metagRoot

F425671

General Info

Members	Datasets	Scaffolds	Average Seq Length
371	234	371	181

Family's Representative Sequence

Representative Sequence	3300005543\|Ga0070672_100474131\|Ga0070672_1004741312
Length	207
Sequence	VAKPPDLKMIFRETALKGAFVIEPELKEDERGFFARAWCQRELAAHGLNPNVVQANLSYNRHRHTLRGMHYQKPPNEETKLVRCIRGAIYDVIVDLRAGSPTYRQWVGVTLSAENRHMIYVPEGFAHGFQTLEDDSELFYLMTEFYTPGAETGARWDDPAFGIRWPEAGTRIISDRDRNWPLLEPTPRQAMQGGTDNVGSGKLQAKG

Samples

	Sample ID	Description	Type	Environment
1	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
2	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
3	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
4	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
5	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
6	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
7	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
8	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
9	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
10	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
11	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
15	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
22	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
25	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
26	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
27	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
28	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
33	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
34	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
39	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
40	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
44	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
45	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
46	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
47	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
48	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
49	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
50	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
51	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
52	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
53	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
54	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
55	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
56	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
59	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
60	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
61	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
62	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
65	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
66	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
69	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
70	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
71	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
72	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
73	3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Metagenome	Rhizosphere
74	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
75	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
76	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
77	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
78	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
79	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
80	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
81	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
82	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
83	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
84	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
85	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
86	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
87	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
88	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
89	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
