F426119

General Info

Members Datasets Scaffolds Average Seq Length
372 269 364 168

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0011110|Ga0453683_0011110_625_1176
Length 183
Sequence MAELATIARPYAEALFKSSSAAGASGSADLGATSQWLDALAAVAGNAQLLRFADNPRVVAQQVFDVVSDVARVQLPAAGQNFLRTVIDNGRLAALPEIARQFRDMKNAQSGSSDAVVHSAFPIAADQLGRVAQVLEKRFGRKLNLSVQEDPSLIGGIRVVVGDEVLDTSVKARLEQMKVALTA

Samples

Sample ID Description Type Environment
1 2643221683 Variovorax sp. Root473 Isolate Unclassified
2 2842677519 Variovorax sp. R-72495 Isolate Unclassified
3 2842733646 Variovorax sp. R-72446 Isolate Unclassified
4 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
5 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
6 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
7 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
8 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
9 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
119 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
120 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
121 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
122 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
123 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
124 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
163 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
164 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
165 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
166 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
167 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
168 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
169 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
170 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
171 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
243 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
256 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
257 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
260 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.41
Metatranscriptomes 13.44
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.02
Nodule 0.54
Rhizoplane 5.65
Rhizosphere 78.23
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1000270 3300003347 Bacteria 2597
2 Ga0055540_1005371 3300003792 Bacteria 5411
3 Ga0065715_10138574 3300005293 Bacteria 1889
4 Ga0070676_10076261 3300005328 Bacteria 2023
5 Ga0070690_100074555 3300005330 Bacteria 2210
6 Ga0070670_100194565 3300005331 Bacteria 1761
7 Ga0068868_100000297 3300005338 Bacteria 33456
8 Ga0070689_100146122 3300005340 Bacteria 1905
9 Ga0070669_100722251 3300005353 Bacteria 842
10 Ga0070675_100004452 3300005354 Bacteria 10686
11 Ga0070674_101027463 3300005356 Bacteria 724
12 Ga0070673_100208219 3300005364 Bacteria 1687
13 Ga0070688_100126810 3300005365 Bacteria 1716
14 Ga0070659_100650311 3300005366 Bacteria 909
15 Ga0070667_100002670 3300005367 Bacteria 15446
16 Ga0070708_100222677 3300005445 Bacteria 1769
17 Ga0070663_100456103 3300005455 Bacteria 1055
18 Ga0070678_100131304 3300005456 Bacteria 1990
19 Ga0070678_101370618 3300005456 Bacteria 659
20 Ga0070662_100664965 3300005457 Bacteria 879
21 Ga0068867_100739544 3300005459 Bacteria 872
22 Ga0070685_10148844 3300005466 Bacteria 1482
23 Ga0070672_100748681 3300005543 Bacteria 857
24 Ga0070665_101327487 3300005548 Bacteria 729
25 Ga0068856_100262510 3300005614 Bacteria 1742
26 Ga0068852_100579550 3300005616 Bacteria 1125
27 Ga0068859_100044735 3300005617 Bacteria 4448
28 Ga0068859_101001324 3300005617 Bacteria 918
29 Ga0068864_100034150 3300005618 Bacteria 4324
30 Ga0068866_10632201 3300005718 Bacteria 726
31 Ga0068861_100339873 3300005719 Bacteria 1313
32 Ga0068851_10371765 3300005834 Bacteria 836
33 Ga0068870_10327212 3300005840 Bacteria 976
34 Ga0068863_100081692 3300005841 Bacteria 3061
35 Ga0068863_100889260 3300005841 Bacteria 891
36 Ga0068858_100000165 3300005842 Bacteria 70617
37 Ga0075365_10196286 3300006038 Bacteria 1413
38 Ga0075362_10139789 3300006177 Bacteria 1157
39 Ga0075362_10402407 3300006177 Bacteria 690
40 Ga0075366_10016607 3300006195 Bacteria 4233
41 Ga0075366_10090911 3300006195 Bacteria 1828
42 Ga0075366_10092494 3300006195 Bacteria 1812
43 Ga0075366_10181823 3300006195 Bacteria 1277
44 Ga0097621_100164033 3300006237 Bacteria 1912
45 Ga0097621_100249634 3300006237 Bacteria 1553
46 Ga0075370_10159242 3300006353 Bacteria 1324
47 Ga0068871_100042342 3300006358 Bacteria 3655
48 Ga0075429_100168712 3300006880 Bacteria 1917
49 Ga0097620_100044734 3300006931 Bacteria 4448
50 Ga0097620_101001393 3300006931 Bacteria 918
51 Ga0099826_10041264 3300006948 Bacteria 3202
52 Ga0105245_10253333 3300009098 Bacteria 1711
53 Ga0114129_10148981 3300009147 Bacteria 3203
54 Ga0105243_10001715 3300009148 Bacteria 18866
55 Ga0105248_10072506 3300009177 Bacteria 3870
56 Ga0105248_11389128 3300009177 Bacteria 794
57 Ga0105238_11817661 3300009551 Bacteria 641
58 Ga0157369_10688138 3300013105 Bacteria 1053
59 Ga0157378_10584767 3300013297 Bacteria 1126
60 Ga0163162_11179999 3300013306 Bacteria 868
61 Ga0157375_10399059 3300013308 Bacteria 1542
62 Ga0157375_11413166 3300013308 Bacteria 820
63 Ga0163163_10040793 3300014325 Bacteria 4535
64 Ga0182008_10015662 3300014497 Bacteria 3953
65 Ga0157377_10197254 3300014745 Bacteria 1276
66 Ga0157379_10094774 3300014968 Bacteria 2678
67 Ga0157376_10185378 3300014969 Bacteria 1905
68 Ga0157376_10751268 3300014969 Bacteria 984
69 Ga0182005_1080191 3300015265 Bacteria 901
