F426167

General Info

Members Datasets Scaffolds Average Seq Length
372 257 362 319

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0021565|Ga0501067_0021565_2491_3504
Length 337
Sequence MTQAPAATAPGPLQDLAGTPDDLTTVNATLGGDTQSRKEQIVLGALIIVPFLAVAAAIPVAWGGWLGWTDVLITVVMYWLTGHGITVGFHRLFTHKSYKPNRAVKVAVAIAGSMAIQGPVVRWVADHRKHHKFSDRDGDPHSPWRYGTSVGALTKGFVHAHLMWLFDPEQTPQRKYAPDLMKDRDIVRISRQFPFWVVVSLLAPAVAGGLLTWSWQGAVTAFFWGSLVRVSLLHHVTWSINSICHTIGARPFVSRDKSANVWWLAIPSMGESWHNLHHADPTCARHGVLRGQLDTSARIIWFMEKLGWVHDVRWPVKERIAAKLVRNQTPSDVPTAA

Samples

Sample ID Description Type Environment
1 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
2 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221696 Nocardioides sp. Root140 Isolate Unclassified
5 2684623036 Frankia sp. CgIM4 Isolate Nodule
6 2710264753 Frankia sp. KB5 Isolate Nodule
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 637000116 Frankia casuarinae CcI3 Isolate Nodule
255 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
256 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
257 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.43
Metatranscriptomes 1.88
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0.81
Rhizoplane 8.06
Rhizosphere 86.02
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10012993 3300002075 Bacteria 1809
2 Ga0070658_10000294 3300005327 Bacteria 43582
3 Ga0070683_100045908 3300005329 Bacteria 4033
4 Ga0068869_100246603 3300005334 Bacteria 1425
5 Ga0070666_10037917 3300005335 Bacteria 3206
6 Ga0070680_100000466 3300005336 Bacteria 27668
7 Ga0070680_100252687 3300005336 Bacteria 1490
8 Ga0070682_100008265 3300005337 Bacteria 5868
9 Ga0070682_100046234 3300005337 Bacteria 2700
10 Ga0068868_100080493 3300005338 Bacteria 2611
11 Ga0070660_100000966 3300005339 Bacteria 19231
12 Ga0070660_100036033 3300005339 Bacteria 3746
13 Ga0070689_100039033 3300005340 Bacteria 3634
14 Ga0070689_100247999 3300005340 Bacteria 1468
15 Ga0070691_10175708 3300005341 Bacteria 1112
16 Ga0070687_100029942 3300005343 Bacteria 2656
17 Ga0070661_100038647 3300005344 Bacteria 3475
18 Ga0070668_100034810 3300005347 Bacteria 3839
19 Ga0070669_100177540 3300005353 Bacteria 1664
20 Ga0070674_100042279 3300005356 Bacteria 3094
21 Ga0070673_100043230 3300005364 Bacteria 3480
22 Ga0070688_100130638 3300005365 Bacteria 1694
23 Ga0070659_100022047 3300005366 Bacteria 4860
24 Ga0070659_100043709 3300005366 Bacteria 3504
25 Ga0070659_100075970 3300005366 Bacteria 2679
26 Ga0070659_100108467 3300005366 Bacteria 2240
27 Ga0070667_100401483 3300005367 Bacteria 1248
28 Ga0070709_10042674 3300005434 Bacteria 2802
29 Ga0070714_100009102 3300005435 Bacteria 7790
30 Ga0070714_100150465 3300005435 Bacteria 2097
31 Ga0070714_100541377 3300005435 Bacteria 1114
32 Ga0070713_100101863 3300005436 Bacteria 2488
33 Ga0070701_10011497 3300005438 Bacteria 3960
34 Ga0070701_10096559 3300005438 Bacteria 1629
35 Ga0070711_100061244 3300005439 Bacteria 2619
36 Ga0070705_100012295 3300005440 Bacteria 4348
37 Ga0070705_100040441 3300005440 Bacteria 2651
38 Ga0070694_100017761 3300005444 Bacteria 4497
39 Ga0070708_100213618 3300005445 Bacteria 1808
40 Ga0070678_100018448 3300005456 Bacteria 4521
41 Ga0070681_10001311 3300005458 Bacteria 21720
42 Ga0070681_10021375 3300005458 Bacteria 6488
43 Ga0070681_10485023 3300005458 Bacteria 1149
44 Ga0068867_100012944 3300005459 Bacteria 5902
45 Ga0070685_10022138 3300005466 Bacteria 3461
46 Ga0070698_100003094 3300005471 Bacteria 18342
47 Ga0070699_100344305 3300005518 Bacteria 1342
48 Ga0070679_100000169 3300005530 Bacteria 52696
49 Ga0070679_100002298 3300005530 Bacteria 17283
50 Ga0070684_100037218 3300005535 Bacteria 4172
51 Ga0070684_100109598 3300005535 Bacteria 2474
52 Ga0068853_100015206 3300005539 Bacteria 6325
53 Ga0068853_100190315 3300005539 Bacteria 1864
54 Ga0070672_100114595 3300005543 Bacteria 2200
55 Ga0070672_100128566 3300005543 Bacteria 2080
56 Ga0070672_100154385 3300005543 Bacteria 1901
57 Ga0070686_100116310 3300005544 Bacteria 1830
58 Ga0070695_100072634 3300005545 Bacteria 2256
59 Ga0070696_100049082 3300005546 Bacteria 2931
60 Ga0070693_100037085 3300005547 Bacteria 2715
61 Ga0070704_100034343 3300005549 Bacteria 3438
62 Ga0068855_100043787 3300005563 Bacteria 5299
63 Ga0070664_100103885 3300005564 Bacteria 2474
64 Ga0070664_100505092 3300005564 Bacteria 1115
65 Ga0068854_100035708 3300005578 Bacteria 3481
66 Ga0068854_100071226 3300005578 Bacteria 2543
67 Ga0068854_100342111 3300005578 Bacteria 1222
68 Ga0068856_100096092 3300005614 Bacteria 2951
69 Ga0070702_100097114 3300005615 Bacteria 1799
70 Ga0068852_100005828 3300005616 Bacteria 8847
71 Ga0068852_100040165 3300005616 Bacteria 3945
72 Ga0068859_100242004 3300005617 Bacteria 1894
73 Ga0068864_100080412 3300005618 Bacteria 2855
74 Ga0068866_10076431 3300005718 Bacteria 1785
75 Ga0068861_100011457 3300005719 Bacteria 6168
76 Ga0068861_100052415 3300005719 Bacteria 3100
77 Ga0068870_10027506 3300005840 Bacteria 2845
78 Ga0068863_100020259 3300005841 Bacteria 6361
79 Ga0068863_100097748 3300005841 Bacteria 2788
80 Ga0068858_100144324 3300005842 Bacteria 2235
81 Ga0068858_100152724 3300005842 Bacteria 2171
82 Ga0068858_100677704 3300005842 Bacteria 1003
83 Ga0068860_100015855 3300005843 Bacteria 7356
84 Ga0068860_100240297 3300005843 Bacteria 1761
85 Ga0081455_10014885 3300005937 Bacteria 7584
