F426157

General Info

Members Datasets Scaffolds Average Seq Length
372 235 744 191

Family's Representative Sequence

Representative Sequence 3300049533|Ga0501317_043330|Ga0501317_043330_12_647
Length 211
Sequence VPVDRNGLHVRLDPRAPLVLDTRELGRRPGSQRQRTFTAPAPAELGIEVLRVPEGSPVEFDIRLEAVMEGVLVTGTATAGLVGECARCLEEIRDDVVADFQELFVYDDDDNDADDEYSGTSRLEGDLVDLEPLLRDAVVLSLPFQPLCQDDCPGLCVECGARLADDPDHRHEEAVDPRWAALQQLQAQQDHPTDQHHPEHATGRERGLTEE

Samples

Sample ID Description Type Environment
1 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
76 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
77 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
78 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
79 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
80 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
203 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
221 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
222 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
233 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.83
Metatranscriptomes 13.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 5.91
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501317_043330 3300049533 Bacteria 694
2 JGI24743J22301_10005664 3300001991 Bacteria 2094
3 JGI24750J21931_1010163 3300002070 Bacteria 1223
4 JGI24738J21930_10003685 3300002075 Bacteria 3836
5 JGI24749J21850_1007980 3300002076 Bacteria 1473
6 Ga0006778J45830_1017786 3300003162 Bacteria 1339
7 Ga0006759J45824_1019695 3300003163 Bacteria 1445
8 JGI25406J46586_10079727 3300003203 Bacteria 1007
9 Ga0007410J51695_1015600 3300003574 Bacteria 1381
10 Ga0007416J51690_1090774 3300003577 Bacteria 597
11 Ga0007429J51699_1015258 3300003579 Bacteria 1495
12 Ga0007429J51699_1032269 3300003579 Bacteria 885
13 Ga0032354_1008696 3300003693 Bacteria 1423
14 Ga0032354_1059566 3300003693 Bacteria 871
15 Ga0058858_1416511 3300004785 Bacteria 608
16 Ga0058860_10017304 3300004801 Bacteria 848
17 Ga0058862_12833657 3300004803 Bacteria 1005
18 Ga0070658_10031411 3300005327 Bacteria 4265
19 Ga0070676_10231581 3300005328 Bacteria 1225
20 Ga0070683_100049229 3300005329 Bacteria 3897
21 Ga0070683_100485608 3300005329 Bacteria 1180
22 Ga0070683_100767599 3300005329 Bacteria 924
23 Ga0070683_100976909 3300005329 Bacteria 813
24 Ga0068869_100386450 3300005334 Bacteria 1148
25 Ga0070682_100020213 3300005337 Bacteria 3915
26 Ga0070682_100678160 3300005337 Bacteria 824
27 Ga0068868_100538472 3300005338 Bacteria 1027
28 Ga0068868_100542439 3300005338 Unclassified 1024
29 Ga0070660_100010113 3300005339 Bacteria 6656
30 Ga0070660_100242239 3300005339 Bacteria 1469
31 Ga0070660_100291445 3300005339 Bacteria 1337
32 Ga0070691_10063259 3300005341 Bacteria 1784
33 Ga0070691_10083201 3300005341 Bacteria 1570
34 Ga0070687_100408123 3300005343 Bacteria 893
35 Ga0070692_10002957 3300005345 Bacteria 6760
36 Ga0070668_100032187 3300005347 Bacteria 3990
37 Ga0070668_100057867 3300005347 Bacteria 2997
38 Ga0070669_100557419 3300005353 Bacteria 956
39 Ga0070675_100199639 3300005354 Bacteria 1736
40 Ga0070671_100402935 3300005355 Bacteria 1170
41 Ga0070674_100008568 3300005356 Bacteria 6098
42 Ga0070674_100033532 3300005356 Bacteria 3419
43 Ga0070674_100707330 3300005356 Bacteria 862
44 Ga0070673_100873365 3300005364 Unclassified 833
45 Ga0070659_100060256 3300005366 Bacteria 2998
46 Ga0070701_10073977 3300005438 Bacteria 1829
47 Ga0070700_100000496 3300005441 Bacteria 19728
48 Ga0070663_100230813 3300005455 Bacteria 1457
49 Ga0070663_100315362 3300005455 Bacteria 1256
50 Ga0070678_100805036 3300005456 Bacteria 853
51 Ga0070662_100038421 3300005457 Bacteria 3400