90	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
91	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
131	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
132	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
135	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
136	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
137	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
138	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
139	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
140	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
141	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
142	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
143	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
144	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
145	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
146	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
147	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
148	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
149	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
150	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
151	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
152	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
153	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
154	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
155	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
156	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
157	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
158	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
159	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
160	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
161	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
162	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
163	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
164	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
165	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
166	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
167	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
168	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
169	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
170	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
171	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
172	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
173	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
174	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
175	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
176	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
177	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
178	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
179	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
180	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
181	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
182	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
183	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
184	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
185	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
186	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
188	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
189	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
190	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
191	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
192	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
194	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
195	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
197	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
198	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
199	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
200	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
201	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
202	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
203	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
204	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
205	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
206	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
207	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
208	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
209	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
210	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
211	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
212	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
215	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
216	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
217	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
218	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
219	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
220	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
221	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
222	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
223	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
224	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
225	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
226	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
227	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
228	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
229	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
230	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
231	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
232	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
233	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
234	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.92
Metatranscriptomes	1.08
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.74
Nodule	0
Rhizoplane	1.08
Rhizosphere	88.68
Stem	0
Stem Tuber	0
Unclassified	3.5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10002553	3300001989	Bacteria	7023
2	JGI24033J26618_1005775	3300002155	Bacteria	1374
3	JGI25153J46596_10012342	3300003215	Bacteria	3697
4	rootH2_10001886	3300003320	Bacteria	115156
5	rootH2_10091878	3300003320	Unclassified	1136
6	rootH2_10181079	3300003320	Bacteria	1063
7	JGI25160J50197_1002152	3300003354	Bacteria	9325
8	Ga0055528_1001633	3300003790	Bacteria	13218
9	Ga0055528_1001646	3300003790	Bacteria	13151
10	Ga0055530_10003030	3300003791	Bacteria	10044
11	Ga0055531_10044070	3300003794	Bacteria	1255
12	Ga0065165_1000056	3300005262	Bacteria	186730
13	Ga0065712_10069472	3300005290	Bacteria	7215
14	Ga0065707_10018763	3300005295	Bacteria	2087
15	Ga0070670_100021623	3300005331	Bacteria	5532
16	Ga0070670_100078762	3300005331	Bacteria	2831
17	Ga0068869_100104670	3300005334	Unclassified	2145
18	Ga0070680_100414527	3300005336	Unclassified	1149
19	Ga0070682_100081319	3300005337	Bacteria	2097
20	Ga0070682_100587331	3300005337	Unclassified	877
21	Ga0070689_100148234	3300005340	Bacteria	1891
22	Ga0070668_100128576	3300005347	Unclassified	2031
23	Ga0070675_100071572	3300005354	Unclassified	2877
24	Ga0070675_100074553	3300005354	Bacteria	2819
25	Ga0070688_100177383	3300005365	Unclassified	1475
26	Ga0070667_100151254	3300005367	Bacteria	2039
27	Ga0070703_10058269	3300005406	Unclassified	1256
28	Ga0070714_100423682	3300005435	Unclassified	1261
29	Ga0070714_100769146	3300005435	Bacteria	931
30	Ga0070713_100031757	3300005436	Unclassified	4209
31	Ga0070713_100054734	3300005436	Bacteria	3312
32	Ga0070710_10225706	3300005437	Bacteria	1194
33	Ga0070711_100190808	3300005439	Bacteria	1575
34	Ga0070711_100594066	3300005439	Unclassified	923
35	Ga0070700_100325785	3300005441	Unclassified	1130
36	Ga0070694_100023118	3300005444	Bacteria	3993
37	Ga0070694_100129827	3300005444	Bacteria	1819
38	Ga0070708_100008880	3300005445	Bacteria	8090
39	Ga0070708_100063197	3300005445	Bacteria	3313
40	Ga0070678_101039216	3300005456	Bacteria	754
41	Ga0070681_10004534	3300005458	Bacteria	13259
42	Ga0070681_10235977	3300005458	Bacteria	1743
