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.8898 14 319
ID Description Score Start End Superfamily
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.935 19 336 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9266 15 330 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9044 86 336 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9041 15 322 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9013 15 322 3.20.20.100
ID Description Score Start End GO Terms
AF-Q0JE28-F1-model_v4 Os04g0338100 protein 0.973 117 203
AF-A0A1N7REV1-F1-model_v4 Predicted oxidoreductase 0.968 14 338 GO:0004033
GO:0005737
GO:0016020
AF-A0A7W0KPQ5-F1-model_v4 Aldo/keto reductase 0.9662 233 328 GO:0004033
GO:0005737
AF-W9VHQ2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9623 102 210 GO:0004033
GO:0005737
AF-A0A3N5PSF6-F1-model_v4 Aldo/keto reductase 0.9568 143 338 GO:0004033
GO:0005737

Map