86 Ga0081540_1011168 3300005983 Bacteria 6026
87 Ga0070717_10016646 3300006028 Bacteria 5706
88 Ga0075432_10047979 3300006058 Bacteria 1502
89 Ga0070716_100049818 3300006173 Bacteria 2374
90 Ga0070712_100031616 3300006175 Bacteria 3567
91 Ga0075362_10053800 3300006177 Bacteria 1808
92 Ga0097621_100053286 3300006237 Bacteria 3297
93 Ga0075428_100014322 3300006844 Bacteria 8816
94 Ga0075430_100075552 3300006846 Bacteria 2825
95 Ga0075430_100166228 3300006846 Bacteria 1836
96 Ga0075433_10020028 3300006852 Bacteria 5587
97 Ga0075434_100074715 3300006871 Bacteria 3382
98 Ga0068865_100016851 3300006881 Bacteria 4687
99 Ga0068865_100107461 3300006881 Bacteria 2052
100 Ga0068865_100171759 3300006881 Bacteria 1663
101 Ga0075436_100066388 3300006914 Bacteria 2493
102 Ga0097620_100242032 3300006931 Bacteria 1894
103 Ga0075435_100008153 3300007076 Bacteria 7502
104 Ga0105251_10053392 3300009011 Bacteria 1921
105 Ga0105240_10089421 3300009093 Bacteria 3766
106 Ga0111539_10011076 3300009094 Bacteria 11346
107 Ga0111539_10164191 3300009094 Bacteria 2597
108 Ga0105245_10081398 3300009098 Bacteria 2960
109 Ga0105247_10047552 3300009101 Bacteria 2635
110 Ga0105247_10056171 3300009101 Bacteria 2431
111 Ga0114129_10166211 3300009147 Bacteria 3010
112 Ga0105243_10006420 3300009148 Bacteria 9088
113 Ga0105243_10015159 3300009148 Bacteria 5832
114 Ga0105241_10018704 3300009174 Bacteria 5101
115 Ga0105242_10037687 3300009176 Bacteria 3885
116 Ga0105242_10049334 3300009176 Bacteria 3426
117 Ga0105242_10059762 3300009176 Bacteria 3129
118 Ga0105242_10563175 3300009176 Bacteria 1095
119 Ga0105248_10235612 3300009177 Bacteria 2061
120 Ga0105237_10017439 3300009545 Bacteria 7443
121 Ga0105237_10020333 3300009545 Bacteria 6847
122 Ga0105237_10095709 3300009545 Bacteria 2959
123 Ga0105237_10120169 3300009545 Bacteria 2621
124 Ga0105238_10082158 3300009551 Bacteria 3212
125 Ga0105238_10510480 3300009551 Bacteria 1204
126 Ga0105249_10007621 3300009553 Bacteria 9443
127 Ga0105249_10418850 3300009553 Bacteria 1373
128 Ga0105239_10143312 3300010375 Bacteria 2664
129 Ga0105239_10158961 3300010375 Bacteria 2524
130 Ga0105239_10317094 3300010375 Bacteria 1757
131 Ga0105239_10455121 3300010375 Bacteria 1452
132 Ga0105246_10000026 3300011119 Bacteria 54296
133 Ga0105246_10031271 3300011119 Bacteria 3522
134 Ga0105246_10336820 3300011119 Bacteria 1231
135 Ga0157373_10227358 3300013100 Bacteria 1317
136 Ga0157371_10085041 3300013102 Bacteria 2241
137 Ga0157369_10005216 3300013105 Bacteria 15175
138 Ga0157369_10012387 3300013105 Bacteria 9682
139 Ga0157369_10188428 3300013105 Bacteria 2168
140 Ga0157374_10025736 3300013296 Bacteria 5287
141 Ga0157378_10025706 3300013297 Bacteria 5186
142 Ga0157378_10070912 3300013297 Bacteria 3129
143 Ga0163162_10010160 3300013306 Bacteria 9144
144 Ga0157372_10132935 3300013307 Bacteria 2864
145 Ga0157372_10219788 3300013307 Bacteria 2202
146 Ga0157375_10046370 3300013308 Bacteria 4237
147 Ga0157375_10133889 3300013308 Bacteria 2600
148 Ga0163163_10150354 3300014325 Bacteria 2372
149 Ga0157380_10065322 3300014326 Bacteria 2924
150 Ga0157380_10094714 3300014326 Bacteria 2472
151 Ga0157380_10137341 3300014326 Bacteria 2095
152 Ga0157377_10046383 3300014745 Bacteria 2430
153 Ga0157377_10089289 3300014745 Bacteria 1817
154 Ga0157379_10078671 3300014968 Bacteria 2953
155 Ga0157376_10072079 3300014969 Bacteria 2937
156 Ga0163161_10007157 3300017792 Bacteria 7714
157 Ga0197907_11183462 3300020069 Bacteria 1093
158 Ga0206349_1119784 3300020075 Bacteria 1107
159 Ga0206355_1155132 3300020076 Bacteria 1288
160 Ga0206351_10774565 3300020077 Bacteria 2324
161 Ga0206351_10851589 3300020077 Bacteria 1150
162 Ga0206353_11371393 3300020082 Bacteria 1742
163 Ga0224712_10033636 3300022467 Bacteria 1878
164 Ga0207642_10015888 3300025899 Bacteria 2820
165 Ga0207642_10081175 3300025899 Bacteria 1575
166 Ga0207710_10045270 3300025900 Bacteria 1962
167 Ga0207688_10008999 3300025901 Bacteria 5435
168 Ga0207680_10065264 3300025903 Bacteria 2234
169 Ga0207647_10005591 3300025904 Bacteria 9186
170 Ga0207647_10015362 3300025904 Bacteria 5250
171 Ga0207699_10028820 3300025906 Bacteria 3090
172 Ga0207645_10010347 3300025907 Bacteria 6403
173 Ga0207643_10006354 3300025908 Bacteria 6329
174 Ga0207705_10000417 3300025909 Bacteria 37398
175 Ga0207707_10000066 3300025912 Bacteria 106182
176 Ga0207671_10021633 3300025914 Bacteria 4875
177 Ga0207671_10152139 3300025914 Bacteria 1788
178 Ga0207693_10002732 3300025915 Bacteria 15275
179 Ga0207660_10004554 3300025917 Bacteria 9041
180 Ga0207660_10013454 3300025917 Bacteria 5362
181 Ga0207660_10311402 3300025917 Bacteria 1255
182 Ga0207660_10354849 3300025917 Bacteria 1176
183 Ga0207662_10010531 3300025918 Bacteria 5109
184 Ga0207657_10004685 3300025919 Bacteria 14438
185 Ga0207657_10121500 3300025919 Bacteria 2149
186 Ga0207657_10170978 3300025919 Bacteria 1760
187 Ga0207657_10430978 3300025919 Bacteria 1036
188 Ga0207652_10000287 3300025921 Bacteria 52686
189 Ga0207652_10014001 3300025921 Bacteria 6494
190 Ga0207681_10143037 3300025923 Bacteria 1784
191 Ga0207694_10183755 3300025924 Bacteria 1696
192 Ga0207694_10222653 3300025924 Bacteria 1539
193 Ga0207687_10292393 3300025927 Bacteria 1310
194 Ga0207700_10172284 3300025928 Bacteria 1806
195 Ga0207664_10006816 3300025929 Bacteria 7894