43	Ga0070681_10447215	3300005458	Unclassified	1204
44	Ga0068867_100254401	3300005459	Unclassified	1429
45	Ga0070706_100036726	3300005467	Bacteria	4525
46	Ga0070706_100109736	3300005467	Bacteria	2567
47	Ga0070706_100290131	3300005467	Bacteria	1527
48	Ga0070707_100002643	3300005468	Bacteria	17042
49	Ga0070707_100163482	3300005468	Bacteria	2169
50	Ga0070698_100004148	3300005471	Bacteria	15936
51	Ga0070698_100062992	3300005471	Bacteria	3740
52	Ga0070698_100137092	3300005471	Bacteria	2401
53	Ga0070699_100021652	3300005518	Bacteria	5544
54	Ga0070699_100042368	3300005518	Bacteria	3940
55	Ga0070699_100444109	3300005518	Bacteria	1176
56	Ga0070679_100089847	3300005530	Bacteria	3059
57	Ga0070679_100290833	3300005530	Bacteria	1585
58	Ga0070684_100676813	3300005535	Unclassified	961
59	Ga0070684_101469088	3300005535	Unclassified	642
60	Ga0070697_100009909	3300005536	Bacteria	7431
61	Ga0070697_100327491	3300005536	Bacteria	1320
62	Ga0068853_100015661	3300005539	Bacteria	6228
63	Ga0070672_100163169	3300005543	Bacteria	1850
64	Ga0070672_100474131	3300005543	Bacteria	1080
65	Ga0070695_100013633	3300005545	Bacteria	4885
66	Ga0070695_100016603	3300005545	Bacteria	4459
67	Ga0070695_100065604	3300005545	Bacteria	2365
68	Ga0070695_101454688	3300005545	Unclassified	569
69	Ga0070696_100003525	3300005546	Bacteria	10410
70	Ga0068857_100367011	3300005577	Bacteria	1335
71	Ga0068854_100368971	3300005578	Unclassified	1180
72	Ga0068852_100992448	3300005616	Unclassified	858
73	Ga0068858_100924609	3300005842	Bacteria	853
74	Ga0068862_100989545	3300005844	Unclassified	831
75	Ga0081455_10002146	3300005937	Bacteria	23521
76	Ga0081455_10092773	3300005937	Bacteria	2442
77	Ga0081455_10108831	3300005937	Bacteria	2206
78	Ga0081538_10008456	3300005981	Bacteria	8730
79	Ga0070717_10035209	3300006028	Unclassified	4051
80	Ga0070717_10655087	3300006028	Bacteria	953
81	Ga0075365_10000255	3300006038	Bacteria	18257
82	Ga0075364_10011139	3300006051	Bacteria	5459
83	Ga0075366_10126295	3300006195	Bacteria	1543
84	Ga0068871_100088173	3300006358	Bacteria	2581
85	Ga0075428_100026535	3300006844	Bacteria	6412
86	Ga0075428_100226506	3300006844	Bacteria	2018
87	Ga0075430_100000065	3300006846	Bacteria	56889
88	Ga0075430_100074047	3300006846	Bacteria	2855
89	Ga0075430_100517653	3300006846	Unclassified	984
90	Ga0075430_100554737	3300006846	Unclassified	948
91	Ga0075430_100879267	3300006846	Bacteria	738
92	Ga0075431_100000849	3300006847	Bacteria	26798
93	Ga0075431_100504871	3300006847	Bacteria	1200
94	Ga0075431_101238226	3300006847	Unclassified	708
95	Ga0075433_10022691	3300006852	Bacteria	5272
96	Ga0075433_10303466	3300006852	Bacteria	1414
97	Ga0075434_100049728	3300006871	Bacteria	4163
98	Ga0075434_100643812	3300006871	Bacteria	1078
99	Ga0075434_100781178	3300006871	Bacteria	971
100	Ga0075429_100020092	3300006880	Bacteria	5791
101	Ga0075429_100339385	3300006880	Bacteria	1315
102	Ga0075429_100438628	3300006880	Bacteria	1144
103	Ga0068865_100462807	3300006881	Bacteria	1051
104	Ga0075436_100071945	3300006914	Bacteria	2392
105	Ga0075435_100249977	3300007076	Bacteria	1509
106	Ga0075435_100661715	3300007076	Bacteria	907
107	Ga0099794_10000292	3300007265	Bacteria	17246
108	Ga0099794_10001481	3300007265	Bacteria	8215
109	Ga0105240_10003974	3300009093	Bacteria	22818
110	Ga0111539_10028181	3300009094	Bacteria	6856
111	Ga0111539_10081170	3300009094	Bacteria	3814
112	Ga0111539_10088793	3300009094	Bacteria	3632
113	Ga0111539_10332100	3300009094	Bacteria	1770
114	Ga0111539_10718707	3300009094	Bacteria	1163
115	Ga0114129_10009073	3300009147	Bacteria	14174
116	Ga0114129_10215012	3300009147	Bacteria	2596
117	Ga0114129_10867355	3300009147	Bacteria	1146
118	Ga0114129_11002215	3300009147	Unclassified	1052
119	Ga0114129_12107431	3300009147	Bacteria	680
120	Ga0105242_10014857	3300009176	Bacteria	6032
121	Ga0105237_10004265	3300009545	Bacteria	16621
122	Ga0105237_10384468	3300009545	Unclassified	1408
123	Ga0105238_10056297	3300009551	Bacteria	3946
124	Ga0105238_10460539	3300009551	Bacteria	1269