70 Ga0163161_10674168 3300017792 Bacteria 859
71 Ga0209676_1000375 3300025292 Bacteria 82420
72 Ga0209050_1024481 3300025298 Bacteria 2087
73 Ga0209051_1000263 3300025303 Bacteria 87839
74 Ga0209051_1004508 3300025303 Bacteria 8550
75 Ga0209257_1000108 3300025304 Bacteria 240229
76 Ga0209257_1018417 3300025304 Bacteria 2687
77 Ga0207697_10036082 3300025315 Bacteria 2024
78 Ga0207642_10108742 3300025899 Bacteria 1407
79 Ga0207680_10014979 3300025903 Bacteria 4034
80 Ga0207643_10021061 3300025908 Bacteria 3580
81 Ga0207662_10106734 3300025918 Bacteria 1742
82 Ga0207681_10021413 3300025923 Bacteria 4109
83 Ga0207650_10129294 3300025925 Bacteria 1975
84 Ga0207650_10623582 3300025925 Bacteria 908
85 Ga0207659_10002630 3300025926 Bacteria 10693
86 Ga0207687_10559312 3300025927 Bacteria 960
87 Ga0207644_10004409 3300025931 Bacteria 9132
88 Ga0207690_10465942 3300025932 Bacteria 1018
89 Ga0207706_10789628 3300025933 Bacteria 807
90 Ga0207686_10412387 3300025934 Bacteria 1031
91 Ga0207709_10001150 3300025935 Bacteria 19278
92 Ga0207670_10120145 3300025936 Bacteria 1909
93 Ga0207669_10763067 3300025937 Bacteria 800
94 Ga0207669_10901880 3300025937 Bacteria 738
95 Ga0207691_10637717 3300025940 Bacteria 901
96 Ga0207691_10752814 3300025940 Bacteria 820
97 Ga0207711_10058182 3300025941 Bacteria 3325
98 Ga0207651_10158031 3300025960 Bacteria 1773
99 Ga0207712_10133270 3300025961 Bacteria 1896
100 Ga0207658_10002388 3300025986 Bacteria 13764
101 Ga0207677_10005425 3300026023 Bacteria 6923
102 Ga0207703_10118136 3300026035 Bacteria 2273
103 Ga0207639_10712908 3300026041 Bacteria 931
104 Ga0207678_10550541 3300026067 Bacteria 1009
105 Ga0207702_10221269 3300026078 Bacteria 1764
106 Ga0207641_10087672 3300026088 Bacteria 2715
107 Ga0207648_10914997 3300026089 Bacteria 820
108 Ga0207676_10001560 3300026095 Bacteria 16902
109 Ga0207674_11161036 3300026116 Bacteria 742
110 Ga0207675_100457290 3300026118 Bacteria 1266
111 Ga0207683_10217503 3300026121 Bacteria 1740
112 Ga0207698_10307693 3300026142 Bacteria 1478
113 Ga0207698_11132969 3300026142 Bacteria 795
114 Ga0209281_1042647 3300027111 Bacteria 755
115 Ga0209969_1005121 3300027360 Bacteria 1835
116 Ga0209981_1001092 3300027378 Bacteria 3455
117 Ga0209996_1001084 3300027395 Bacteria 3241
118 Ga0209995_1006938 3300027471 Bacteria 1826
119 Ga0209968_1001563 3300027526 Bacteria 3465
120 Ga0209999_1012423 3300027543 Bacteria 1542
121 Ga0209970_1000134 3300027614 Bacteria 11104
122 Ga0209983_1051650 3300027665 Bacteria 900
123 Ga0209966_1000007 3300027695 Bacteria 95874
124 Ga0209998_10049195 3300027717 Bacteria 973
125 Ga0268266_11217061 3300028379 Bacteria 728
126 Ga0268264_10282179 3300028381 Bacteria 1556
127 Ga0307515_10000013 3300028794 Bacteria 568456
128 Ga0307515_10000037 3300028794 Bacteria 331970
129 Ga0316177_1041663 3300030731 Bacteria 1512
130 Ga0316176_1106074 3300030732 Bacteria 1355
131 Ga0314311_1023424 3300030733 Bacteria 9020
132 Ga0316179_1041273 3300030734 Bacteria 2418
133 Ga0316178_1001040 3300030735 Bacteria 3779
134 Ga0316180_1144076 3300030736 Bacteria 6669
135 Ga0316183_1166349 3300030742 Bacteria 1377
136 Ga0316181_1208588 3300030744 Bacteria 9361
137 Ga0316182_1074800 3300030745 Bacteria 2548
138 Ga0307408_100169830 3300031548 Bacteria 1740
139 Ga0307514_10000530 3300031649 Bacteria 74660
140 Ga0307516_10382921 3300031730 Bacteria 1068
141 Ga0307405_10019642 3300031731 Bacteria 3758
142 Ga0307405_10163003 3300031731 Bacteria 1581
143 Ga0307405_10216798 3300031731 Bacteria 1401
144 Ga0307405_10289859 3300031731 Bacteria 1236
145 Ga0307405_10778480 3300031731 Bacteria 799
146 Ga0307413_10572156 3300031824 Bacteria 920
147 Ga0307410_10258890 3300031852 Bacteria 1356
148 Ga0307406_10067579 3300031901 Bacteria 2330
149 Ga0307406_10364168 3300031901 Bacteria 1134
150 Ga0307407_10291528 3300031903 Bacteria 1134
151 Ga0307412_10014995 3300031911 Bacteria 4583
152 Ga0307412_10269145 3300031911 Bacteria 1332
153 Ga0307412_10424513 3300031911 Bacteria 1088
154 Ga0307412_10599773 3300031911 Bacteria 932
155 Ga0307412_11037709 3300031911 Bacteria 726
156 Ga0307416_100091442 3300032002 Bacteria 2613
157 Ga0307416_100662526 3300032002 Bacteria 1129
158 Ga0307416_100873534 3300032002 Bacteria 998
159 Ga0307416_101481780 3300032002 Bacteria 784
160 Ga0307414_10048058 3300032004 Bacteria 2941
161 Ga0307414_11177864 3300032004 Bacteria 709
162 Ga0307411_10012001 3300032005 Bacteria 4705
163 Ga0307411_10062253 3300032005 Bacteria 2488
164 Ga0307411_10987679 3300032005 Bacteria 753
165 Ga0307415_100093235 3300032126 Bacteria 2186
166 Ga0307510_10160077 3300033180 Bacteria 1850
167 Ga0395899_0007626 3300037312 Bacteria 8346
168 Ga0395900_0045270 3300037418 Bacteria 4532
169 Ga0395900_0087665 3300037418 Bacteria 3198
170 Ga0395900_0126386 3300037418 Bacteria 2622
171 Ga0395898_0003864 3300037466 Bacteria 16558
172 Ga0395898_0017003 3300037466 Bacteria 7427
173 Ga0395898_0060835 3300037466 Bacteria 3669
174 Ga0395905_0020746 3300037471 Bacteria 6221
175 Ga0395905_0042964 3300037471 Bacteria 4240
176 Ga0395905_0051976 3300037471 Bacteria 3837
177 Ga0395905_0054324 3300037471 Bacteria 3748
178 Ga0395905_0108714 3300037471 Bacteria 2603
179 Ga0395905_0130920 3300037471 Bacteria 2359
180 Ga0395905_1002398 3300037471 Bacteria 738
181 Ga0395901_0010545 3300038443 Bacteria 9360
182 Ga0395901_0026076 3300038443 Bacteria 6001
183 Ga0395901_0050659 3300038443 Bacteria 4313
184 Ga0395901_0145053 3300038443 Bacteria 2495