196 Ga0207664_10445695 3300025929 Bacteria 1155
197 Ga0207644_10283462 3300025931 Bacteria 1331
198 Ga0207690_10002301 3300025932 Bacteria 11642
199 Ga0207690_10014122 3300025932 Bacteria 4815
200 Ga0207690_10066106 3300025932 Bacteria 2475
201 Ga0207690_10076806 3300025932 Bacteria 2320
202 Ga0207706_10011004 3300025933 Bacteria 8249
203 Ga0207706_10121710 3300025933 Bacteria 2295
204 Ga0207686_10030905 3300025934 Bacteria 3176
205 Ga0207704_10333250 3300025938 Bacteria 1175
206 Ga0207665_10000538 3300025939 Bacteria 25495
207 Ga0207691_10011312 3300025940 Bacteria 8562
208 Ga0207711_10219482 3300025941 Bacteria 1738
209 Ga0207689_10046366 3300025942 Bacteria 3592
210 Ga0207661_10417426 3300025944 Bacteria 1218
211 Ga0207679_10084776 3300025945 Bacteria 2432
212 Ga0207667_10154397 3300025949 Bacteria 2362
213 Ga0207667_10322464 3300025949 Bacteria 1578
214 Ga0207651_10165963 3300025960 Bacteria 1736
215 Ga0207712_10055031 3300025961 Bacteria 2797
216 Ga0207668_10098423 3300025972 Bacteria 2167
217 Ga0207668_10134073 3300025972 Bacteria 1895
218 Ga0207640_10049463 3300025981 Bacteria 2722
219 Ga0207640_10055877 3300025981 Bacteria 2588
220 Ga0207640_10139147 3300025981 Bacteria 1767
221 Ga0207658_10153718 3300025986 Bacteria 1878
222 Ga0207677_10002869 3300026023 Bacteria 9092
223 Ga0207677_10020752 3300026023 Bacteria 3997
224 Ga0207677_10155285 3300026023 Bacteria 1771
225 Ga0207708_10005718 3300026075 Bacteria 9193
226 Ga0207641_10080730 3300026088 Bacteria 2822
227 Ga0207648_10004558 3300026089 Bacteria 14205
228 Ga0207675_100002294 3300026118 Bacteria 18992
229 Ga0207675_100012912 3300026118 Bacteria 7800
230 Ga0207675_100022895 3300026118 Bacteria 5811
231 Ga0207675_100074474 3300026118 Bacteria 3177
232 Ga0207683_10000893 3300026121 Bacteria 27409
233 Ga0207683_10030160 3300026121 Bacteria 4698
234 Ga0207683_10133167 3300026121 Bacteria 2236
235 Ga0207698_10308475 3300026142 Bacteria 1476
236 Ga0207428_10100440 3300027907 Bacteria 2236
237 Ga0268266_10123175 3300028379 Bacteria 2309
238 Ga0268265_10098102 3300028380 Bacteria 2359
239 Ga0314311_1204474 3300030733 Bacteria 1505
240 Ga0316183_1038383 3300030742 Bacteria 1212
241 Ga0316182_1196784 3300030745 Bacteria 1207
242 Ga0307513_10000001 3300031456 Bacteria 1660464
243 Ga0307509_10065258 3300031507 Bacteria 3825
244 Ga0316576_10064172 3300031727 Bacteria 2697
245 Ga0316578_10019154 3300031728 Bacteria 3761
246 Ga0307410_10036683 3300031852 Bacteria 3195
247 Ga0307407_10090357 3300031903 Bacteria 1875
248 Ga0307412_10106018 3300031911 Bacteria 1998
249 Ga0307409_100226792 3300031995 Bacteria 1690
250 Ga0307411_10087808 3300032005 Bacteria 2161
251 Ga0373939_0001977 3300035114 Bacteria 4897
252 Ga0373960_0022289 3300035121 Bacteria 1694
253 Ga0373942_0006287 3300035207 Bacteria 2741
254 Ga0373962_0025898 3300035242 Bacteria 1577
255 Ga0316574_0050658 3300035398 Bacteria 2585
256 Ga0373931_0009811 3300035691 Bacteria 4585
257 Ga0316582_0150927 3300036647 Bacteria 1571
258 Ga0395899_0046126 3300037312 Bacteria 3246
259 Ga0395900_0248022 3300037418 Bacteria 1783
260 Ga0395898_0007961 3300037466 Bacteria 11238
261 Ga0395898_0125313 3300037466 Bacteria 2461
262 Ga0395901_0056823 3300038443 Bacteria 4071
263 Ga0436363_1636713 3300039450 Bacteria 2672
264 Ga0451853_3964862 3300041512 Bacteria 1397
265 Ga0439432_000307 3300042006 Bacteria 17662
266 Ga0439449_0001108 3300042007 Bacteria 10596
267 Ga0466965_0021499 3300044683 Bacteria 3106
268 Ga0466965_0035195 3300044683 Bacteria 2453
269 Ga0466966_0093868 3300044684 Bacteria 1860
270 Ga0466961_0053806 3300044693 Bacteria 2568
271 Ga0466961_0097431 3300044693 Bacteria 1854
272 Ga0466961_0122783 3300044693 Bacteria 1630
273 Ga0466963_0020941 3300044694 Bacteria 4120
274 Ga0466963_0072476 3300044694 Bacteria 2320
275 Ga0466971_0006954 3300044719 Bacteria 4921
276 Ga0466971_0025867 3300044719 Bacteria 2621
277 Ga0466970_0026518 3300044765 Bacteria 3037
278 Ga0466957_0020464 3300044842 Bacteria 3893
279 Ga0466960_0049573 3300044901 Bacteria 2022
280 Ga0466960_0132367 3300044901 Bacteria 1317
281 Ga0466959_0046068 3300045049 Bacteria 3210
282 Ga0466959_0126954 3300045049 Bacteria 1810
283 Ga0466958_0019053 3300045836 Bacteria 3991
284 Ga0466958_0026353 3300045836 Bacteria 3435
285 Ga0466958_0094278 3300045836 Bacteria 1855
286 Ga0466967_0062319 3300045976 Bacteria 3310
287 Ga0466967_0118468 3300045976 Bacteria 2442
288 Ga0495664_0028499 3300046477 Bacteria 3261
289 Ga0495680_0183085 3300047322 Bacteria 1511
290 Ga0495680_0270959 3300047322 Bacteria 1199
291 Ga0496100_0007370 3300048903 Bacteria 6065
292 Ga0496100_0030801 3300048903 Bacteria 3331
293 Ga0496101_0052682 3300048904 Bacteria 2935
294 Ga0496102_0000144 3300048905 Bacteria 96509
295 Ga0496102_0016308 3300048905 Bacteria 6489
296 Ga0496102_0253017 3300048905 Bacteria 1661
297 Ga0496103_0000829 3300048906 Bacteria 22726
298 Ga0496104_0032900 3300048907 Bacteria 4827
299 Ga0496104_0055424 3300048907 Bacteria 3749
300 Ga0496104_0058443 3300048907 Bacteria 3650
301 Ga0496105_0043453 3300048908 Bacteria 3706
302 Ga0496106_0021419 3300048909 Bacteria 4800
303 Ga0496106_0035442 3300048909 Bacteria 3731
304 Ga0496108_0020346 3300048911 Bacteria 5455
305 Ga0496108_0096836 3300048911 Bacteria 2514
306 Ga0496109_0197744 3300048912 Bacteria 1890
307 Ga0496109_0306783 3300048912 Bacteria 1497