52 Ga0068867_100005026 3300005459 Bacteria 9328
53 Ga0068867_100039380 3300005459 Bacteria 3446
54 Ga0068867_100267656 3300005459 Bacteria 1396
55 Ga0070685_10398234 3300005466 Bacteria 953
56 Ga0070684_100116749 3300005535 Bacteria 2397
57 Ga0068853_100381142 3300005539 Bacteria 1317
58 Ga0068853_100543256 3300005539 Bacteria 1100
59 Ga0070672_100000846 3300005543 Bacteria 18317
60 Ga0070686_100205699 3300005544 Bacteria 1414
61 Ga0070704_100352520 3300005549 Bacteria 1243
62 Ga0068854_100016780 3300005578 Bacteria 4888
63 Ga0070702_100032376 3300005615 Bacteria 2868
64 Ga0070702_100236432 3300005615 Bacteria 1231
65 Ga0068852_100003702 3300005616 Bacteria 10716
66 Ga0068852_100280324 3300005616 Bacteria 1606
67 Ga0068852_100460056 3300005616 Bacteria 1261
68 Ga0068852_100693771 3300005616 Bacteria 1028
69 Ga0068864_100732750 3300005618 Bacteria 968
70 Ga0068866_10026472 3300005718 Bacteria 2739
71 Ga0068866_10034682 3300005718 Bacteria 2459
72 Ga0068866_10145187 3300005718 Bacteria 1367
73 Ga0068861_100006281 3300005719 Bacteria 8086
74 Ga0068861_100082724 3300005719 Bacteria 2516
75 Ga0068861_100266250 3300005719 Bacteria 1469
76 Ga0068851_10126581 3300005834 Bacteria 1378
77 Ga0068870_10012266 3300005840 Bacteria 4001
78 Ga0068862_100114551 3300005844 Bacteria 2370
79 Ga0081455_10003491 3300005937 Bacteria 18054
80 Ga0081455_10020641 3300005937 Bacteria 6196
81 Ga0081538_10007881 3300005981 Bacteria 9127
82 Ga0081539_10017187 3300005985 Bacteria 5095
83 Ga0075365_10119149 3300006038 Bacteria 1819
84 Ga0075365_10281401 3300006038 Bacteria 1170
85 Ga0075432_10000408 3300006058 Bacteria 12547
86 Ga0075432_10055659 3300006058 Bacteria 1402
87 Ga0075370_10047559 3300006353 Bacteria 2429
88 Ga0075428_100033283 3300006844 Bacteria 5691
89 Ga0075428_100054615 3300006844 Bacteria 4377
90 Ga0075428_100064864 3300006844 Bacteria 4000
91 Ga0075431_100197389 3300006847 Unclassified 2060
92 Ga0075433_10008309 3300006852 Bacteria 8275
93 Ga0068865_100019553 3300006881 Bacteria 4384
94 Ga0068865_100036185 3300006881 Bacteria 3326
95 Ga0068865_100048762 3300006881 Bacteria 2916
96 Ga0075435_100001932 3300007076 Bacteria 13497
97 Ga0075435_100065521 3300007076 Unclassified 2953
98 Ga0105244_10241465 3300009036 Bacteria 844
99 Ga0111539_10004898 3300009094 Bacteria 17433
100 Ga0111539_10221199 3300009094 Bacteria 2205
101 Ga0105245_10012359 3300009098 Bacteria 7429
102 Ga0105245_10015497 3300009098 Bacteria 6646
103 Ga0105247_10204732 3300009101 Bacteria 1328
104 Ga0105243_10018670 3300009148 Bacteria 5255
105 Ga0105243_10260240 3300009148 Bacteria 1553
106 Ga0105243_10316153 3300009148 Bacteria 1421
107 Ga0105242_10024659 3300009176 Bacteria 4752
108 Ga0105242_10035528 3300009176 Bacteria 3996
109 Ga0105248_10026951 3300009177 Bacteria 6391
110 Ga0105238_10256002 3300009551 Bacteria 1730
111 Ga0105238_10590095 3300009551 Bacteria 1118
112 Ga0105249_10010039 3300009553 Bacteria 8309
113 Ga0105239_10238113 3300010375 Bacteria 2043
114 Ga0157344_1004855 3300012476 Bacteria 816
115 Ga0157341_1011203 3300012494 Bacteria 773
116 Ga0157323_1000679 3300012495 Bacteria 1530
117 Ga0157345_1011215 3300012498 Bacteria 792
118 Ga0157339_1006293 3300012505 Bacteria 965
119 Ga0154019_136243 3300013044 Bacteria 752
120 Ga0157371_10149792 3300013102 Bacteria 1663
121 Ga0157370_10341408 3300013104 Bacteria 1380
122 Ga0157372_10007206 3300013307 Bacteria 11840
123 Ga0157372_10012444 3300013307 Bacteria 9070
124 Ga0157375_10107044 3300013308 Bacteria 2889
125 Ga0157375_10886908 3300013308 Unclassified 1037
126 Ga0163163_10036720 3300014325 Bacteria 4761