185 Ga0395901_0483754 3300038443 Bacteria 1262
186 Ga0395901_0489730 3300038443 Bacteria 1253
187 Ga0395901_0697378 3300038443 Bacteria 1013
188 Ga0439436_0047329 3300041404 Bacteria 1221
189 Ga0439436_0108459 3300041404 Bacteria 775
190 Ga0439453_0011342 3300041408 Bacteria 1485
191 Ga0451789_0960326 3300041443 Bacteria 1157
192 Ga0451793_0921268 3300041452 Bacteria 1391
193 Ga0451797_0334826 3300041453 Bacteria 1323
194 Ga0451795_0938206 3300041456 Bacteria 1718
195 Ga0451798_0016593 3300041458 Bacteria 1681
196 Ga0451800_1171684 3300041459 Bacteria 1662
197 Ga0451804_0081191 3300041463 Bacteria 2116
198 Ga0451807_1043038 3300041486 Bacteria 606
199 Ga0451843_1012347 3300041509 Bacteria 733
200 Ga0439448_0171738 3300042005 Bacteria 756
201 Ga0439449_0000443 3300042007 Bacteria 15378
202 Ga0439449_0061596 3300042007 Bacteria 1384
203 Ga0439450_071116 3300042008 Bacteria 854
204 Ga0439455_0056681 3300042012 Bacteria 1032
205 Ga0439462_0001121 3300042015 Bacteria 5807
206 Ga0439462_0029651 3300042015 Bacteria 1447
207 Ga0450912_003260 3300042116 Bacteria 1146
208 Ga0450923_008131 3300042125 Bacteria 1795
209 Ga0450897_000353 3300042128 Bacteria 2469
210 Ga0450894_011384 3300042131 Bacteria 1158
211 Ga0450896_014176 3300042133 Bacteria 1137
212 Ga0450896_056951 3300042133 Bacteria 631
213 Ga0450898_003929 3300042134 Bacteria 2167
214 Ga0450898_007938 3300042134 Bacteria 1663
215 Ga0450899_018418 3300042135 Bacteria 807
216 Ga0450904_005237 3300042139 Bacteria 1320
217 Ga0450905_013265 3300042142 Bacteria 1166
218 Ga0450909_035604 3300042185 Bacteria 760
219 Ga0439435_0038792 3300042436 Bacteria 1325
220 Ga0439459_0108058 3300042438 Bacteria 688
221 Ga0439464_0002825 3300042439 Bacteria 4314
222 Ga0450893_0008810 3300042532 Bacteria 1646
223 Ga0451577_0075418 3300042876 Bacteria 3007
224 Ga0451577_0288468 3300042876 Bacteria 1487
225 Ga0453683_0011110 3300044673 Bacteria 5951
226 Ga0453683_0404919 3300044673 Bacteria 880
227 Ga0466961_0040108 3300044693 Bacteria 3002
228 Ga0466963_0440546 3300044694 Bacteria 919
229 Ga0453684_0551768 3300044712 Bacteria 1269
230 Ga0466970_0144467 3300044765 Bacteria 1312
231 Ga0466957_0417086 3300044842 Bacteria 920
232 Ga0466957_0436422 3300044842 Bacteria 900
233 Ga0466959_0378343 3300045049 Bacteria 964
234 Ga0451576_0004699 3300045051 Bacteria 17568
235 Ga0451576_0431708 3300045051 Bacteria 1382
236 Ga0466967_1281232 3300045976 Bacteria 730
237 Ga0466967_1382703 3300045976 Bacteria 701
238 Ga0495610_0150418 3300046512 Bacteria 994
239 Ga0495632_0000930 3300046519 Bacteria 25660
240 Ga0495642_0043824 3300046528 Bacteria 1825
241 Ga0495621_0180497 3300046539 Bacteria 842
242 Ga0495633_0053093 3300046558 Bacteria 1908
243 Ga0495656_0011889 3300046615 Bacteria 3201
244 Ga0495656_0031596 3300046615 Bacteria 2149
245 Ga0495588_0031589 3300046674 Bacteria 2666
246 Ga0495647_0106932 3300046681 Bacteria 1164
247 Ga0495647_0431242 3300046681 Bacteria 608
248 Ga0495636_0045924 3300047318 Bacteria 1821
249 Ga0495677_0010653 3300047445 Bacteria 3370
250 Ga0495681_0053233 3300047470 Bacteria 1896
251 Ga0495615_0006938 3300048090 Bacteria 2126
252 Ga0496101_0497563 3300048904 Bacteria 963
253 Ga0496104_0514518 3300048907 Bacteria 1108
254 Ga0496104_1140046 3300048907 Bacteria 683
255 Ga0496105_0063775 3300048908 Bacteria 3040
256 Ga0496106_0166396 3300048909 Bacteria 1746
257 Ga0496107_0242468 3300048910 Bacteria 1341
258 Ga0496108_0522397 3300048911 Bacteria 1036
259 Ga0496108_1378463 3300048911 Bacteria 590
260 Ga0496109_0511600 3300048912 Bacteria 1133
261 Ga0496110_0184560 3300048913 Bacteria 1894
262 Ga0496114_0293383 3300048917 Bacteria 1435
263 Ga0496114_0721968 3300048917 Bacteria 873
264 Ga0496114_0824466 3300048917 Bacteria 807
265 Ga0496116_0218661 3300048919 Bacteria 979
266 Ga0496117_0375504 3300048920 Bacteria 726
267 Ga0496121_0007574 3300048924 Bacteria 13071
268 Ga0496122_0002564 3300048925 Bacteria 25525
269 Ga0496123_0056087 3300048926 Bacteria 2578
270 Ga0496124_0349786 3300048927 Bacteria 1046
271 Ga0496124_0706353 3300048927 Bacteria 638
272 Ga0496126_0498324 3300048929 Bacteria 974
273 Ga0501306_010645 3300049127 Bacteria 1161
274 Ga0501306_027101 3300049127 Bacteria 833
275 Ga0501306_044839 3300049127 Bacteria 695
276 Ga0501308_011355 3300049128 Bacteria 1002
277 Ga0501308_015564 3300049128 Bacteria 903
278 Ga0501309_035354 3300049129 Bacteria 749
279 Ga0501310_004595 3300049130 Bacteria 1391
280 Ga0501310_021954 3300049130 Bacteria 802
281 Ga0501304_001056 3300049160 Bacteria 1672
282 Ga0501305_034290 3300049161 Bacteria 804
283 Ga0501305_041997 3300049161 Bacteria 746
284 Ga0501305_062855 3300049161 Bacteria 642
285 Ga0501307_012871 3300049162 Bacteria 1002
286 Ga0501307_023552 3300049162 Bacteria 816
287 Ga0501307_037201 3300049162 Bacteria 696
288 Ga0501311_003705 3300049527 Bacteria 1583
289 Ga0501311_006685 3300049527 Bacteria 1307
290 Ga0501311_039349 3300049527 Bacteria 712
291 Ga0501312_009347 3300049528 Bacteria 1290
292 Ga0501312_067599 3300049528 Bacteria 629
293 Ga0501313_007388 3300049529 Bacteria 1210
294 Ga0501313_028575 3300049529 Bacteria 716
295 Ga0501313_044691 3300049529 Bacteria 602
296 Ga0501314_016732 3300049530 Bacteria 734
297 Ga0501315_007534 3300049531 Bacteria 1243
298 Ga0501315_020756 3300049531 Bacteria 884
299 Ga0501315_023730 3300049531 Bacteria 844
300 Ga0501315_039376 3300049531 Bacteria 710
301 Ga0501315_074949 3300049531 Bacteria 567