308 Ga0496109_0396357 3300048912 Bacteria 1304
309 Ga0496109_0414017 3300048912 Bacteria 1273
310 Ga0496110_0011088 3300048913 Bacteria 7362
311 Ga0496110_0015868 3300048913 Bacteria 6280
312 Ga0496110_0040742 3300048913 Bacteria 4048
313 Ga0496111_0042489 3300048914 Bacteria 3264
314 Ga0496112_0041417 3300048915 Bacteria 4507
315 Ga0496114_0040483 3300048917 Bacteria 3858
316 Ga0496114_0109981 3300048917 Bacteria 2360
317 Ga0496114_0208155 3300048917 Bacteria 1715
318 Ga0496115_0158272 3300048918 Bacteria 1871
319 Ga0496116_0001878 3300048919 Bacteria 22687
320 Ga0496117_0000356 3300048920 Bacteria 80485
321 Ga0496118_0002824 3300048921 Bacteria 22725
322 Ga0496119_0009493 3300048922 Bacteria 8342
323 Ga0496120_0066936 3300048923 Bacteria 1986
324 Ga0496121_0002743 3300048924 Bacteria 26190
325 Ga0496124_0102757 3300048927 Bacteria 2312
326 Ga0496126_0002824 3300048929 Bacteria 22752
327 Ga0501032_0022637 3300049569 Bacteria 4354
328 Ga0501036_0012154 3300049572 Bacteria 7132
329 Ga0501037_0019081 3300049573 Bacteria 5055
330 Ga0501038_0134437 3300049574 Bacteria 2027
331 Ga0501040_0023479 3300049576 Bacteria 4136
332 Ga0501040_0130920 3300049576 Bacteria 1764
333 Ga0501041_0016123 3300049577 Bacteria 4438
334 Ga0501042_0007937 3300049578 Bacteria 6981
335 Ga0501043_0048332 3300049579 Bacteria 3345
336 Ga0501067_0021565 3300049583 Bacteria 3565
337 Ga0501068_0106460 3300049584 Bacteria 1741
338 Ga0501070_0016249 3300049586 Bacteria 6254
339 Ga0501072_0085752 3300049588 Bacteria 2498
340 Ga0501075_0149977 3300049591 Bacteria 1777
341 Ga0501076_0024251 3300049592 Bacteria 4686
342 Ga0501076_0074615 3300049592 Bacteria 2718
343 Ga0501076_0213914 3300049592 Bacteria 1576
344 Ga0501077_0048354 3300049593 Bacteria 2702
345 Ga0501261_013245 3300049690 Bacteria 1118
346 Ga0501045_0109203 3300049824 Bacteria 2050
347 nmdc:mga0yw44_185863_c1 3300050492 Bacteria 1369
348 nmdc:mga05p37_6050_c1 3300050507 Bacteria 14243
349 nmdc:mga09592_61865_c1 3300050508 Bacteria 3167
350 nmdc:mga06r32_45820_c1 3300050510 Bacteria 4171
351 nmdc:mga06r32_608752_c1 3300050510 Bacteria 1063
352 nmdc:mga06r32_61825_c1 3300050510 Bacteria 3606
353 nmdc:mga08y16_336887_c1 3300050511 Bacteria 1551
354 nmdc:mga0n895_54732_c1 3300050512 Bacteria 3926
355 nmdc:mga08x19_11020_c1 3300050514 Bacteria 5440
356 nmdc:mga0a205_41322_c1 3300050515 Bacteria 4440
357 Ga0500643_000769 3300053087 Bacteria 20938
358 Ga0501084_0037168 3300054114 Bacteria 4068
359 Ga0501084_0067840 3300054114 Bacteria 2986
360 Ga0466962_0016476 3300061719 Bacteria 3565
361 Ga0530510_0033142 3300061734 Bacteria 3718
362 Ga0530510_0183013 3300061734 Bacteria 1554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10014885 Ga0081455_100148856 276
2 3300035398 Ga0316574_0050658 Ga0316574_0050658_31_945 278
3 3300030745 Ga0316182_1196784 Ga0316182_11967841 280
4 3300042007 Ga0439449_0001108 Ga0439449_0001108_2077_3036 284
5 3300048903 Ga0496100_0007370 Ga0496100_0007370_984_1931 284
6 3300048911 Ga0496108_0096836 Ga0496108_0096836_750_1697 284
7 3300048922 Ga0496119_0009493 Ga0496119_0009493_964_1911 284
8 3300048923 Ga0496120_0066936 Ga0496120_0066936_381_1328 284
9 3300048924 Ga0496121_0002743 Ga0496121_0002743_11962_12909 284
10 iso_pu_bacteria 637000116 637879592 287
11 3300054114 Ga0501084_0067840 Ga0501084_0067840_872_1861 288
12 3300005336 Ga0070680_100000466 Ga0070680_1000004665 290
13 3300005458 Ga0070681_10001311 Ga0070681_1000131118 290
14 3300025912 Ga0207707_10000066 Ga0207707_100000665 290
15 3300025917 Ga0207660_10004554 Ga0207660_100045545 290
16 3300025921 Ga0207652_10000287 Ga0207652_1000028758 290
17 3300030733 Ga0314311_1204474 Ga0314311_12044741 290
18 3300044901 Ga0466960_0049573 Ga0466960_0049573_673_1641 293
19 3300013105 Ga0157369_10012387 Ga0157369_100123877 294
20 3300050492 nmdc:mga0yw44_185863_c1 nmdc:mga0yw44_185863_c1_308_1219 294
21 3300053087 Ga0500643_000769 Ga0500643_000769_19510_20427 294
22 3300005347 Ga0070668_100034810 Ga0070668_1000348103 297
23 3300005841 Ga0068863_100097748 Ga0068863_1000977482 297
24 3300005983 Ga0081540_1011168 Ga0081540_10111684 297
25 3300014968 Ga0157379_10078671 Ga0157379_100786712 297
26 3300025972 Ga0207668_10098423 Ga0207668_100984231 297
27 3300026088 Ga0207641_10080730 Ga0207641_100807302 297
28 3300031852 Ga0307410_10036683 Ga0307410_100366834 297
29 3300048905 Ga0496102_0000144 Ga0496102_0000144_36917_37864 297
30 3300048906 Ga0496103_0000829 Ga0496103_0000829_20974_21921 297
31 3300048912 Ga0496109_0197744 Ga0496109_0197744_756_1703 297
32 3300048919 Ga0496116_0001878 Ga0496116_0001878_20963_21910 297
33 3300048920 Ga0496117_0000356 Ga0496117_0000356_58576_59523 297
34 3300048921 Ga0496118_0002824 Ga0496118_0002824_786_1733 297
35 3300048927 Ga0496124_0102757 Ga0496124_0102757_582_1529 297
36 3300048929 Ga0496126_0002824 Ga0496126_0002824_21033_21980 297
37 3300013307 Ga0157372_10219788 Ga0157372_102197881 298
38 3300005535 Ga0070684_100109598 Ga0070684_1001095983 299
39 iso_pu_bacteria 2684623036 2686542821 299
40 iso_pu_bacteria 2710264753 2710603744 299
41 3300031727 Ga0316576_10064172 Ga0316576_100641723 300
42 3300031728 Ga0316578_10019154 Ga0316578_100191545 300
43 3300036647 Ga0316582_0150927 Ga0316582_0150927_234_1214 300
44 3300044693 Ga0466961_0053806 Ga0466961_0053806_92_1066 300