127 Ga0163163_10945897 3300014325 Bacteria 925
128 Ga0157380_10010809 3300014326 Bacteria 6581
129 Ga0157380_10228608 3300014326 Bacteria 1669
130 Ga0157377_10005537 3300014745 Bacteria 5944
131 Ga0163161_10052651 3300017792 Bacteria 2951
132 Ga0163161_10096405 3300017792 Bacteria 2195
133 Ga0206356_10986245 3300020070 Bacteria 831
134 Ga0206349_1410956 3300020075 Bacteria 1435
135 Ga0206349_1737116 3300020075 Bacteria 707
136 Ga0206349_1830447 3300020075 Bacteria 689
137 Ga0206355_1316860 3300020076 Bacteria 751
138 Ga0206351_10078393 3300020077 Bacteria 636
139 Ga0206352_10458878 3300020078 Bacteria 1156
140 Ga0206352_10915834 3300020078 Bacteria 680
141 Ga0206350_10296592 3300020080 Bacteria 917
142 Ga0206354_10175964 3300020081 Bacteria 703
143 Ga0206354_10796374 3300020081 Bacteria 698
144 Ga0206354_11541982 3300020081 Bacteria 979
145 Ga0206353_10228254 3300020082 Bacteria 1185
146 Ga0206353_10318561 3300020082 Bacteria 892
147 Ga0206353_10640122 3300020082 Bacteria 647
148 Ga0206353_11616426 3300020082 Bacteria 1083
149 Ga0154015_1431064 3300020610 Bacteria 853
150 Ga0154015_1512956 3300020610 Bacteria 713
151 Ga0207697_10053341 3300025315 Bacteria 1674
152 Ga0207656_10067994 3300025321 Bacteria 1578
153 Ga0207642_10003773 3300025899 Bacteria 4823
154 Ga0207642_10006481 3300025899 Bacteria 3895
155 Ga0207688_10005388 3300025901 Bacteria 6953
156 Ga0207688_10020070 3300025901 Bacteria 3646
157 Ga0207647_10105731 3300025904 Bacteria 1667
158 Ga0207643_10002867 3300025908 Bacteria 9300
159 Ga0207643_10229038 3300025908 Bacteria 1139
160 Ga0207705_10038282 3300025909 Bacteria 3433
161 Ga0207657_10032566 3300025919 Bacteria 4707
162 Ga0207657_10258124 3300025919 Bacteria 1387
163 Ga0207657_10309300 3300025919 Bacteria 1251
164 Ga0207681_10654521 3300025923 Bacteria 871
165 Ga0207687_10023480 3300025927 Bacteria 4112
166 Ga0207687_10058600 3300025927 Bacteria 2710
167 Ga0207687_10067797 3300025927 Bacteria 2539
168 Ga0207687_10398236 3300025927 Bacteria 1132
169 Ga0207690_10020624 3300025932 Bacteria 4076
170 Ga0207690_10102702 3300025932 Bacteria 2045
171 Ga0207690_10501713 3300025932 Bacteria 982
172 Ga0207706_10007615 3300025933 Bacteria 10017
173 Ga0207686_10126379 3300025934 Bacteria 1748
174 Ga0207709_10011439 3300025935 Bacteria 4895
175 Ga0207709_10060484 3300025935 Bacteria 2362
176 Ga0207669_10025203 3300025937 Bacteria 3210
177 Ga0207669_10244645 3300025937 Bacteria 1332
178 Ga0207704_10011028 3300025938 Bacteria 4434
179 Ga0207704_10068264 3300025938 Bacteria 2240
180 Ga0207691_10001204 3300025940 Bacteria 25759
181 Ga0207711_10037674 3300025941 Bacteria 4109
182 Ga0207689_10131940 3300025942 Bacteria 2056
183 Ga0207661_10015734 3300025944 Bacteria 5572
184 Ga0207661_10470770 3300025944 Bacteria 1146
185 Ga0207679_10392418 3300025945 Bacteria 1219
186 Ga0207712_10022486 3300025961 Bacteria 4153
187 Ga0207712_10052214 3300025961 Bacteria 2863
188 Ga0207712_11153888 3300025961 Unclassified 690
189 Ga0207668_10183531 3300025972 Bacteria 1652
190 Ga0207668_10259869 3300025972 Bacteria 1414
191 Ga0207640_10005664 3300025981 Bacteria 6806
192 Ga0207677_10454259 3300026023 Unclassified 1098
193 Ga0207639_10509221 3300026041 Bacteria 1101
194 Ga0207678_10592575 3300026067 Bacteria 971
195 Ga0207708_10000431 3300026075 Bacteria 32602
196 Ga0207708_10142146 3300026075 Bacteria 1884
197 Ga0207648_10002197 3300026089 Bacteria 21185
198 Ga0207648_10047682 3300026089 Bacteria 3754
199 Ga0207648_10519893 3300026089 Bacteria 1090
200 Ga0207676_10076364 3300026095 Bacteria 2707
201 Ga0207676_10583645 3300026095 Bacteria 1072
202 Ga0207676_10694068 3300026095 Bacteria 986