125	Ga0105249_10251780	3300009553	Unclassified	1751
126	Ga0105249_10790884	3300009553	Bacteria	1012
127	Ga0105249_11850383	3300009553	Unclassified	676
128	Ga0105246_10398816	3300011119	Bacteria	1142
129	Ga0105246_11066369	3300011119	Bacteria	736
130	Ga0157323_1019909	3300012495	Bacteria	629
131	Ga0157373_10330279	3300013100	Unclassified	1086
132	Ga0157371_10054183	3300013102	Bacteria	2849
133	Ga0157370_10012492	3300013104	Bacteria	8802
134	Ga0157370_10233604	3300013104	Bacteria	1702
135	Ga0157369_10000744	3300013105	Bacteria	42014
136	Ga0157369_10203030	3300013105	Bacteria	2080
137	Ga0157378_10021140	3300013297	Bacteria	5724
138	Ga0157378_10157638	3300013297	Unclassified	2120
139	Ga0157378_11171385	3300013297	Bacteria	807
140	Ga0157378_11771802	3300013297	Unclassified	665
141	Ga0163162_10006177	3300013306	Bacteria	11607
142	Ga0157372_10028175	3300013307	Bacteria	6129
143	Ga0157372_10137419	3300013307	Bacteria	2815
144	Ga0157372_11128362	3300013307	Bacteria	907
145	Ga0157375_10202145	3300013308	Bacteria	2143
146	Ga0157375_10431301	3300013308	Unclassified	1484
147	Ga0157380_10000314	3300014326	Bacteria	29344
148	Ga0157380_10018891	3300014326	Bacteria	5127
149	Ga0157380_10025694	3300014326	Bacteria	4468
150	Ga0157380_10050863	3300014326	Bacteria	3274
151	Ga0157380_10130729	3300014326	Unclassified	2141
152	Ga0157377_10169683	3300014745	Bacteria	1364
153	Ga0157376_10833335	3300014969	Bacteria	937
154	Ga0197907_11008217	3300020069	Bacteria	5485
155	Ga0206355_1578354	3300020076	Bacteria	1288
156	Ga0213872_10004710	3300021361	Bacteria	7165
157	Ga0213876_10171897	3300021384	Bacteria	1153
158	Ga0209673_1000130	3300025273	Bacteria	163870
159	Ga0209564_1002706	3300025295	Bacteria	13383
160	Ga0209564_1003430	3300025295	Bacteria	10866
161	Ga0209758_1002696	3300025297	Bacteria	17505
162	Ga0209050_1000427	3300025298	Bacteria	77517
163	Ga0207426_1003025	3300025302	Bacteria	9737
164	Ga0207426_1024659	3300025302	Bacteria	2038
165	Ga0209051_1037597	3300025303	Bacteria	1773
166	Ga0209257_1010371	3300025304	Unclassified	4731
167	Ga0207653_10087815	3300025885	Bacteria	1085
168	Ga0207682_10277636	3300025893	Unclassified	783
169	Ga0207692_10033732	3300025898	Unclassified	2473
170	Ga0207643_10203480	3300025908	Unclassified	1206
171	Ga0207705_10081149	3300025909	Bacteria	2364
172	Ga0207684_10034064	3300025910	Bacteria	4329
173	Ga0207684_10035364	3300025910	Unclassified	4242
174	Ga0207684_10331204	3300025910	Bacteria	1312
175	Ga0207707_10029895	3300025912	Unclassified	4764
176	Ga0207707_10074718	3300025912	Bacteria	2956
177	Ga0207695_10012403	3300025913	Bacteria	10235
178	Ga0207671_10049663	3300025914	Bacteria	3106
179	Ga0207693_10018655	3300025915	Bacteria	5522
180	Ga0207693_10185967	3300025915	Bacteria	1635
181	Ga0207660_10282465	3300025917	Bacteria	1318
182	Ga0207652_10046972	3300025921	Bacteria	3687
183	Ga0207652_10435132	3300025921	Bacteria	1183
184	Ga0207646_10041057	3300025922	Bacteria	4161
185	Ga0207646_10678311	3300025922	Unclassified	922
186	Ga0207646_10966514	3300025922	Bacteria	754
187	Ga0207694_10202147	3300025924	Bacteria	1617
188	Ga0207650_10071216	3300025925	Bacteria	2615
189	Ga0207659_10065221	3300025926	Bacteria	2638
190	Ga0207700_10007846	3300025928	Bacteria	6563
191	Ga0207700_10011222	3300025928	Bacteria	5704
192	Ga0207700_10370598	3300025928	Bacteria	1250
193	Ga0207664_10227807	3300025929	Bacteria	1619
194	Ga0207664_10477018	3300025929	Bacteria	1115
195	Ga0207664_10845636	3300025929	Unclassified	822
196	Ga0207644_10258678	3300025931	Bacteria	1391
197	Ga0207690_10696821	3300025932	Bacteria	835
198	Ga0207686_10039512	3300025934	Bacteria	2863
199	Ga0207670_10321347	3300025936	Bacteria	1218
200	Ga0207704_10663784	3300025938	Unclassified	860
201	Ga0207691_10310930	3300025940	Bacteria	1352
202	Ga0207691_10556415	3300025940	Unclassified	972
203	Ga0207689_10084615	3300025942	Unclassified	2607
204	Ga0207712_10339726	3300025961	Archaea	1245
205	Ga0207712_10384561	3300025961	Unclassified	1175