45 3300045836 Ga0466958_0094278 Ga0466958_0094278_590_1552 300
46 3300049591 Ga0501075_0149977 Ga0501075_0149977_13_990 300
47 iso_pu_bacteria 2599185167 2599401059 300
48 iso_pu_bacteria 2599185191 2599516654 300
49 3300030742 Ga0316183_1038383 Ga0316183_10383831 301
50 3300005440 Ga0070705_100040441 Ga0070705_1000404413 302
51 3300005578 Ga0068854_100342111 Ga0068854_1003421111 302
52 3300005615 Ga0070702_100097114 Ga0070702_1000971143 302
53 3300009148 Ga0105243_10015159 Ga0105243_100151597 302
54 3300009176 Ga0105242_10037687 Ga0105242_100376876 302
55 3300013297 Ga0157378_10025706 Ga0157378_100257064 302
56 3300013308 Ga0157375_10046370 Ga0157375_100463706 302
57 3300014326 Ga0157380_10137341 Ga0157380_101373412 302
58 3300025934 Ga0207686_10030905 Ga0207686_100309056 302
59 3300025961 Ga0207712_10055031 Ga0207712_100550316 302
60 3300025981 Ga0207640_10139147 Ga0207640_101391471 302
61 3300031507 Ga0307509_10065258 Ga0307509_100652582 302
62 iso_pu_bacteria 8056054917 8056055249 302
63 3300009545 Ga0105237_10095709 Ga0105237_100957092 303
64 3300005366 Ga0070659_100043709 Ga0070659_1000437092 304
65 3300009545 Ga0105237_10020333 Ga0105237_100203332 304
66 3300011119 Ga0105246_10000026 Ga0105246_100000266 304
67 3300025914 Ga0207671_10021633 Ga0207671_100216333 304
68 3300025932 Ga0207690_10014122 Ga0207690_100141222 304
69 3300042006 Ga0439432_000307 Ga0439432_000307_4252_5208 304
70 3300005327 Ga0070658_10000294 Ga0070658_1000029429 305
71 3300005335 Ga0070666_10037917 Ga0070666_100379172 305
72 3300005337 Ga0070682_100046234 Ga0070682_1000462342 305
73 3300005339 Ga0070660_100036033 Ga0070660_1000360332 305
74 3300005341 Ga0070691_10175708 Ga0070691_101757081 305
75 3300005353 Ga0070669_100177540 Ga0070669_1001775402 305
76 3300005364 Ga0070673_100043230 Ga0070673_1000432303 305
77 3300005365 Ga0070688_100130638 Ga0070688_1001306382 305
78 3300005366 Ga0070659_100075970 Ga0070659_1000759702 305
79 3300005367 Ga0070667_100401483 Ga0070667_1004014831 305
80 3300005434 Ga0070709_10042674 Ga0070709_100426743 305
81 3300005435 Ga0070714_100150465 Ga0070714_1001504652 305
82 3300005436 Ga0070713_100101863 Ga0070713_1001018631 305
83 3300005438 Ga0070701_10011497 Ga0070701_100114973 305
84 3300005439 Ga0070711_100061244 Ga0070711_1000612442 305
85 3300005440 Ga0070705_100012295 Ga0070705_1000122953 305
86 3300005444 Ga0070694_100017761 Ga0070694_1000177613 305
87 3300005445 Ga0070708_100213618 Ga0070708_1002136182 305
88 3300005456 Ga0070678_100018448 Ga0070678_1000184484 305
89 3300005518 Ga0070699_100344305 Ga0070699_1003443052 305
90 3300005539 Ga0068853_100015206 Ga0068853_1000152064 305
91 3300005543 Ga0070672_100114595 Ga0070672_1001145953 305
92 3300005545 Ga0070695_100072634 Ga0070695_1000726343 305
93 3300005546 Ga0070696_100049082 Ga0070696_1000490823 305
94 3300005549 Ga0070704_100034343 Ga0070704_1000343431 305
95 3300005563 Ga0068855_100043787 Ga0068855_1000437875 305
96 3300005578 Ga0068854_100035708 Ga0068854_1000357083 305
97 3300005614 Ga0068856_100096092 Ga0068856_1000960923 305
98 3300005616 Ga0068852_100040165 Ga0068852_1000401653 305
99 3300005617 Ga0068859_100242004 Ga0068859_1002420041 305
100 3300005618 Ga0068864_100080412 Ga0068864_1000804122 305
101 3300005719 Ga0068861_100011457 Ga0068861_1000114574 305
102 3300005841 Ga0068863_100020259 Ga0068863_1000202593 305
103 3300005842 Ga0068858_100152724 Ga0068858_1001527243 305
104 3300005843 Ga0068860_100015855 Ga0068860_1000158554 305
105 3300006028 Ga0070717_10016646 Ga0070717_100166462 305
106 3300006058 Ga0075432_10047979 Ga0075432_100479792 305
107 3300006173 Ga0070716_100049818 Ga0070716_1000498182 305
108 3300006175 Ga0070712_100031616 Ga0070712_1000316163 305
109 3300006237 Ga0097621_100053286 Ga0097621_1000532863 305
110 3300006852 Ga0075433_10020028 Ga0075433_100200286 305
111 3300006871 Ga0075434_100074715 Ga0075434_1000747152 305
112 3300006881 Ga0068865_100016851 Ga0068865_1000168514 305
113 3300006914 Ga0075436_100066388 Ga0075436_1000663882 305
114 3300006931 Ga0097620_100242032 Ga0097620_1002420323 305
115 3300007076 Ga0075435_100008153 Ga0075435_1000081533 305
116 3300009011 Ga0105251_10053392 Ga0105251_100533922 305
117 3300009093 Ga0105240_10089421 Ga0105240_100894213 305
118 3300009098 Ga0105245_10081398 Ga0105245_100813982 305
119 3300009101 Ga0105247_10047552 Ga0105247_100475523 305
120 3300009148 Ga0105243_10006420 Ga0105243_100064207 305
121 3300009174 Ga0105241_10018704 Ga0105241_100187044 305
122 3300009176 Ga0105242_10049334 Ga0105242_100493343 305
123 3300009176 Ga0105242_10059762 Ga0105242_100597623 305
124 3300009545 Ga0105237_10017439 Ga0105237_100174393 305
125 3300009551 Ga0105238_10082158 Ga0105238_100821583 305
126 3300009553 Ga0105249_10007621 Ga0105249_100076217 305
127 3300010375 Ga0105239_10143312 Ga0105239_101433121 305
128 3300010375 Ga0105239_10317094 Ga0105239_103170943 305
129 3300011119 Ga0105246_10031271 Ga0105246_100312713 305
130 3300013100 Ga0157373_10227358 Ga0157373_102273582 305
131 3300013102 Ga0157371_10085041 Ga0157371_100850412 305
132 3300013105 Ga0157369_10005216 Ga0157369_1000521612 305
133 3300013296 Ga0157374_10025736 Ga0157374_100257365 305
134 3300013297 Ga0157378_10070912 Ga0157378_100709123 305
135 3300013306 Ga0163162_10010160 Ga0163162_100101607 305
136 3300014326 Ga0157380_10094714 Ga0157380_100947142 305