203 Ga0207675_100001152 3300026118 Bacteria 26247
204 Ga0207675_100008076 3300026118 Bacteria 9914
205 Ga0207675_100020474 3300026118 Bacteria 6166
206 Ga0207675_100385792 3300026118 Bacteria 1378
207 Ga0207683_10384053 3300026121 Bacteria 1291
208 Ga0207683_10393164 3300026121 Bacteria 1275
209 Ga0207698_10020198 3300026142 Bacteria 4579
210 Ga0207698_10202749 3300026142 Bacteria 1778
211 Ga0209813_10088545 3300027866 Bacteria 1035
212 Ga0207428_10002706 3300027907 Bacteria 17663
213 Ga0207428_10036837 3300027907 Bacteria 3985
214 Ga0207428_10047476 3300027907 Bacteria 3448
215 Ga0307408_100663268 3300031548 Bacteria 934
216 Ga0307405_10003650 3300031731 Bacteria 7125
217 Ga0307405_10003884 3300031731 Bacteria 6971
218 Ga0307405_10154802 3300031731 Bacteria 1616
219 Ga0307413_10001803 3300031824 Bacteria 8403
220 Ga0307413_10026129 3300031824 Bacteria 3213
221 Ga0307413_10149288 3300031824 Bacteria 1626
222 Ga0307410_10002686 3300031852 Bacteria 8681
223 Ga0307410_10003877 3300031852 Bacteria 7608
224 Ga0307410_10094816 3300031852 Bacteria 2126
225 Ga0307406_10000871 3300031901 Bacteria 16990
226 Ga0307406_10021588 3300031901 Bacteria 3810
227 Ga0307406_10099953 3300031901 Bacteria 1973
228 Ga0307406_10139363 3300031901 Bacteria 1714
229 Ga0307407_10000276 3300031903 Bacteria 15090
230 Ga0307407_10002721 3300031903 Bacteria 7023
231 Ga0307407_10137588 3300031903 Bacteria 1571
232 Ga0307412_10080988 3300031911 Bacteria 2244
233 Ga0307409_100000149 3300031995 Bacteria 26564
234 Ga0307409_100007492 3300031995 Bacteria 6535
235 Ga0307409_100161546 3300031995 Bacteria 1960
236 Ga0307416_100128849 3300032002 Bacteria 2272
237 Ga0307416_100234018 3300032002 Bacteria 1773
238 Ga0307416_100288346 3300032002 Bacteria 1623
239 Ga0307414_10006847 3300032004 Bacteria 6377
240 Ga0307414_10052430 3300032004 Bacteria 2839
241 Ga0307411_10074768 3300032005 Bacteria 2310
242 Ga0307415_100046741 3300032126 Bacteria 2909
243 Ga0307415_100323673 3300032126 Bacteria 1286
244 Ga0373938_0055340 3300034957 Bacteria 916
245 Ga0373931_0081277 3300035691 Bacteria 1789
246 Ga0395899_0017593 3300037312 Bacteria 5445
247 Ga0395898_0120236 3300037466 Bacteria 2516
248 Ga0451795_0255972 3300041456 Bacteria 774
249 Ga0451800_0694124 3300041459 Bacteria 1337
250 Ga0451807_0191828 3300041486 Bacteria 816
251 Ga0451839_1051544 3300041496 Bacteria 677
252 Ga0451843_0688426 3300041509 Bacteria 2218
253 Ga0451843_1583634 3300041509 Bacteria 601
254 Ga0451853_1367340 3300041512 Bacteria 1639
255 Ga0451853_2386155 3300041512 Bacteria 1244
256 Ga0439443_029536 3300042003 Bacteria 899
257 Ga0439448_0063077 3300042005 Bacteria 1227
258 Ga0439450_091299 3300042008 Unclassified 765
259 Ga0439455_0160523 3300042012 Bacteria 643
260 Ga0439463_000599 3300042016 Bacteria 9996
261 Ga0439463_010548 3300042016 Bacteria 2270
262 Ga0439463_012844 3300042016 Bacteria 2058
263 Ga0439458_0089916 3300042157 Bacteria 790
264 Ga0439444_0007618 3300042437 Bacteria 1669
265 Ga0439459_0049718 3300042438 Bacteria 917
266 Ga0439464_0005918 3300042439 Bacteria 3178
267 Ga0451577_0469186 3300042876 Bacteria 1143
268 Ga0439440_0012170 3300042993 Bacteria 1825
269 Ga0466969_0057139 3300044656 Bacteria 1903
270 Ga0466972_0094334 3300044658 Bacteria 1418
271 Ga0466965_0215764 3300044683 Bacteria 1021
272 Ga0466965_0311175 3300044683 Bacteria 856
273 Ga0466966_0066224 3300044684 Bacteria 2270
274 Ga0466961_0190147 3300044693 Bacteria 1272
275 Ga0466963_0019917 3300044694 Bacteria 4215
276 Ga0466963_0022299 3300044694 Bacteria 4008
277 Ga0466963_0166282 3300044694 Bacteria 1536
278 Ga0466964_0013732 3300044706 Bacteria 3074