206	Ga0207668_10181936	3300025972	Unclassified	1659
207	Ga0207703_10781904	3300026035	Bacteria	911
208	Ga0207639_10046656	3300026041	Bacteria	3270
209	Ga0207641_10213002	3300026088	Bacteria	1788
210	Ga0207648_10034657	3300026089	Unclassified	4449
211	Ga0207648_10768927	3300026089	Bacteria	895
212	Ga0207674_10355758	3300026116	Bacteria	1416
213	Ga0207698_10900899	3300026142	Unclassified	892
214	Ga0209588_1001847	3300027671	Bacteria	5646
215	Ga0209588_1013160	3300027671	Bacteria	2520
216	Ga0207428_10057763	3300027907	Bacteria	3080
217	Ga0207428_10130572	3300027907	Unclassified	1922
218	Ga0265357_1005918	3300028023	Unclassified	1145
219	Ga0268266_10335504	3300028379	Unclassified	1418
220	Ga0268265_10663063	3300028380	Bacteria	1004
221	Ga0265319_1000822	3300028563	Bacteria	19798
222	Ga0265323_10191698	3300028653	Bacteria	645
223	Ga0265338_10015618	3300028800	Bacteria	8321
224	Ga0265338_10436120	3300028800	Bacteria	929
225	Ga0265320_10004192	3300031240	Bacteria	9473
226	Ga0265325_10000842	3300031241	Bacteria	22229
227	Ga0265339_10003997	3300031249	Bacteria	10192
228	Ga0265331_10000792	3300031250	Bacteria	26282
229	Ga0265316_10075446	3300031344	Bacteria	2593
230	Ga0265313_10001268	3300031595	Bacteria	23991
231	Ga0265314_10000078	3300031711	Bacteria	145069
232	Ga0265314_10085762	3300031711	Unclassified	2064
233	Ga0265342_10008213	3300031712	Bacteria	7520
234	Ga0307405_10511858	3300031731	Bacteria	964
235	Ga0307406_10090484	3300031901	Bacteria	2059
236	Ga0307406_10275361	3300031901	Bacteria	1281
237	Ga0307415_100508425	3300032126	Bacteria	1055
238	Ga0316583_10049493	3300032133	Unclassified	1480
239	Ga0316593_10006768	3300032168	Bacteria	3115
240	Ga0316593_10216642	3300032168	Unclassified	710
241	Ga0373954_0338522	3300035118	Unclassified	743
242	Ga0373942_0132410	3300035207	Unclassified	788
243	Ga0373927_0167477	3300035695	Bacteria	1440
244	Ga0373947_0821134	3300035725	Unclassified	635
245	Ga0316582_0025709	3300036647	Unclassified	3538
246	Ga0316582_0179525	3300036647	Bacteria	1440
247	Ga0316584_0953723	3300036712	Bacteria	575
248	Ga0400490_09372	3300038726	Bacteria	14741
249	Ga0400490_28656	3300038726	Bacteria	9927
250	Ga0400483_117460	3300039062	Bacteria	1831
251	Ga0400483_234344	3300039062	Bacteria	3636
252	Ga0400489_86832	3300039093	Bacteria	38193
253	Ga0436365_0930066	3300039437	Bacteria	1230
254	Ga0436365_1485815	3300039437	Bacteria	971
255	Ga0436361_1126806	3300039447	Bacteria	2514
256	Ga0436363_0149102	3300039450	Bacteria	2839
257	Ga0451797_0845075	3300041453	Unclassified	977
258	Ga0451837_1554724	3300041494	Bacteria	1149
259	Ga0451577_0222624	3300042876	Bacteria	1706
260	Ga0453683_0038240	3300044673	Bacteria	3017
261	Ga0453683_0052505	3300044673	Bacteria	2552
262	Ga0453684_0250217	3300044712	Bacteria	2035
263	Ga0453684_1350427	3300044712	Bacteria	741
264	Ga0466971_0043085	3300044719	Bacteria	2028
265	Ga0466959_0001548	3300045049	Bacteria	14146
266	Ga0451576_0003225	3300045051	Bacteria	22720
267	Ga0451576_0004797	3300045051	Bacteria	17330
268	Ga0451576_0453869	3300045051	Bacteria	1346
269	Ga0466958_0225780	3300045836	Bacteria	1195
270	Ga0495603_0098219	3300046455	Bacteria	1710
271	Ga0495629_0343283	3300046459	Bacteria	1019
272	Ga0495651_0199202	3300046462	Bacteria	1403
273	Ga0495580_0031187	3300046472	Bacteria	3855
274	Ga0495664_0279891	3300046477	Unclassified	1008
275	Ga0495622_0108502	3300046557	Bacteria	1271
276	Ga0495611_0000057	3300046648	Bacteria	80239
277	Ga0495649_0063550	3300046694	Bacteria	1983
278	Ga0495672_0022419	3300047320	Bacteria	4105
279	Ga0496105_0670822	3300048908	Bacteria	798
280	Ga0496112_0209468	3300048915	Bacteria	1907
281	Ga0496112_0262915	3300048915	Bacteria	1675
282	Ga0501292_030973	3300049515	Unclassified	899
283	Ga0501031_0032414	3300049568	Bacteria	3407
284	Ga0501032_0036179	3300049569	Bacteria	3372
285	Ga0501032_0170380	3300049569	Bacteria	1428
286	Ga0501033_0321994	3300049570	Bacteria	1086
287	Ga0501034_0662713	3300049571	Bacteria	944
288	Ga0501036_0129456	3300049572	Bacteria	2131