137 3300014745 Ga0157377_10046383 Ga0157377_100463832 305
138 3300014969 Ga0157376_10072079 Ga0157376_100720793 305
139 3300017792 Ga0163161_10007157 Ga0163161_100071575 305
140 3300020075 Ga0206349_1119784 Ga0206349_11197841 305
141 3300020076 Ga0206355_1155132 Ga0206355_11551322 305
142 3300022467 Ga0224712_10033636 Ga0224712_100336362 305
143 3300025900 Ga0207710_10045270 Ga0207710_100452702 305
144 3300025901 Ga0207688_10008999 Ga0207688_100089994 305
145 3300025903 Ga0207680_10065264 Ga0207680_100652643 305
146 3300025904 Ga0207647_10005591 Ga0207647_100055913 305
147 3300025906 Ga0207699_10028820 Ga0207699_100288202 305
148 3300025909 Ga0207705_10000417 Ga0207705_1000041729 305
149 3300025915 Ga0207693_10002732 Ga0207693_100027325 305
150 3300025917 Ga0207660_10013454 Ga0207660_100134542 305
151 3300025917 Ga0207660_10311402 Ga0207660_103114021 305
152 3300025919 Ga0207657_10004685 Ga0207657_100046856 305
153 3300025924 Ga0207694_10183755 Ga0207694_101837552 305
154 3300025928 Ga0207700_10172284 Ga0207700_101722842 305
155 3300025932 Ga0207690_10076806 Ga0207690_100768062 305
156 3300025933 Ga0207706_10011004 Ga0207706_100110045 305
157 3300025938 Ga0207704_10333250 Ga0207704_103332502 305
158 3300025939 Ga0207665_10000538 Ga0207665_100005388 305
159 3300025941 Ga0207711_10219482 Ga0207711_102194821 305
160 3300025949 Ga0207667_10154397 Ga0207667_101543973 305
161 3300025960 Ga0207651_10165963 Ga0207651_101659632 305
162 3300026023 Ga0207677_10020752 Ga0207677_100207523 305
163 3300026118 Ga0207675_100012912 Ga0207675_1000129127 305
164 3300026121 Ga0207683_10000893 Ga0207683_1000089311 305
165 3300026142 Ga0207698_10308475 Ga0207698_103084753 305
166 3300027907 Ga0207428_10100440 Ga0207428_101004403 305
167 3300031456 Ga0307513_10000001 Ga0307513_100000011499 305
168 3300035114 Ga0373939_0001977 Ga0373939_0001977_1166_2131 305
169 3300035121 Ga0373960_0022289 Ga0373960_0022289_475_1440 305
170 3300035207 Ga0373942_0006287 Ga0373942_0006287_637_1602 305
171 3300035242 Ga0373962_0025898 Ga0373962_0025898_289_1254 305
172 3300035691 Ga0373931_0009811 Ga0373931_0009811_516_1481 305
173 3300048904 Ga0496101_0052682 Ga0496101_0052682_571_1536 305
174 3300048907 Ga0496104_0058443 Ga0496104_0058443_159_1124 305
175 3300048908 Ga0496105_0043453 Ga0496105_0043453_2710_3675 305
176 3300048909 Ga0496106_0021419 Ga0496106_0021419_1406_2371 305
177 3300048912 Ga0496109_0414017 Ga0496109_0414017_108_1073 305
178 3300048913 Ga0496110_0015868 Ga0496110_0015868_691_1656 305
179 3300048915 Ga0496112_0041417 Ga0496112_0041417_804_1769 305
180 3300048917 Ga0496114_0040483 Ga0496114_0040483_1755_2720 305
181 3300048918 Ga0496115_0158272 Ga0496115_0158272_351_1316 305
182 3300049569 Ga0501032_0022637 Ga0501032_0022637_1530_2522 305
183 3300049572 Ga0501036_0012154 Ga0501036_0012154_3464_4456 305
184 3300049573 Ga0501037_0019081 Ga0501037_0019081_1171_2163 305
185 3300049574 Ga0501038_0134437 Ga0501038_0134437_88_1080 305
186 3300049576 Ga0501040_0023479 Ga0501040_0023479_2553_3545 305
187 3300049577 Ga0501041_0016123 Ga0501041_0016123_784_1776 305
188 3300049578 Ga0501042_0007937 Ga0501042_0007937_5300_6292 305
189 3300049579 Ga0501043_0048332 Ga0501043_0048332_1140_2132 305
190 3300049586 Ga0501070_0016249 Ga0501070_0016249_3549_4505 305
191 3300049588 Ga0501072_0085752 Ga0501072_0085752_1270_2262 305
192 3300049592 Ga0501076_0024251 Ga0501076_0024251_2371_3363 305
193 3300049593 Ga0501077_0048354 Ga0501077_0048354_119_1111 305
194 3300049824 Ga0501045_0109203 Ga0501045_0109203_781_1773 305
195 3300050512 nmdc:mga0n895_54732_c1 nmdc:mga0n895_54732_c1_2619_3584 305
196 3300050514 nmdc:mga08x19_11020_c1 nmdc:mga08x19_11020_c1_815_1780 305
197 3300050515 nmdc:mga0a205_41322_c1 nmdc:mga0a205_41322_c1_846_1811 305
198 3300054114 Ga0501084_0037168 Ga0501084_0037168_2440_3432 305
199 3300061734 Ga0530510_0033142 Ga0530510_0033142_1920_2912 305
200 iso_pu_bacteria 8056060235 8056062548 305
201 3300005339 Ga0070660_100000966 Ga0070660_10000096611 306
202 3300005340 Ga0070689_100039033 Ga0070689_1000390333 306
203 3300005340 Ga0070689_100247999 Ga0070689_1002479992 306
204 3300005343 Ga0070687_100029942 Ga0070687_1000299422 306
205 3300005344 Ga0070661_100038647 Ga0070661_1000386473 306
206 3300005356 Ga0070674_100042279 Ga0070674_1000422792 306
207 3300005366 Ga0070659_100022047 Ga0070659_1000220474 306
208 3300005366 Ga0070659_100108467 Ga0070659_1001084673 306
209 3300005435 Ga0070714_100541377 Ga0070714_1005413771 306
210 3300005458 Ga0070681_10021375 Ga0070681_100213756 306
211 3300005466 Ga0070685_10022138 Ga0070685_100221382 306
212 3300005471 Ga0070698_100003094 Ga0070698_1000030943 306
213 3300005530 Ga0070679_100002298 Ga0070679_1000022989 306
214 3300005543 Ga0070672_100154385 Ga0070672_1001543852 306
215 3300005547 Ga0070693_100037085 Ga0070693_1000370852 306
216 3300005564 Ga0070664_100103885 Ga0070664_1001038852 306
217 3300005842 Ga0068858_100144324 Ga0068858_1001443243 306
218 3300005843 Ga0068860_100240297 Ga0068860_1002402972 306
219 3300006846 Ga0075430_100166228 Ga0075430_1001662282 306
220 3300006881 Ga0068865_100171759 Ga0068865_1001717592 306
221 3300009094 Ga0111539_10011076 Ga0111539_1001107612 306
222 3300009094 Ga0111539_10164191 Ga0111539_101641912 306
223 3300009101 Ga0105247_10056171 Ga0105247_100561713 306