302 Ga0501316_006481 3300049532 Bacteria 1246
303 Ga0501316_013842 3300049532 Bacteria 957
304 Ga0501316_016670 3300049532 Bacteria 895
305 Ga0501316_018190 3300049532 Bacteria 867
306 Ga0501317_028634 3300049533 Bacteria 797
307 Ga0501318_007829 3300049534 Bacteria 1127
308 Ga0501318_026636 3300049534 Bacteria 764
309 Ga0501319_000958 3300049535 Bacteria 1556
310 Ga0501320_001200 3300049536 Bacteria 1827
311 Ga0501320_016759 3300049536 Bacteria 813
312 Ga0501320_025790 3300049536 Bacteria 707
313 Ga0501321_011198 3300049537 Bacteria 996
314 Ga0501321_019872 3300049537 Bacteria 826
315 Ga0501321_030261 3300049537 Bacteria 720
316 Ga0501323_007001 3300049539 Bacteria 1276
317 Ga0501323_028205 3300049539 Bacteria 777
318 Ga0501323_035144 3300049539 Bacteria 717
319 Ga0501323_040083 3300049539 Bacteria 684
320 Ga0501325_023328 3300049541 Bacteria 667
321 Ga0501340_007748 3300049556 Bacteria 746
322 Ga0501033_0135737 3300049570 Bacteria 1780
323 Ga0501036_0446333 3300049572 Bacteria 1078
324 Ga0501037_0052511 3300049573 Bacteria 2981
325 Ga0501038_0476315 3300049574 Bacteria 957
326 Ga0501047_0579099 3300049581 Bacteria 945
327 Ga0501223_025776 3300049663 Bacteria 1144
328 Ga0501249_010981 3300049679 Bacteria 1897
329 Ga0501262_000368 3300049759 Bacteria 5460
330 Ga0501280_032423 3300049776 Bacteria 820
331 Ga0501035_0109585 3300049822 Bacteria 2420
332 Ga0501044_0318057 3300049823 Bacteria 1481
333 Ga0501044_0420999 3300049823 Bacteria 1246
334 nmdc:mga03683_47668_c1 3300050489 Bacteria 1778
335 nmdc:mga0yw44_442719_c1 3300050492 Bacteria 880
336 nmdc:mga0k408_293526_c1 3300050493 Bacteria 970
337 nmdc:mga0k408_327659_c1 3300050493 Bacteria 914
338 nmdc:mga0k408_33585_c1 3300050493 Bacteria 2935
339 nmdc:mga0k408_7758_c1 3300050493 Bacteria 5738
340 nmdc:mga0k408_86968_c1 3300050493 Bacteria 1835
341 nmdc:mga07m45_261450_c1 3300050496 Bacteria 1007
342 nmdc:mga07m45_464132_c1 3300050496 Bacteria 734
343 nmdc:mga05p37_121842_c1 3300050507 Bacteria 3203
344 nmdc:mga09592_677631_c1 3300050508 Bacteria 879
345 Ga0500635_0224096 3300053080 Bacteria 734
346 Ga0500646_0053152 3300053090 Bacteria 1174
347 Ga0500583_0249981 3300053092 Bacteria 875
348 Ga0500651_0016966 3300053093 Bacteria 4482
349 Ga0500650_0174673 3300053098 Bacteria 986
350 Ga0500555_133369 3300053103 Bacteria 615
351 Ga0500562_015123 3300053108 Bacteria 1979
352 Ga0500569_016154 3300053109 Bacteria 1885
353 Ga0500628_011615 3300053129 Bacteria 1604
354 Ga0500652_000132 3300053131 Bacteria 27923
355 Ga0500658_0142555 3300053134 Bacteria 1076
356 Ga0500568_0004545 3300053139 Bacteria 7400
357 Ga0500568_0038930 3300053139 Bacteria 1922
358 Ga0500568_0193465 3300053139 Bacteria 746
359 Ga0500588_0180939 3300053146 Bacteria 775
360 Ga0500616_0013271 3300053153 Bacteria 4791
361 Ga0500622_0028869 3300053156 Bacteria 2919
362 Ga0590074_012377 3300059423 Bacteria 1435
363 Ga0587108_006845 3300059653 Bacteria 891
364 Ga0501082_0689785 3300060353 Bacteria 894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10138574 Ga0065715_101385743 135
2 3300005328 Ga0070676_10076261 Ga0070676_100762612 135
3 3300005330 Ga0070690_100074555 Ga0070690_1000745552 135
4 3300005331 Ga0070670_100194565 Ga0070670_1001945652 135
5 3300005338 Ga0068868_100000297 Ga0068868_10000029721 135
6 3300005340 Ga0070689_100146122 Ga0070689_1001461223 135
7 3300005353 Ga0070669_100722251 Ga0070669_1007222511 135
8 3300005354 Ga0070675_100004452 Ga0070675_1000044522 135
9 3300005356 Ga0070674_101027463 Ga0070674_1010274631 135
10 3300005364 Ga0070673_100208219 Ga0070673_1002082192 135
11 3300005365 Ga0070688_100126810 Ga0070688_1001268102 135
12 3300005367 Ga0070667_100002670 Ga0070667_1000026702 135
13 3300005455 Ga0070663_100456103 Ga0070663_1004561032 135
14 3300005456 Ga0070678_100131304 Ga0070678_1001313042 135
15 3300005457 Ga0070662_100664965 Ga0070662_1006649652 135
16 3300005466 Ga0070685_10148844 Ga0070685_101488443 135
17 3300005543 Ga0070672_100748681 Ga0070672_1007486812 135
18 3300005617 Ga0068859_100044735 Ga0068859_1000447353 135
19 3300005618 Ga0068864_100034150 Ga0068864_1000341502 135
20 3300005718 Ga0068866_10632201 Ga0068866_106322011 135
21 3300005719 Ga0068861_100339873 Ga0068861_1003398731 135
22 3300005834 Ga0068851_10371765 Ga0068851_103717652 135
23 3300005840 Ga0068870_10327212 Ga0068870_103272122 135
24 3300005841 Ga0068863_100081692 Ga0068863_1000816922 135
25 3300005842 Ga0068858_100000165 Ga0068858_10000016520 135
26 3300006237 Ga0097621_100249634 Ga0097621_1002496342 135
27 3300006358 Ga0068871_100042342 Ga0068871_1000423422 135
28 3300006931 Ga0097620_100044734 Ga0097620_1000447343 135
29 3300009098 Ga0105245_10253333 Ga0105245_102533332 135
30 3300013297 Ga0157378_10584767 Ga0157378_105847672 135
31 3300013306 Ga0163162_11179999 Ga0163162_111799992 135
32 3300013308 Ga0157375_10399059 Ga0157375_103990592 135
33 3300014325 Ga0163163_10040793 Ga0163163_100407936 135
34 3300014745 Ga0157377_10197254 Ga0157377_101972543 135
35 3300014968 Ga0157379_10094774 Ga0157379_100947742 135
36 3300014969 Ga0157376_10185378 Ga0157376_101853782 135
37 3300017792 Ga0163161_10674168 Ga0163161_106741682 135
38 3300025315 Ga0207697_10036082 Ga0207697_100360822 135
39 3300025899 Ga0207642_10108742 Ga0207642_101087423 135
40 3300025903 Ga0207680_10014979 Ga0207680_100149794 135
41 3300025908 Ga0207643_10021061 Ga0207643_100210612 135
42 3300025925 Ga0207650_10129294 Ga0207650_101292942 135
43 3300025926 Ga0207659_10002630 Ga0207659_1000263015 135