289	Ga0501038_0004862	3300049574	Bacteria	12484
290	Ga0501039_0156672	3300049575	Bacteria	1789
291	Ga0501039_0434656	3300049575	Bacteria	1031
292	Ga0501040_0007699	3300049576	Bacteria	6969
293	Ga0501040_0442041	3300049576	Bacteria	936
294	Ga0501041_0000920	3300049577	Bacteria	15948
295	Ga0501041_0034305	3300049577	Bacteria	3072
296	Ga0501041_0479300	3300049577	Unclassified	791
297	Ga0501042_0001626	3300049578	Bacteria	13368
298	Ga0501043_0156415	3300049579	Bacteria	1783
299	Ga0501043_0242650	3300049579	Bacteria	1389
300	Ga0501047_0092154	3300049581	Bacteria	2909
301	Ga0501047_0108279	3300049581	Bacteria	2661
302	Ga0501048_0003386	3300049582	Bacteria	12119
303	Ga0501048_0077031	3300049582	Bacteria	2354
304	Ga0501070_0045246	3300049586	Bacteria	3661
305	Ga0501070_0102977	3300049586	Bacteria	2361
306	Ga0501071_0003254	3300049587	Bacteria	10131
307	Ga0501072_0000756	3300049588	Bacteria	23584
308	Ga0501073_0206304	3300049589	Bacteria	1358
309	Ga0501073_0250327	3300049589	Bacteria	1223
310	Ga0501074_0447129	3300049590	Bacteria	916
311	Ga0501075_0000100	3300049591	Bacteria	39814
312	Ga0501075_0225400	3300049591	Bacteria	1430
313	Ga0501075_0297142	3300049591	Unclassified	1230
314	Ga0501076_0062735	3300049592	Bacteria	2960
315	Ga0501076_0680594	3300049592	Bacteria	849
316	Ga0501077_0001718	3300049593	Bacteria	13213
317	Ga0501077_0031445	3300049593	Bacteria	3377
318	Ga0501223_010588	3300049663	Unclassified	1853
319	Ga0501233_088458	3300049668	Unclassified	806
320	Ga0501225_0198810	3300049705	Unclassified	635
321	Ga0501079_0007346	3300049741	Bacteria	8330
322	Ga0501079_0723095	3300049741	Bacteria	784
323	Ga0501080_0001073	3300049742	Bacteria	22507
324	Ga0501081_0217875	3300049743	Bacteria	1388
325	Ga0501081_0810742	3300049743	Unclassified	705
326	Ga0501083_0058061	3300049744	Bacteria	2590
327	Ga0501035_0062725	3300049822	Bacteria	3307
328	Ga0501035_0714640	3300049822	Unclassified	807
329	Ga0501044_0081356	3300049823	Bacteria	3279
330	Ga0501044_0340165	3300049823	Bacteria	1422
331	Ga0501044_0423070	3300049823	Bacteria	1242
332	Ga0501044_0580976	3300049823	Bacteria	1015
333	Ga0501045_0000694	3300049824	Bacteria	21409
334	nmdc:mga00v17_8730_c1	3300050491	Bacteria	5458
335	nmdc:mga0yw44_104_c1	3300050492	Bacteria	29373
336	nmdc:mga0k408_19233_c1	3300050493	Bacteria	3814
337	nmdc:mga05p37_14108_c1	3300050507	Bacteria	9589
338	nmdc:mga05p37_370252_c1	3300050507	Unclassified	1682
339	nmdc:mga05p37_384810_c1	3300050507	Bacteria	1643
340	nmdc:mga05p37_570139_c1	3300050507	Bacteria	1284
341	nmdc:mga09592_329908_c1	3300050508	Bacteria	910
342	nmdc:mga09592_35351_c1	3300050508	Bacteria	4183
343	nmdc:mga0qj67_583307_c1	3300050509	Unclassified	895
344	nmdc:mga0qj67_766215_c1	3300050509	Bacteria	765
345	nmdc:mga06r32_1024607_c1	3300050510	Unclassified	777
346	nmdc:mga06r32_345830_c1	3300050510	Bacteria	1472
347	nmdc:mga06r32_37688_c1	3300050510	Bacteria	4574
348	nmdc:mga08y16_1002943_c1	3300050511	Bacteria	815
349	nmdc:mga08y16_137210_c1	3300050511	Bacteria	2543
350	nmdc:mga08y16_18932_c1	3300050511	Bacteria	7250
351	nmdc:mga08y16_389518_c1	3300050511	Bacteria	1428
352	nmdc:mga0n895_4107_c1	3300050512	Bacteria	11858
353	nmdc:mga0n895_779086_c1	3300050512	Bacteria	948
354	nmdc:mga0n895_897983_c1	3300050512	Bacteria	872
355	nmdc:mga0rr50_15549_c1	3300050513	Bacteria	5026
356	nmdc:mga08x19_28441_c1	3300050514	Bacteria	3501
357	nmdc:mga0a205_209680_c1	3300050515	Bacteria	1837
358	nmdc:mga0a205_388224_c1	3300050515	Bacteria	1261
359	nmdc:mga0a205_41525_c1	3300050515	Bacteria	4430
360	Ga0495619_0475905	3300053085	Unclassified	860
361	Ga0500643_008637	3300053087	Bacteria	3986
362	Ga0500583_0000015	3300053092	Bacteria	147804
363	Ga0500559_0038254	3300053136	Bacteria	2083
364	Ga0501084_0000458	3300054114	Bacteria	31426
365	Ga0590077_040308	3300059426	Bacteria	1036
366	Ga0501082_0023609	3300060353	Bacteria	5304
367	Ga0501082_0268818	3300060353	Unclassified	1484
368	Ga0501082_1122831	3300060353	Unclassified	687
369	Ga0466962_0148466	3300061719	Bacteria	1137