224 3300009176 Ga0105242_10563175 Ga0105242_105631751 306
225 3300009545 Ga0105237_10120169 Ga0105237_101201692 306
226 3300013105 Ga0157369_10188428 Ga0157369_101884282 306
227 3300013308 Ga0157375_10133889 Ga0157375_101338894 306
228 3300025899 Ga0207642_10081175 Ga0207642_100811752 306
229 3300025904 Ga0207647_10015362 Ga0207647_100153624 306
230 3300025907 Ga0207645_10010347 Ga0207645_100103479 306
231 3300025914 Ga0207671_10152139 Ga0207671_101521392 306
232 3300025918 Ga0207662_10010531 Ga0207662_100105312 306
233 3300025919 Ga0207657_10121500 Ga0207657_101215002 306
234 3300025919 Ga0207657_10170978 Ga0207657_101709782 306
235 3300025919 Ga0207657_10430978 Ga0207657_104309781 306
236 3300025921 Ga0207652_10014001 Ga0207652_100140014 306
237 3300025923 Ga0207681_10143037 Ga0207681_101430372 306
238 3300025924 Ga0207694_10222653 Ga0207694_102226532 306
239 3300025929 Ga0207664_10445695 Ga0207664_104456952 306
240 3300025931 Ga0207644_10283462 Ga0207644_102834621 306
241 3300025932 Ga0207690_10002301 Ga0207690_100023019 306
242 3300025932 Ga0207690_10066106 Ga0207690_100661062 306
243 3300025933 Ga0207706_10121710 Ga0207706_101217102 306
244 3300025942 Ga0207689_10046366 Ga0207689_100463663 306
245 3300025944 Ga0207661_10417426 Ga0207661_104174261 306
246 3300025945 Ga0207679_10084776 Ga0207679_100847762 306
247 3300025949 Ga0207667_10322464 Ga0207667_103224641 306
248 3300025972 Ga0207668_10134073 Ga0207668_101340732 306
249 3300025981 Ga0207640_10049463 Ga0207640_100494632 306
250 3300025986 Ga0207658_10153718 Ga0207658_101537182 306
251 3300026023 Ga0207677_10002869 Ga0207677_100028692 306
252 3300026023 Ga0207677_10155285 Ga0207677_101552852 306
253 3300026075 Ga0207708_10005718 Ga0207708_100057189 306
254 3300026118 Ga0207675_100022895 Ga0207675_1000228954 306
255 3300026118 Ga0207675_100074474 Ga0207675_1000744744 306
256 3300026121 Ga0207683_10030160 Ga0207683_100301602 306
257 3300028379 Ga0268266_10123175 Ga0268266_101231752 306
258 3300028380 Ga0268265_10098102 Ga0268265_100981022 306
259 3300039450 Ga0436363_1636713 Ga0436363_1636713_269_1246 306
260 3300041512 Ga0451853_3964862 Ga0451853_3964862_125_1072 306
261 3300050510 nmdc:mga06r32_608752_c1 nmdc:mga06r32_608752_c1_59_1036 306
262 3300050510 nmdc:mga06r32_61825_c1 nmdc:mga06r32_61825_c1_1477_2439 306
263 iso_pu_bacteria 8003856774 8003861753 306
264 3300006844 Ga0075428_100014322 Ga0075428_1000143225 307
265 3300006846 Ga0075430_100075552 Ga0075430_1000755522 307
266 3300009147 Ga0114129_10166211 Ga0114129_101662114 307
267 3300010375 Ga0105239_10455121 Ga0105239_104551211 307
268 3300020077 Ga0206351_10774565 Ga0206351_107745653 307
269 3300044684 Ga0466966_0093868 Ga0466966_0093868_725_1720 307
270 3300044693 Ga0466961_0097431 Ga0466961_0097431_208_1203 307
271 3300045049 Ga0466959_0046068 Ga0466959_0046068_110_1105 307
272 3300045049 Ga0466959_0126954 Ga0466959_0126954_240_1235 307
273 3300045836 Ga0466958_0019053 Ga0466958_0019053_780_1775 307
274 3300047322 Ga0495680_0183085 Ga0495680_0183085_276_1274 307
275 3300048907 Ga0496104_0032900 Ga0496104_0032900_2204_3202 307
276 3300048911 Ga0496108_0020346 Ga0496108_0020346_2276_3274 307
277 3300048913 Ga0496110_0011088 Ga0496110_0011088_167_1165 307
278 3300048914 Ga0496111_0042489 Ga0496111_0042489_2253_3251 307
279 3300050507 nmdc:mga05p37_6050_c1 nmdc:mga05p37_6050_c1_1317_2279 307
280 3300050508 nmdc:mga09592_61865_c1 nmdc:mga09592_61865_c1_621_1583 307
281 3300050510 nmdc:mga06r32_45820_c1 nmdc:mga06r32_45820_c1_2908_3876 307
282 3300005530 Ga0070679_100000169 Ga0070679_1000001694 308
283 3300044693 Ga0466961_0122783 Ga0466961_0122783_83_1066 308
284 3300005338 Ga0068868_100080493 Ga0068868_1000804933 310
285 3300013307 Ga0157372_10132935 Ga0157372_101329353 310
286 3300020069 Ga0197907_11183462 Ga0197907_111834621 310
287 3300020077 Ga0206351_10851589 Ga0206351_108515891 310
288 3300020082 Ga0206353_11371393 Ga0206353_113713931 310
289 3300037312 Ga0395899_0046126 Ga0395899_0046126_825_1799 310
290 3300037418 Ga0395900_0248022 Ga0395900_0248022_601_1575 310
291 3300037466 Ga0395898_0007961 Ga0395898_0007961_9495_10469 310
292 3300037466 Ga0395898_0125313 Ga0395898_0125313_989_1981 310
293 3300038443 Ga0395901_0056823 Ga0395901_0056823_1664_2656 310
294 3300044694 Ga0466963_0072476 Ga0466963_0072476_377_1351 310
295 3300044719 Ga0466971_0025867 Ga0466971_0025867_462_1436 310
296 3300045976 Ga0466967_0062319 Ga0466967_0062319_2182_3189 310
297 3300048903 Ga0496100_0030801 Ga0496100_0030801_1102_2094 310
298 3300048905 Ga0496102_0016308 Ga0496102_0016308_2742_3734 310
299 3300048907 Ga0496104_0055424 Ga0496104_0055424_2677_3669 310
300 3300048909 Ga0496106_0035442 Ga0496106_0035442_1843_2835 310
301 3300048913 Ga0496110_0040742 Ga0496110_0040742_2793_3785 310
302 iso_pu_bacteria 2643221561 2643827498 310
303 iso_pu_bacteria 2643221696 2644533672 310
304 3300005336 Ga0070680_100252687 Ga0070680_1002526872 311
305 3300005435 Ga0070714_100009102 Ga0070714_1000091023 311
306 3300005458 Ga0070681_10485023 Ga0070681_104850231 311
307 3300025917 Ga0207660_10354849 Ga0207660_103548491 311
308 3300025929 Ga0207664_10006816 Ga0207664_100068165 311
309 3300031903 Ga0307407_10090357 Ga0307407_100903571 311
310 3300031995 Ga0307409_100226792 Ga0307409_1002267921 311
311 3300032005 Ga0307411_10087808 Ga0307411_100878082 311