44 3300025931 Ga0207644_10004409 Ga0207644_100044094 135
45 3300025933 Ga0207706_10789628 Ga0207706_107896282 135
46 3300025934 Ga0207686_10412387 Ga0207686_104123872 135
47 3300025936 Ga0207670_10120145 Ga0207670_101201452 135
48 3300025937 Ga0207669_10901880 Ga0207669_109018801 135
49 3300025940 Ga0207691_10752814 Ga0207691_107528142 135
50 3300025986 Ga0207658_10002388 Ga0207658_1000238815 135
51 3300026023 Ga0207677_10005425 Ga0207677_100054252 135
52 3300026035 Ga0207703_10118136 Ga0207703_101181362 135
53 3300026088 Ga0207641_10087672 Ga0207641_100876722 135
54 3300026089 Ga0207648_10914997 Ga0207648_109149971 135
55 3300026095 Ga0207676_10001560 Ga0207676_1000156018 135
56 3300026118 Ga0207675_100457290 Ga0207675_1004572902 135
57 3300026121 Ga0207683_10217503 Ga0207683_102175032 135
58 3300026142 Ga0207698_10307693 Ga0207698_103076933 135
59 3300028381 Ga0268264_10282179 Ga0268264_102821792 135
60 3300046681 Ga0495647_0431242 Ga0495647_0431242_22_567 135
61 3300048904 Ga0496101_0497563 Ga0496101_0497563_238_783 135
62 3300048907 Ga0496104_1140046 Ga0496104_1140046_100_645 135
63 3300048911 Ga0496108_1378463 Ga0496108_1378463_25_570 135
64 3300048912 Ga0496109_0511600 Ga0496109_0511600_310_855 135
65 3300048917 Ga0496114_0824466 Ga0496114_0824466_160_705 135
66 3300005456 Ga0070678_101370618 Ga0070678_1013706181 136
67 3300005841 Ga0068863_100889260 Ga0068863_1008892601 136
68 3300009177 Ga0105248_10072506 Ga0105248_100725066 136
69 3300013308 Ga0157375_11413166 Ga0157375_114131661 136
70 3300014969 Ga0157376_10751268 Ga0157376_107512681 136
71 3300025918 Ga0207662_10106734 Ga0207662_101067344 136
72 3300025960 Ga0207651_10158031 Ga0207651_101580312 136
73 3300046681 Ga0495647_0106932 Ga0495647_0106932_203_748 136
74 3300048907 Ga0496104_0514518 Ga0496104_0514518_530_1075 136
75 3300048908 Ga0496105_0063775 Ga0496105_0063775_848_1393 136
76 3300048911 Ga0496108_0522397 Ga0496108_0522397_256_801 136
77 3300048917 Ga0496114_0293383 Ga0496114_0293383_378_923 136
78 3300026041 Ga0207639_10712908 Ga0207639_107129082 137
79 3300041486 Ga0451807_1043038 Ga0451807_1043038_14_478 153
80 3300041509 Ga0451843_1012347 Ga0451843_1012347_93_632 158
81 3300009177 Ga0105248_11389128 Ga0105248_113891281 159
82 3300025941 Ga0207711_10058182 Ga0207711_100581821 159
83 3300048913 Ga0496110_0184560 Ga0496110_0184560_788_1321 160
84 3300049537 Ga0501321_019872 Ga0501321_019872_11_499 160
85 3300031731 Ga0307405_10163003 Ga0307405_101630032 162
86 3300032004 Ga0307414_10048058 Ga0307414_100480584 162
87 3300032005 Ga0307411_10062253 Ga0307411_100622534 162
88 3300005445 Ga0070708_100222677 Ga0070708_1002226773 170
89 3300006195 Ga0075366_10181823 Ga0075366_101818232 170
90 3300009147 Ga0114129_10148981 Ga0114129_101489811 170
91 3300042012 Ga0439455_0056681 Ga0439455_0056681_500_1021 170
92 3300044673 Ga0453683_0404919 Ga0453683_0404919_226_747 170
93 3300050493 nmdc:mga0k408_7758_c1 nmdc:mga0k408_7758_c1_240_764 170
94 3300050507 nmdc:mga05p37_121842_c1 nmdc:mga05p37_121842_c1_2616_3137 170
95 iso_pu_bacteria 2643221683 2644466288 170
96 iso_pu_bacteria 2842677519 2842680664 170
97 iso_pu_bacteria 2842733646 2842737751 170
98 iso_pu_bacteria 2919462493 2919463404 170
99 iso_pu_bacteria 2928115317 2928120510 170
100 iso_pu_bacteria 2939631187 2939636411 170
101 iso_pu_bacteria 2945945610 2945951190 170
102 iso_pu_bacteria 2954767861 2954769416 170
103 3300006195 Ga0075366_10092494 Ga0075366_100924943 173
104 3300050493 nmdc:mga0k408_33585_c1 nmdc:mga0k408_33585_c1_2168_2707 173
105 3300003347 JGI26128J50194_1000270 JGI26128J50194_10002704 174
106 3300003792 Ga0055540_1005371 Ga0055540_10053712 174
107 3300005366 Ga0070659_100650311 Ga0070659_1006503112 174
108 3300005459 Ga0068867_100739544 Ga0068867_1007395442 174
109 3300005548 Ga0070665_101327487 Ga0070665_1013274872 174
110 3300005614 Ga0068856_100262510 Ga0068856_1002625102 174
111 3300005616 Ga0068852_100579550 Ga0068852_1005795502 174
112 3300005617 Ga0068859_101001324 Ga0068859_1010013242 174
113 3300006038 Ga0075365_10196286 Ga0075365_101962862 174
114 3300006177 Ga0075362_10139789 Ga0075362_101397892 174
115 3300006177 Ga0075362_10402407 Ga0075362_104024071 174
116 3300006195 Ga0075366_10016607 Ga0075366_100166071 174
117 3300006195 Ga0075366_10090911 Ga0075366_100909112 174
118 3300006237 Ga0097621_100164033 Ga0097621_1001640332 174
119 3300006353 Ga0075370_10159242 Ga0075370_101592422 174
120 3300006880 Ga0075429_100168712 Ga0075429_1001687123 174
121 3300006931 Ga0097620_101001393 Ga0097620_1010013932 174
122 3300006948 Ga0099826_10041264 Ga0099826_100412646 174
123 3300009148 Ga0105243_10001715 Ga0105243_100017152 174
124 3300009551 Ga0105238_11817661 Ga0105238_118176611 174
125 3300013105 Ga0157369_10688138 Ga0157369_106881382 174
126 3300014497 Ga0182008_10015662 Ga0182008_100156624 174
127 3300015265 Ga0182005_1080191 Ga0182005_10801911 174
128 3300025292 Ga0209676_1000375 Ga0209676_10003759 174
129 3300025298 Ga0209050_1024481 Ga0209050_10244812 174
130 3300025303 Ga0209051_1000263 Ga0209051_100026311 174
131 3300025303 Ga0209051_1004508 Ga0209051_10045084 174
132 3300025304 Ga0209257_1000108 Ga0209257_100010889 174
133 3300025304 Ga0209257_1018417 Ga0209257_10184172 174
134 3300025923 Ga0207681_10021413 Ga0207681_100214132 174
135 3300025925 Ga0207650_10623582 Ga0207650_106235822 174
136 3300025927 Ga0207687_10559312 Ga0207687_105593122 174