279 Ga0466964_0091682 3300044706 Bacteria 1323
280 Ga0466964_0222012 3300044706 Bacteria 918
281 Ga0466971_0027592 3300044719 Bacteria 2544
282 Ga0466968_0096658 3300044735 Bacteria 1315
283 Ga0466957_0057030 3300044842 Bacteria 2389
284 Ga0466960_0051196 3300044901 Bacteria 1994
285 Ga0466960_0121993 3300044901 Bacteria 1366
286 Ga0466960_0369786 3300044901 Bacteria 821
287 Ga0466959_0094132 3300045049 Bacteria 2149
288 Ga0466958_0014813 3300045836 Bacteria 4457
289 Ga0466958_0063720 3300045836 Bacteria 2248
290 Ga0466967_0020408 3300045976 Bacteria 5355
291 Ga0466967_0073921 3300045976 Bacteria 3059
292 Ga0495651_0148599 3300046462 Bacteria 1692
293 Ga0495605_0052073 3300046474 Bacteria 1991
294 Ga0495620_0043349 3300046515 Bacteria 1960
295 Ga0495637_0061673 3300046520 Bacteria 1537
296 Ga0495609_0100843 3300046538 Bacteria 1251
297 Ga0495656_0031121 3300046615 Bacteria 2162
298 Ga0495656_0078458 3300046615 Bacteria 1484
299 Ga0495635_0116229 3300046663 Bacteria 1826
300 Ga0495636_0119099 3300047318 Bacteria 1167
301 Ga0496102_0398373 3300048905 Bacteria 1294
302 Ga0496102_1506595 3300048905 Bacteria 591
303 Ga0496105_0618653 3300048908 Bacteria 839
304 Ga0496105_0686288 3300048908 Bacteria 787
305 Ga0496108_0025318 3300048911 Bacteria 4890
306 Ga0496108_0248014 3300048911 Bacteria 1549
307 Ga0496108_0277567 3300048911 Bacteria 1459
308 Ga0496108_0310760 3300048911 Bacteria 1373
309 Ga0496109_0251199 3300048912 Bacteria 1665
310 Ga0496109_0990949 3300048912 Bacteria 778
311 Ga0496110_0131683 3300048913 Bacteria 2259
312 Ga0496110_0349300 3300048913 Bacteria 1347
313 Ga0496110_0479535 3300048913 Bacteria 1133
314 Ga0496111_0292938 3300048914 Bacteria 1207
315 Ga0496111_0578781 3300048914 Bacteria 823
316 Ga0496114_0042465 3300048917 Bacteria 3770
317 Ga0496114_0091315 3300048917 Bacteria 2586
318 Ga0496114_0375298 3300048917 Bacteria 1259
319 Ga0496114_0448099 3300048917 Bacteria 1143
320 Ga0496124_0119826 3300048927 Bacteria 2105
321 Ga0496124_0275816 3300048927 Bacteria 1229
322 Ga0501306_008811 3300049127 Bacteria 1238
323 Ga0501306_036945 3300049127 Bacteria 746
324 Ga0501308_009141 3300049128 Bacteria 1076
325 Ga0501309_054851 3300049129 Bacteria 632
326 Ga0501310_057466 3300049130 Bacteria 574
327 Ga0501305_011779 3300049161 Bacteria 1187
328 Ga0501307_047201 3300049162 Bacteria 640
329 Ga0501292_018280 3300049515 Bacteria 1114
330 Ga0501311_047557 3300049527 Bacteria 665
331 Ga0501312_015826 3300049528 Bacteria 1073
332 Ga0501315_018611 3300049531 Bacteria 918
333 Ga0501316_048888 3300049532 Bacteria 605
334 Ga0501317_032983 3300049533 Bacteria 760
335 Ga0501318_002237 3300049534 Bacteria 1651
336 Ga0501318_023665 3300049534 Bacteria 795
337 Ga0501318_037269 3300049534 Bacteria 683
338 Ga0501318_046609 3300049534 Bacteria 634
339 Ga0501321_008264 3300049537 Bacteria 1100
340 Ga0501031_0528047 3300049568 Bacteria 761
341 Ga0501032_0189385 3300049569 Bacteria 1345
342 Ga0501036_0658059 3300049572 Bacteria 867
343 Ga0501039_0404594 3300049575 Bacteria 1072
344 Ga0501040_0625910 3300049576 Bacteria 778
345 Ga0501041_0321523 3300049577 Bacteria 976
346 Ga0501042_0471970 3300049578 Bacteria 910
347 Ga0501047_0000195 3300049581 Bacteria 73381
348 Ga0501067_0004050 3300049583 Bacteria 8081
349 Ga0501067_0453787 3300049583 Bacteria 716
350 Ga0501069_0013208 3300049585 Bacteria 4400
351 Ga0501072_0422429 3300049588 Bacteria 1057
352 Ga0501202_004713 3300049652 Bacteria 2393
353 Ga0501250_010251 3300049680 Unclassified 1072
354 Ga0501262_030697 3300049759 Unclassified 773
355 Ga0501045_0677370 3300049824 Bacteria 761
356 nmdc:mga0yw44_16984_c1 3300050492 Bacteria 3948