312 3300044901 Ga0466960_0132367 Ga0466960_0132367_225_1217 311
313 3300046477 Ga0495664_0028499 Ga0495664_0028499_777_1775 311
314 3300049690 Ga0501261_013245 Ga0501261_013245_66_1067 311
315 3300005334 Ga0068869_100246603 Ga0068869_1002466031 312
316 3300005564 Ga0070664_100505092 Ga0070664_1005050921 312
317 3300006177 Ga0075362_10053800 Ga0075362_100538001 312
318 3300031911 Ga0307412_10106018 Ga0307412_101060182 312
319 3300044683 Ga0466965_0021499 Ga0466965_0021499_1065_2033 312
320 3300044683 Ga0466965_0035195 Ga0466965_0035195_799_1791 312
321 3300044694 Ga0466963_0020941 Ga0466963_0020941_2910_3878 312
322 3300044719 Ga0466971_0006954 Ga0466971_0006954_2774_3742 312
323 3300044765 Ga0466970_0026518 Ga0466970_0026518_1494_2486 312
324 3300044842 Ga0466957_0020464 Ga0466957_0020464_215_1183 312
325 3300045836 Ga0466958_0026353 Ga0466958_0026353_2330_3298 312
326 3300045976 Ga0466967_0118468 Ga0466967_0118468_255_1223 312
327 3300047322 Ga0495680_0270959 Ga0495680_0270959_78_1049 312
328 3300048905 Ga0496102_0253017 Ga0496102_0253017_389_1366 312
329 3300048912 Ga0496109_0306783 Ga0496109_0306783_209_1186 312
330 3300048917 Ga0496114_0109981 Ga0496114_0109981_239_1234 312
331 3300048917 Ga0496114_0208155 Ga0496114_0208155_574_1551 312
332 3300049576 Ga0501040_0130920 Ga0501040_0130920_378_1379 312
333 3300049583 Ga0501067_0021565 Ga0501067_0021565_2491_3504 312
334 3300049584 Ga0501068_0106460 Ga0501068_0106460_195_1208 312
335 3300049592 Ga0501076_0074615 Ga0501076_0074615_1306_2313 312
336 3300049592 Ga0501076_0213914 Ga0501076_0213914_494_1486 312
337 3300061719 Ga0466962_0016476 Ga0466962_0016476_147_1115 312
338 3300002075 JGI24738J21930_10012993 JGI24738J21930_100129932 314
339 3300005329 Ga0070683_100045908 Ga0070683_1000459081 314
340 3300005337 Ga0070682_100008265 Ga0070682_1000082655 314
341 3300005438 Ga0070701_10096559 Ga0070701_100965591 314
342 3300005459 Ga0068867_100012944 Ga0068867_1000129447 314
343 3300005535 Ga0070684_100037218 Ga0070684_1000372186 314
344 3300005539 Ga0068853_100190315 Ga0068853_1001903152 314
345 3300005543 Ga0070672_100128566 Ga0070672_1001285663 314
346 3300005544 Ga0070686_100116310 Ga0070686_1001163102 314
347 3300005578 Ga0068854_100071226 Ga0068854_1000712261 314
348 3300005616 Ga0068852_100005828 Ga0068852_1000058282 314
349 3300005718 Ga0068866_10076431 Ga0068866_100764312 314
350 3300005719 Ga0068861_100052415 Ga0068861_1000524153 314
351 3300005840 Ga0068870_10027506 Ga0068870_100275061 314
352 3300005842 Ga0068858_100677704 Ga0068858_1006777041 314
353 3300006881 Ga0068865_100107461 Ga0068865_1001074611 314
354 3300009177 Ga0105248_10235612 Ga0105248_102356121 314
355 3300009551 Ga0105238_10510480 Ga0105238_105104801 314
356 3300009553 Ga0105249_10418850 Ga0105249_104188502 314
357 3300010375 Ga0105239_10158961 Ga0105239_101589611 314
358 3300011119 Ga0105246_10336820 Ga0105246_103368201 314
359 3300014325 Ga0163163_10150354 Ga0163163_101503543 314
360 3300014326 Ga0157380_10065322 Ga0157380_100653223 314
361 3300014745 Ga0157377_10089289 Ga0157377_100892893 314
362 3300025899 Ga0207642_10015888 Ga0207642_100158881 314
363 3300025908 Ga0207643_10006354 Ga0207643_100063545 314
364 3300025927 Ga0207687_10292393 Ga0207687_102923931 314
365 3300025940 Ga0207691_10011312 Ga0207691_100113125 314
366 3300025981 Ga0207640_10055877 Ga0207640_100558773 314
367 3300026089 Ga0207648_10004558 Ga0207648_1000455812 314
368 3300026118 Ga0207675_100002294 Ga0207675_10000229417 314
369 3300026121 Ga0207683_10133167 Ga0207683_101331671 314
370 3300048912 Ga0496109_0396357 Ga0496109_0396357_180_1142 314
371 3300050511 nmdc:mga08y16_336887_c1 nmdc:mga08y16_336887_c1_49_1014 314
372 3300061734 Ga0530510_0183013 Ga0530510_0183013_369_1331 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

66

288

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.7974 7 303
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.7952 27 312
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.7875 7 303
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.7095 27 312
4ry2-assembly1.cif.gz_B crystal structure of the peptidase-containing abc transporter pcat1 0.3287 25 267
ID Description Score Start End Superfamily
4ry2A02 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.3186 25 260 1.20.1560.10
af_O14286_106_430_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.2892 15 273 1.20.1560.10
af_Q8T9W2_103_447_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.2857 25 260 1.20.1560.10
af_Q54BV5_285_493_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.2838 49 215 1.20.900.10
af_Q03795_274_493_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2782 24 214 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A848DS39-F1-model_v4 Acyl-CoA desaturase 0.9374 46 308 GO:0006631
GO:0016020
GO:0016717
AF-A0A7W0LIW7-F1-model_v4 Acyl-CoA desaturase 0.937 57 303 GO:0006631
GO:0016020
GO:0016717
AF-A0A7V9PD31-F1-model_v4 Acyl-CoA desaturase 0.9365 23 303 GO:0006631
GO:0016020
GO:0016717
AF-A0A3N1H7R4-F1-model_v4 Stearoyl-CoA desaturase (Delta-9 desaturase) 0.936 20 305 GO:0006631
GO:0016020
GO:0016717
AF-A0A7V5Q148-F1-model_v4 Acyl-CoA desaturase 0.9358 47 305 GO:0006631
GO:0016020
GO:0016717

Feature Viewer

pLDDT pTM Quality
83.23 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map