137 3300025932 Ga0207690_10465942 Ga0207690_104659422 174
138 3300025935 Ga0207709_10001150 Ga0207709_1000115021 174
139 3300025937 Ga0207669_10763067 Ga0207669_107630671 174
140 3300025940 Ga0207691_10637717 Ga0207691_106377171 174
141 3300025961 Ga0207712_10133270 Ga0207712_101332702 174
142 3300026067 Ga0207678_10550541 Ga0207678_105505412 174
143 3300026078 Ga0207702_10221269 Ga0207702_102212693 174
144 3300026116 Ga0207674_11161036 Ga0207674_111610361 174
145 3300026142 Ga0207698_11132969 Ga0207698_111329692 174
146 3300027111 Ga0209281_1042647 Ga0209281_10426471 174
147 3300027360 Ga0209969_1005121 Ga0209969_10051212 174
148 3300027378 Ga0209981_1001092 Ga0209981_10010923 174
149 3300027395 Ga0209996_1001084 Ga0209996_10010845 174
150 3300027471 Ga0209995_1006938 Ga0209995_10069383 174
151 3300027526 Ga0209968_1001563 Ga0209968_10015632 174
152 3300027543 Ga0209999_1012423 Ga0209999_10124232 174
153 3300027614 Ga0209970_1000134 Ga0209970_10001348 174
154 3300027665 Ga0209983_1051650 Ga0209983_10516502 174
155 3300027695 Ga0209966_1000007 Ga0209966_100000715 174
156 3300027717 Ga0209998_10049195 Ga0209998_100491952 174
157 3300028379 Ga0268266_11217061 Ga0268266_112170612 174
158 3300028794 Ga0307515_10000013 Ga0307515_10000013119 174
159 3300028794 Ga0307515_10000037 Ga0307515_10000037197 174
160 3300030731 Ga0316177_1041663 Ga0316177_10416634 174
161 3300030732 Ga0316176_1106074 Ga0316176_11060742 174
162 3300030733 Ga0314311_1023424 Ga0314311_102342411 174
163 3300030734 Ga0316179_1041273 Ga0316179_10412734 174
164 3300030735 Ga0316178_1001040 Ga0316178_10010405 174
165 3300030736 Ga0316180_1144076 Ga0316180_11440765 174
166 3300030742 Ga0316183_1166349 Ga0316183_11663492 174
167 3300030744 Ga0316181_1208588 Ga0316181_12085885 174
168 3300030745 Ga0316182_1074800 Ga0316182_10748004 174
169 3300031548 Ga0307408_100169830 Ga0307408_1001698302 174
170 3300031649 Ga0307514_10000530 Ga0307514_1000053069 174
171 3300031730 Ga0307516_10382921 Ga0307516_103829211 174
172 3300031731 Ga0307405_10019642 Ga0307405_100196422 174
173 3300031731 Ga0307405_10216798 Ga0307405_102167982 174
174 3300031731 Ga0307405_10289859 Ga0307405_102898592 174
175 3300031731 Ga0307405_10778480 Ga0307405_107784801 174
176 3300031824 Ga0307413_10572156 Ga0307413_105721562 174
177 3300031852 Ga0307410_10258890 Ga0307410_102588902 174
178 3300031901 Ga0307406_10067579 Ga0307406_100675792 174
179 3300031901 Ga0307406_10364168 Ga0307406_103641682 174
180 3300031903 Ga0307407_10291528 Ga0307407_102915282 174
181 3300031911 Ga0307412_10014995 Ga0307412_100149952 174
182 3300031911 Ga0307412_10269145 Ga0307412_102691452 174
183 3300031911 Ga0307412_10424513 Ga0307412_104245131 174
184 3300031911 Ga0307412_10599773 Ga0307412_105997732 174
185 3300031911 Ga0307412_11037709 Ga0307412_110377091 174
186 3300032002 Ga0307416_100091442 Ga0307416_1000914422 174
187 3300032002 Ga0307416_100662526 Ga0307416_1006625262 174
188 3300032002 Ga0307416_100873534 Ga0307416_1008735341 174
189 3300032002 Ga0307416_101481780 Ga0307416_1014817802 174
190 3300032004 Ga0307414_11177864 Ga0307414_111778641 174
191 3300032005 Ga0307411_10012001 Ga0307411_100120018 174
192 3300032005 Ga0307411_10987679 Ga0307411_109876792 174
193 3300032126 Ga0307415_100093235 Ga0307415_1000932353 174
194 3300033180 Ga0307510_10160077 Ga0307510_101600771 174
195 3300037312 Ga0395899_0007626 Ga0395899_0007626_3105_3635 174
196 3300037418 Ga0395900_0045270 Ga0395900_0045270_1136_1666 174
197 3300037418 Ga0395900_0087665 Ga0395900_0087665_1421_1951 174
198 3300037418 Ga0395900_0126386 Ga0395900_0126386_1909_2439 174
199 3300037466 Ga0395898_0003864 Ga0395898_0003864_2854_3384 174
200 3300037466 Ga0395898_0017003 Ga0395898_0017003_914_1444 174
201 3300037466 Ga0395898_0060835 Ga0395898_0060835_2623_3153 174
202 3300037471 Ga0395905_0020746 Ga0395905_0020746_4445_4975 174
203 3300037471 Ga0395905_0042964 Ga0395905_0042964_1938_2468 174
204 3300037471 Ga0395905_0051976 Ga0395905_0051976_1220_1750 174
205 3300037471 Ga0395905_0054324 Ga0395905_0054324_1925_2455 174
206 3300037471 Ga0395905_0108714 Ga0395905_0108714_1944_2474 174
207 3300037471 Ga0395905_0130920 Ga0395905_0130920_1397_1927 174
208 3300037471 Ga0395905_1002398 Ga0395905_1002398_164_694 174
209 3300038443 Ga0395901_0010545 Ga0395901_0010545_4363_4893 174
210 3300038443 Ga0395901_0026076 Ga0395901_0026076_3105_3635 174
211 3300038443 Ga0395901_0050659 Ga0395901_0050659_787_1317 174
212 3300038443 Ga0395901_0145053 Ga0395901_0145053_1500_2030 174
213 3300038443 Ga0395901_0483754 Ga0395901_0483754_119_649 174
214 3300038443 Ga0395901_0489730 Ga0395901_0489730_100_633 174
215 3300038443 Ga0395901_0697378 Ga0395901_0697378_151_681 174
216 3300041404 Ga0439436_0047329 Ga0439436_0047329_455_985 174
217 3300041404 Ga0439436_0108459 Ga0439436_0108459_142_672 174
218 3300041408 Ga0439453_0011342 Ga0439453_0011342_185_715 174
219 3300041443 Ga0451789_0960326 Ga0451789_0960326_560_1093 174
220 3300041452 Ga0451793_0921268 Ga0451793_0921268_334_867 174
221 3300041453 Ga0451797_0334826 Ga0451797_0334826_446_979 174
222 3300041456 Ga0451795_0938206 Ga0451795_0938206_579_1112 174
223 3300041458 Ga0451798_0016593 Ga0451798_0016593_303_836 174
224 3300041459 Ga0451800_1171684 Ga0451800_1171684_502_1035 174
225 3300041463 Ga0451804_0081191 Ga0451804_0081191_54_587 174
226 3300042005 Ga0439448_0171738 Ga0439448_0171738_187_717 174
227 3300042007 Ga0439449_0000443 Ga0439449_0000443_2874_3404 174