357 nmdc:mga0yw44_266150_c1 3300050492 Bacteria 1143
358 nmdc:mga07m45_55418_c1 3300050496 Bacteria 2241
359 nmdc:mga09592_170460_c1 3300050508 Bacteria 1882
360 nmdc:mga06r32_482781_c1 3300050510 Bacteria 1217
361 nmdc:mga08y16_16205_c1 3300050511 Bacteria 7836
362 nmdc:mga08y16_211694_c1 3300050511 Bacteria 2008
363 nmdc:mga0a205_1754_c1 3300050515 Bacteria 18765
364 Ga0495655_0066932 3300053083 Bacteria 995
365 Ga0495655_0157376 3300053083 Bacteria 719
366 Ga0500556_0001871 3300053104 Bacteria 7563
367 Ga0500593_000571 3300053117 Bacteria 14163
368 Ga0587079_061391 3300059647 Unclassified 816
369 Ga0466962_0018262 3300061719 Bacteria 3374
370 Ga0466962_0045520 3300061719 Bacteria 2097
371 Ga0466962_0105527 3300061719 Bacteria 1354
372 Ga0530510_0089434 3300061734 Bacteria 2245
373 Ga0501317_043330
374 JGI24743J22301_10005664
375 JGI24750J21931_1010163
376 JGI24738J21930_10003685
377 JGI24749J21850_1007980
378 Ga0006778J45830_1017786
379 Ga0006759J45824_1019695
380 JGI25406J46586_10079727
381 Ga0007410J51695_1015600
382 Ga0007416J51690_1090774
383 Ga0007429J51699_1015258
384 Ga0007429J51699_1032269
385 Ga0032354_1008696
386 Ga0032354_1059566
387 Ga0058858_1416511
388 Ga0058860_10017304
389 Ga0058862_12833657
390 Ga0070658_10031411
391 Ga0070676_10231581
392 Ga0070683_100049229
393 Ga0070683_100485608
394 Ga0070683_100767599
395 Ga0070683_100976909
396 Ga0068869_100386450
397 Ga0070682_100020213
398 Ga0070682_100678160
399 Ga0068868_100538472
400 Ga0068868_100542439
401 Ga0070660_100010113
402 Ga0070660_100242239
403 Ga0070660_100291445
404 Ga0070691_10063259
405 Ga0070691_10083201
406 Ga0070687_100408123
407 Ga0070692_10002957
408 Ga0070668_100032187
409 Ga0070668_100057867
410 Ga0070669_100557419
411 Ga0070675_100199639
412 Ga0070671_100402935
413 Ga0070674_100008568
414 Ga0070674_100033532
415 Ga0070674_100707330
416 Ga0070673_100873365
417 Ga0070659_100060256
418 Ga0070701_10073977
419 Ga0070700_100000496
420 Ga0070663_100230813
421 Ga0070663_100315362
422 Ga0070678_100805036
423 Ga0070662_100038421
424 Ga0068867_100005026
425 Ga0068867_100039380
426 Ga0068867_100267656
427 Ga0070685_10398234
428 Ga0070684_100116749
429 Ga0068853_100381142
430 Ga0068853_100543256
431 Ga0070672_100000846
432 Ga0070686_100205699
433 Ga0070704_100352520
434 Ga0068854_100016780
435 Ga0070702_100032376
436 Ga0070702_100236432
437 Ga0068852_100003702
438 Ga0068852_100280324
439 Ga0068852_100460056
440 Ga0068852_100693771
441 Ga0068864_100732750
442 Ga0068866_10026472
443 Ga0068866_10034682
444 Ga0068866_10145187
445 Ga0068861_100006281
446 Ga0068861_100082724
447 Ga0068861_100266250
448 Ga0068851_10126581
449 Ga0068870_10012266
450 Ga0068862_100114551
451 Ga0081455_10003491
452 Ga0081455_10020641
453 Ga0081538_10007881
454 Ga0081539_10017187
455 Ga0075365_10119149
456 Ga0075365_10281401
457 Ga0075432_10000408
458 Ga0075432_10055659
459 Ga0075370_10047559
460 Ga0075428_100033283
461 Ga0075428_100054615
462 Ga0075428_100064864
463 Ga0075431_100197389
464 Ga0075433_10008309
465 Ga0068865_100019553
466 Ga0068865_100036185
467 Ga0068865_100048762
468 Ga0075435_100001932
469 Ga0075435_100065521
470 Ga0105244_10241465
471 Ga0111539_10004898
472 Ga0111539_10221199
473 Ga0105245_10012359
474 Ga0105245_10015497
475 Ga0105247_10204732
476 Ga0105243_10018670
477 Ga0105243_10260240
478 Ga0105243_10316153
479 Ga0105242_10024659
480 Ga0105242_10035528
481 Ga0105248_10026951
482 Ga0105238_10256002
483 Ga0105238_10590095
484 Ga0105249_10010039
485 Ga0105239_10238113
486 Ga0157344_1004855
487 Ga0157341_1011203
488 Ga0157323_1000679
489 Ga0157345_1011215
490 Ga0157339_1006293
491 Ga0154019_136243
492 Ga0157371_10149792
493 Ga0157370_10341408
494 Ga0157372_10007206
495 Ga0157372_10012444
496 Ga0157375_10107044
497 Ga0157375_10886908
498 Ga0163163_10036720
499 Ga0163163_10945897
500 Ga0157380_10010809
501 Ga0157380_10228608
502 Ga0157377_10005537
503 Ga0163161_10052651
504 Ga0163161_10096405
505 Ga0206356_10986245
506 Ga0206349_1410956
507 Ga0206349_1737116
508 Ga0206349_1830447
509 Ga0206355_1316860
510 Ga0206351_10078393
511 Ga0206352_10458878
512 Ga0206352_10915834
513 Ga0206350_10296592
514 Ga0206354_10175964
515 Ga0206354_10796374
516 Ga0206354_11541982
517 Ga0206353_10228254
518 Ga0206353_10318561
519 Ga0206353_10640122
520 Ga0206353_11616426
521 Ga0154015_1431064
522 Ga0154015_1512956
523 Ga0207697_10053341
524 Ga0207656_10067994
525 Ga0207642_10003773
526 Ga0207642_10006481
527 Ga0207688_10005388
528 Ga0207688_10020070
529 Ga0207647_10105731
530 Ga0207643_10002867
531 Ga0207643_10229038
532 Ga0207705_10038282
533 Ga0207657_10032566
534 Ga0207657_10258124
535 Ga0207657_10309300
536 Ga0207681_10654521
537 Ga0207687_10023480
538 Ga0207687_10058600
539 Ga0207687_10067797
540 Ga0207687_10398236
541 Ga0207690_10020624
542 Ga0207690_10102702
543 Ga0207690_10501713
544 Ga0207706_10007615
545 Ga0207686_10126379
546 Ga0207709_10011439
547 Ga0207709_10060484
548 Ga0207669_10025203
549 Ga0207669_10244645
550 Ga0207704_10011028
551 Ga0207704_10068264
552 Ga0207691_10001204
553 Ga0207711_10037674
554 Ga0207689_10131940
555 Ga0207661_10015734
556 Ga0207661_10470770
557 Ga0207679_10392418
558 Ga0207712_10022486
559 Ga0207712_10052214
560 Ga0207712_11153888
561 Ga0207668_10183531
562 Ga0207668_10259869
563 Ga0207640_10005664
564 Ga0207677_10454259
565 Ga0207639_10509221
566 Ga0207678_10592575
567 Ga0207708_10000431
568 Ga0207708_10142146
569 Ga0207648_10002197
570 Ga0207648_10047682
571 Ga0207648_10519893
572 Ga0207676_10076364
573 Ga0207676_10583645
574 Ga0207676_10694068
575 Ga0207675_100001152
576 Ga0207675_100008076
577 Ga0207675_100020474
578 Ga0207675_100385792
579 Ga0207683_10384053
580 Ga0207683_10393164
581 Ga0207698_10020198
582 Ga0207698_10202749
583 Ga0209813_10088545
584 Ga0207428_10002706
585 Ga0207428_10036837
586 Ga0207428_10047476
587 Ga0307408_100663268
588 Ga0307405_10003650
589 Ga0307405_10003884
590 Ga0307405_10154802
591 Ga0307413_10001803
592 Ga0307413_10026129
593 Ga0307413_10149288
594 Ga0307410_10002686
595 Ga0307410_10003877
596 Ga0307410_10094816
597 Ga0307406_10000871
598 Ga0307406_10021588
599 Ga0307406_10099953
600 Ga0307406_10139363
601 Ga0307407_10000276
602 Ga0307407_10002721
603 Ga0307407_10137588
604 Ga0307412_10080988
605 Ga0307409_100000149
606 Ga0307409_100007492
607 Ga0307409_100161546
608 Ga0307416_100128849
609 Ga0307416_100234018
610 Ga0307416_100288346
611 Ga0307414_10006847
612 Ga0307414_10052430
613 Ga0307411_10074768
614 Ga0307415_100046741
615 Ga0307415_100323673
616 Ga0373938_0055340
617 Ga0373931_0081277
618 Ga0395899_0017593
619 Ga0395898_0120236
620 Ga0451795_0255972
621 Ga0451800_0694124
622 Ga0451807_0191828
623 Ga0451839_1051544
624 Ga0451843_0688426
625 Ga0451843_1583634
626 Ga0451853_1367340
627 Ga0451853_2386155
628 Ga0439443_029536
629 Ga0439448_0063077
630 Ga0439450_091299
631 Ga0439455_0160523
632 Ga0439463_000599
633 Ga0439463_010548
634 Ga0439463_012844
635 Ga0439458_0089916
636 Ga0439444_0007618
637 Ga0439459_0049718
638 Ga0439464_0005918
639 Ga0451577_0469186
640 Ga0439440_0012170
641 Ga0466969_0057139
642 Ga0466972_0094334
643 Ga0466965_0215764
644 Ga0466965_0311175
645 Ga0466966_0066224
646 Ga0466961_0190147
647 Ga0466963_0019917
648 Ga0466963_0022299
649 Ga0466963_0166282
650 Ga0466964_0013732