228 3300042007 Ga0439449_0061596 Ga0439449_0061596_636_1166 174
229 3300042008 Ga0439450_071116 Ga0439450_071116_130_660 174
230 3300042015 Ga0439462_0001121 Ga0439462_0001121_311_841 174
231 3300042015 Ga0439462_0029651 Ga0439462_0029651_370_900 174
232 3300042116 Ga0450912_003260 Ga0450912_003260_352_882 174
233 3300042125 Ga0450923_008131 Ga0450923_008131_166_696 174
234 3300042128 Ga0450897_000353 Ga0450897_000353_1721_2251 174
235 3300042131 Ga0450894_011384 Ga0450894_011384_465_995 174
236 3300042133 Ga0450896_014176 Ga0450896_014176_246_776 174
237 3300042133 Ga0450896_056951 Ga0450896_056951_88_621 174
238 3300042134 Ga0450898_003929 Ga0450898_003929_389_919 174
239 3300042134 Ga0450898_007938 Ga0450898_007938_281_814 174
240 3300042135 Ga0450899_018418 Ga0450899_018418_223_753 174
241 3300042139 Ga0450904_005237 Ga0450904_005237_235_765 174
242 3300042142 Ga0450905_013265 Ga0450905_013265_587_1117 174
243 3300042185 Ga0450909_035604 Ga0450909_035604_171_701 174
244 3300042436 Ga0439435_0038792 Ga0439435_0038792_703_1233 174
245 3300042438 Ga0439459_0108058 Ga0439459_0108058_112_657 174
246 3300042439 Ga0439464_0002825 Ga0439464_0002825_3482_4012 174
247 3300042532 Ga0450893_0008810 Ga0450893_0008810_336_866 174
248 3300042876 Ga0451577_0075418 Ga0451577_0075418_2144_2674 174
249 3300042876 Ga0451577_0288468 Ga0451577_0288468_425_973 174
250 3300044673 Ga0453683_0011110 Ga0453683_0011110_625_1176 174
251 3300044693 Ga0466961_0040108 Ga0466961_0040108_311_841 174
252 3300044694 Ga0466963_0440546 Ga0466963_0440546_172_702 174
253 3300044712 Ga0453684_0551768 Ga0453684_0551768_514_1044 174
254 3300044765 Ga0466970_0144467 Ga0466970_0144467_467_997 174
255 3300044842 Ga0466957_0417086 Ga0466957_0417086_296_826 174
256 3300044842 Ga0466957_0436422 Ga0466957_0436422_40_570 174
257 3300045049 Ga0466959_0378343 Ga0466959_0378343_352_882 174
258 3300045051 Ga0451576_0004699 Ga0451576_0004699_633_1184 174
259 3300045051 Ga0451576_0431708 Ga0451576_0431708_557_1087 174
260 3300045976 Ga0466967_1281232 Ga0466967_1281232_108_638 174
261 3300045976 Ga0466967_1382703 Ga0466967_1382703_158_688 174
262 3300046512 Ga0495610_0150418 Ga0495610_0150418_156_689 174
263 3300046519 Ga0495632_0000930 Ga0495632_0000930_22174_22707 174
264 3300046528 Ga0495642_0043824 Ga0495642_0043824_620_1150 174
265 3300046539 Ga0495621_0180497 Ga0495621_0180497_174_704 174
266 3300046558 Ga0495633_0053093 Ga0495633_0053093_261_791 174
267 3300046615 Ga0495656_0011889 Ga0495656_0011889_2291_2821 174
268 3300046615 Ga0495656_0031596 Ga0495656_0031596_216_746 174
269 3300046674 Ga0495588_0031589 Ga0495588_0031589_1771_2301 174
270 3300047318 Ga0495636_0045924 Ga0495636_0045924_1119_1649 174
271 3300047445 Ga0495677_0010653 Ga0495677_0010653_260_790 174
272 3300047470 Ga0495681_0053233 Ga0495681_0053233_1016_1546 174
273 3300048090 Ga0495615_0006938 Ga0495615_0006938_717_1247 174
274 3300048909 Ga0496106_0166396 Ga0496106_0166396_950_1486 174
275 3300048910 Ga0496107_0242468 Ga0496107_0242468_728_1258 174
276 3300048917 Ga0496114_0721968 Ga0496114_0721968_51_581 174
277 3300048919 Ga0496116_0218661 Ga0496116_0218661_142_672 174
278 3300048920 Ga0496117_0375504 Ga0496117_0375504_129_659 174
279 3300048924 Ga0496121_0007574 Ga0496121_0007574_12041_12574 174
280 3300048925 Ga0496122_0002564 Ga0496122_0002564_842_1372 174
281 3300048926 Ga0496123_0056087 Ga0496123_0056087_1095_1625 174
282 3300048927 Ga0496124_0349786 Ga0496124_0349786_41_565 174
283 3300048927 Ga0496124_0706353 Ga0496124_0706353_31_564 174
284 3300048929 Ga0496126_0498324 Ga0496126_0498324_283_813 174
285 3300049127 Ga0501306_010645 Ga0501306_010645_41_571 174
286 3300049127 Ga0501306_027101 Ga0501306_027101_74_604 174
287 3300049127 Ga0501306_044839 Ga0501306_044839_69_599 174
288 3300049128 Ga0501308_011355 Ga0501308_011355_404_934 174
289 3300049128 Ga0501308_015564 Ga0501308_015564_271_801 174
290 3300049129 Ga0501309_035354 Ga0501309_035354_127_657 174
291 3300049130 Ga0501310_004595 Ga0501310_004595_769_1299 174
292 3300049130 Ga0501310_021954 Ga0501310_021954_205_735 174
293 3300049160 Ga0501304_001056 Ga0501304_001056_422_952 174
294 3300049161 Ga0501305_034290 Ga0501305_034290_191_721 174
295 3300049161 Ga0501305_041997 Ga0501305_041997_160_690 174
296 3300049161 Ga0501305_062855 Ga0501305_062855_82_612 174
297 3300049162 Ga0501307_012871 Ga0501307_012871_443_973 174
298 3300049162 Ga0501307_023552 Ga0501307_023552_126_656 174
299 3300049162 Ga0501307_037201 Ga0501307_037201_76_606 174
300 3300049527 Ga0501311_003705 Ga0501311_003705_1020_1550 174
301 3300049527 Ga0501311_006685 Ga0501311_006685_256_786 174
302 3300049527 Ga0501311_039349 Ga0501311_039349_36_566 174
303 3300049528 Ga0501312_009347 Ga0501312_009347_479_1009 174
304 3300049528 Ga0501312_067599 Ga0501312_067599_49_579 174
305 3300049529 Ga0501313_007388 Ga0501313_007388_506_1036 174
306 3300049529 Ga0501313_028575 Ga0501313_028575_94_624 174
307 3300049529 Ga0501313_044691 Ga0501313_044691_14_544 174
308 3300049530 Ga0501314_016732 Ga0501314_016732_83_613 174
309 3300049531 Ga0501315_007534 Ga0501315_007534_512_1045 174
310 3300049531 Ga0501315_020756 Ga0501315_020756_191_721 174
311 3300049531 Ga0501315_023730 Ga0501315_023730_92_622 174
312 3300049531 Ga0501315_039376 Ga0501315_039376_99_629 174
313 3300049531 Ga0501315_074949 Ga0501315_074949_15_545 174
314 3300049532 Ga0501316_006481 Ga0501316_006481_126_656 174
315 3300049532 Ga0501316_013842 Ga0501316_013842_398_928 174
316 3300049532 Ga0501316_016670 Ga0501316_016670_200_730 174
317 3300049532 Ga0501316_018190 Ga0501316_018190_179_709 174
318 3300049533 Ga0501317_028634 Ga0501317_028634_92_622 174
319 3300049534 Ga0501318_007829 Ga0501318_007829_575_1105 174
320 3300049534 Ga0501318_026636 Ga0501318_026636_142_672 174
321 3300049535 Ga0501319_000958 Ga0501319_000958_950_1480 174
322 3300049536 Ga0501320_001200 Ga0501320_001200_713_1243 174
323 3300049536 Ga0501320_016759 Ga0501320_016759_111_641 174
324 3300049536 Ga0501320_025790 Ga0501320_025790_103_633 174
325 3300049537 Ga0501321_011198 Ga0501321_011198_356_886 174
326 3300049537 Ga0501321_030261 Ga0501321_030261_98_628 174
327 3300049539 Ga0501323_007001 Ga0501323_007001_77_607 174
328 3300049539 Ga0501323_028205 Ga0501323_028205_155_685 174
329 3300049539 Ga0501323_035144 Ga0501323_035144_65_595 174
330 3300049539 Ga0501323_040083 Ga0501323_040083_96_626 174
331 3300049541 Ga0501325_023328 Ga0501325_023328_67_597 174
332 3300049556 Ga0501340_007748 Ga0501340_007748_41_571 174
333 3300049570 Ga0501033_0135737 Ga0501033_0135737_778_1308 174
334 3300049572 Ga0501036_0446333 Ga0501036_0446333_252_782 174
335 3300049573 Ga0501037_0052511 Ga0501037_0052511_2090_2620 174
336 3300049574 Ga0501038_0476315 Ga0501038_0476315_242_772 174
337 3300049581 Ga0501047_0579099 Ga0501047_0579099_256_786 174
338 3300049663 Ga0501223_025776 Ga0501223_025776_255_785 174
339 3300049679 Ga0501249_010981 Ga0501249_010981_686_1216 174
340 3300049759 Ga0501262_000368 Ga0501262_000368_3854_4384 174
341 3300049776 Ga0501280_032423 Ga0501280_032423_171_701 174
342 3300049822 Ga0501035_0109585 Ga0501035_0109585_1728_2258 174
343 3300049823 Ga0501044_0318057 Ga0501044_0318057_655_1185 174
344 3300049823 Ga0501044_0420999 Ga0501044_0420999_682_1212 174
345 3300050489 nmdc:mga03683_47668_c1 nmdc:mga03683_47668_c1_610_1140 174
346 3300050492 nmdc:mga0yw44_442719_c1 nmdc:mga0yw44_442719_c1_82_612 174
347 3300050493 nmdc:mga0k408_293526_c1 nmdc:mga0k408_293526_c1_223_759 174
348 3300050493 nmdc:mga0k408_327659_c1 nmdc:mga0k408_327659_c1_369_899 174
349 3300050493 nmdc:mga0k408_86968_c1 nmdc:mga0k408_86968_c1_620_1150 174
350 3300050496 nmdc:mga07m45_261450_c1 nmdc:mga07m45_261450_c1_134_664 174
351 3300050496 nmdc:mga07m45_464132_c1 nmdc:mga07m45_464132_c1_37_567 174
352 3300050508 nmdc:mga09592_677631_c1 nmdc:mga09592_677631_c1_63_593 174
353 3300053080 Ga0500635_0224096 Ga0500635_0224096_75_605 174
354 3300053090 Ga0500646_0053152 Ga0500646_0053152_45_575 174
355 3300053092 Ga0500583_0249981 Ga0500583_0249981_31_564 174
356 3300053093 Ga0500651_0016966 Ga0500651_0016966_2010_2543 174
357 3300053098 Ga0500650_0174673 Ga0500650_0174673_98_631 174
358 3300053103 Ga0500555_133369 Ga0500555_133369_15_548 174
359 3300053108 Ga0500562_015123 Ga0500562_015123_311_841 174
360 3300053109 Ga0500569_016154 Ga0500569_016154_796_1329 174
361 3300053129 Ga0500628_011615 Ga0500628_011615_609_1142 174
362 3300053131 Ga0500652_000132 Ga0500652_000132_19095_19628 174
363 3300053134 Ga0500658_0142555 Ga0500658_0142555_217_750 174
364 3300053139 Ga0500568_0004545 Ga0500568_0004545_4159_4695 174
365 3300053139 Ga0500568_0038930 Ga0500568_0038930_714_1247 174
366 3300053139 Ga0500568_0193465 Ga0500568_0193465_100_630 174
367 3300053146 Ga0500588_0180939 Ga0500588_0180939_192_725 174
368 3300053153 Ga0500616_0013271 Ga0500616_0013271_67_597 174
369 3300053156 Ga0500622_0028869 Ga0500622_0028869_681_1214 174
370 3300059423 Ga0590074_012377 Ga0590074_012377_548_1078 174
371 3300059653 Ga0587108_006845 Ga0587108_006845_146_676 174
372 3300060353 Ga0501082_0689785 Ga0501082_0689785_122_652 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

7

181

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bxo-assembly1.cif.gz_A crystal structure of the toxin-antitoxin with amp-pnp 0.8434 103 138
6m6v-assembly1.cif.gz_A crystal structure the toxin-antitoxin mnta-hept 0.8394 102 138
1abv-assembly1.cif.gz_A n-terminal domain of the delta subunit of the f1f0-atp synthase from escherichia coli, nmr, minimized average structure 0.8374 5 101
7aer-assembly1.cif.gz_A rebuilt and re-refined pdb entry 5yep: tri-ampylated shewanella oneidensis hepn toxin in complex with mnt antitoxin 0.8134 105 138
6m6u-assembly1.cif.gz_A crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.8121 105 138
ID Description Score Start End Superfamily
af_Q2FWE7_104_179_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9121 103 172 3.30.2320.30
af_Q84R40_123_196_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9022 103 170 3.30.2320.30
af_Q58612_4_86_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8862 105 139 3.30.460.10
af_I1MUQ0_165_253_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8453 96 172 3.30.2320.30
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8413 105 174 3.30.2320.30
ID Description Score Start End GO Terms
AF-A0A0G1WAR4-F1-model_v4 Uncharacterized protein 0.9167 103 171 GO:0016020
GO:0046933
AF-A0A3D2YG70-F1-model_v4 F0F1 ATP synthase subunit alpha 0.8922 103 173 GO:0005524
GO:0043531
GO:0045261
GO:0046933
AF-A0A7V9V6W5-F1-model_v4 F0F1 ATP synthase subunit delta 0.8866 103 171 GO:0016020
GO:0046933
AF-A0A0G1NZ85-F1-model_v4 ATP synthase subunit delta 0.8854 105 171 GO:0016020
GO:0046933
AF-A0A5A4W9L2-F1-model_v4 deleted 0.8817 102 170

Feature Viewer

pLDDT pTM Quality
80.29 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map