651 Ga0466964_0091682
652 Ga0466964_0222012
653 Ga0466971_0027592
654 Ga0466968_0096658
655 Ga0466957_0057030
656 Ga0466960_0051196
657 Ga0466960_0121993
658 Ga0466960_0369786
659 Ga0466959_0094132
660 Ga0466958_0014813
661 Ga0466958_0063720
662 Ga0466967_0020408
663 Ga0466967_0073921
664 Ga0495651_0148599
665 Ga0495605_0052073
666 Ga0495620_0043349
667 Ga0495637_0061673
668 Ga0495609_0100843
669 Ga0495656_0031121
670 Ga0495656_0078458
671 Ga0495635_0116229
672 Ga0495636_0119099
673 Ga0496102_0398373
674 Ga0496102_1506595
675 Ga0496105_0618653
676 Ga0496105_0686288
677 Ga0496108_0025318
678 Ga0496108_0248014
679 Ga0496108_0277567
680 Ga0496108_0310760
681 Ga0496109_0251199
682 Ga0496109_0990949
683 Ga0496110_0131683
684 Ga0496110_0349300
685 Ga0496110_0479535
686 Ga0496111_0292938
687 Ga0496111_0578781
688 Ga0496114_0042465
689 Ga0496114_0091315
690 Ga0496114_0375298
691 Ga0496114_0448099
692 Ga0496124_0119826
693 Ga0496124_0275816
694 Ga0501306_008811
695 Ga0501306_036945
696 Ga0501308_009141
697 Ga0501309_054851
698 Ga0501310_057466
699 Ga0501305_011779
700 Ga0501307_047201
701 Ga0501292_018280
702 Ga0501311_047557
703 Ga0501312_015826
704 Ga0501315_018611
705 Ga0501316_048888
706 Ga0501317_032983
707 Ga0501318_002237
708 Ga0501318_023665
709 Ga0501318_037269
710 Ga0501318_046609
711 Ga0501321_008264
712 Ga0501031_0528047
713 Ga0501032_0189385
714 Ga0501036_0658059
715 Ga0501039_0404594
716 Ga0501040_0625910
717 Ga0501041_0321523
718 Ga0501042_0471970
719 Ga0501047_0000195
720 Ga0501067_0004050
721 Ga0501067_0453787
722 Ga0501069_0013208
723 Ga0501072_0422429
724 Ga0501202_004713
725 Ga0501250_010251
726 Ga0501262_030697
727 Ga0501045_0677370
728 nmdc:mga0yw44_16984_c1
729 nmdc:mga0yw44_266150_c1
730 nmdc:mga07m45_55418_c1
731 nmdc:mga09592_170460_c1
732 nmdc:mga06r32_482781_c1
733 nmdc:mga08y16_16205_c1
734 nmdc:mga08y16_211694_c1
735 nmdc:mga0a205_1754_c1
736 Ga0495655_0066932
737 Ga0495655_0157376
738 Ga0500556_0001871
739 Ga0500593_000571
740 Ga0587079_061391
741 Ga0466962_0018262
742 Ga0466962_0045520
743 Ga0466962_0105527
744 Ga0530510_0089434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

73

186

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5adx-assembly1.cif.gz_K cryoem structure of dynactin complex at 4.0 angstrom resolution 0.4992 12 93
2vtw-assembly2.cif.gz_D structure of the c-terminal head domain of the fowl adenovirus type 1 short fibre 0.4977 16 62
7ccc-assembly1.cif.gz_C the structure of the actin filament uncapping complex mediated by twinfilin 0.4924 14 87
7t5q-assembly1.cif.gz_I cryo-em structure of a transition state of arp2/3 complex activation 0.4866 14 87
3bf2-assembly1.cif.gz_A-2 crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a 0.4522 32 120
ID Description Score Start End Superfamily
2ra5A01 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.5131 10 59 3.40.1410.10
af_A4IDS8_71_212_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5128 23 87 3.10.450.50
af_Q69KK0_99_372_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5009 21 83 2.120.10.80
af_F4IZV9_103_223_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.4937 34 85 3.10.450.50
1iznA02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit 0.4788 14 83 3.90.1150.210
ID Description Score Start End GO Terms
AF-A0A519FZS4-F1-model_v4 DUF177 domain-containing protein 0.9527 1 86
AF-A0A520ENT6-F1-model_v4 DUF177 domain-containing protein 0.9486 1 131
AF-A0A1V4QA20-F1-model_v4 Metal-binding protein 0.9468 2 145
AF-A0A3D0NPK5-F1-model_v4 DUF177 domain-containing protein 0.9459 1 90
AF-A0A3B9W555-F1-model_v4 DNA-binding protein 0.9442 2 137 GO:0003677

Map