370	Ga0530510_0000157	3300061734	Bacteria	40698
371	Ga0530510_0325653	3300061734	Bacteria	1152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035118	Ga0373954_0338522	Ga0373954_0338522_56_529	157
2	3300049591	Ga0501075_0225400	Ga0501075_0225400_924_1415	163
3	3300049705	Ga0501225_0198810	Ga0501225_0198810_24_563	165
4	3300009094	Ga0111539_10028181	Ga0111539_100281812	167
5	3300028800	Ga0265338_10436120	Ga0265338_104361202	167
6	3300049743	Ga0501081_0217875	Ga0501081_0217875_422_949	167
7	3300050511	nmdc:mga08y16_18932_c1	nmdc:mga08y16_18932_c1_6041_6556	167
8	3300005435	Ga0070714_100769146	Ga0070714_1007691461	169
9	3300005436	Ga0070713_100031757	Ga0070713_1000317575	169
10	3300025910	Ga0207684_10035364	Ga0207684_100353642	169
11	3300025929	Ga0207664_10227807	Ga0207664_102278072	169
12	3300049823	Ga0501044_0580976	Ga0501044_0580976_485_1003	172
13	3300028563	Ga0265319_1000822	Ga0265319_10008224	173
14	3300031240	Ga0265320_10004192	Ga0265320_100041924	173
15	3300041453	Ga0451797_0845075	Ga0451797_0845075_417_938	173
16	3300006038	Ga0075365_10000255	Ga0075365_100002555	174
17	3300006051	Ga0075364_10011139	Ga0075364_100111394	174
18	3300006195	Ga0075366_10126295	Ga0075366_101262952	174
19	3300049663	Ga0501223_010588	Ga0501223_010588_959_1486	174
20	3300050491	nmdc:mga00v17_8730_c1	nmdc:mga00v17_8730_c1_2125_2649	174
21	3300050492	nmdc:mga0yw44_104_c1	nmdc:mga0yw44_104_c1_3804_4328	174
22	3300050493	nmdc:mga0k408_19233_c1	nmdc:mga0k408_19233_c1_602_1126	174
23	3300005340	Ga0070689_100148234	Ga0070689_1001482342	175
24	3300006846	Ga0075430_100879267	Ga0075430_1008792671	175
25	3300007265	Ga0099794_10001481	Ga0099794_100014811	175
26	3300025922	Ga0207646_10678311	Ga0207646_106783112	175
27	3300036647	Ga0316582_0179525	Ga0316582_0179525_292_825	175
28	3300049571	Ga0501034_0662713	Ga0501034_0662713_201_728	175
29	3300049577	Ga0501041_0034305	Ga0501041_0034305_1429_1956	175
30	3300049579	Ga0501043_0156415	Ga0501043_0156415_367_894	175
31	3300049586	Ga0501070_0045246	Ga0501070_0045246_704_1231	175
32	3300050509	nmdc:mga0qj67_766215_c1	nmdc:mga0qj67_766215_c1_22_552	175
33	3300005354	Ga0070675_100071572	Ga0070675_1000715722	176
34	3300005406	Ga0070703_10058269	Ga0070703_100582692	176
35	3300005437	Ga0070710_10225706	Ga0070710_102257062	176
36	3300005439	Ga0070711_100190808	Ga0070711_1001908082	176
37	3300005445	Ga0070708_100063197	Ga0070708_1000631972	176
38	3300005467	Ga0070706_100109736	Ga0070706_1001097362	176
39	3300005467	Ga0070706_100290131	Ga0070706_1002901312	176
40	3300005471	Ga0070698_100062992	Ga0070698_1000629922	176
41	3300005471	Ga0070698_100137092	Ga0070698_1001370922	176
42	3300005518	Ga0070699_100021652	Ga0070699_1000216522	176
43	3300005536	Ga0070697_100327491	Ga0070697_1003274912	176
44	3300005545	Ga0070695_100016603	Ga0070695_1000166033	176
45	3300005545	Ga0070695_100065604	Ga0070695_1000656042	176
46	3300005545	Ga0070695_101454688	Ga0070695_1014546881	176
47	3300005578	Ga0068854_100368971	Ga0068854_1003689712	176
48	3300005842	Ga0068858_100924609	Ga0068858_1009246092	176
49	3300005937	Ga0081455_10002146	Ga0081455_1000214618	176
50	3300005981	Ga0081538_10008456	Ga0081538_100084562	176
51	3300006028	Ga0070717_10035209	Ga0070717_100352092	176
52	3300006358	Ga0068871_100088173	Ga0068871_1000881732	176
53	3300006844	Ga0075428_100026535	Ga0075428_1000265352	176
54	3300006846	Ga0075430_100554737	Ga0075430_1005547371	176
55	3300006847	Ga0075431_101238226	Ga0075431_1012382262	176
56	3300006871	Ga0075434_100049728	Ga0075434_1000497282	176
57	3300006880	Ga0075429_100020092	Ga0075429_1000200926	176
58	3300006880	Ga0075429_100438628	Ga0075429_1004386282	176
59	3300007076	Ga0075435_100249977	Ga0075435_1002499771	176
60	3300009094	Ga0111539_10088793	Ga0111539_100887932	176
61	3300009094	Ga0111539_10332100	Ga0111539_103321004	176
62	3300009147	Ga0114129_10867355	Ga0114129_108673551	176
63	3300009147	Ga0114129_11002215	Ga0114129_110022152	176
64	3300009553	Ga0105249_10790884	Ga0105249_107908842	176
65	3300009553	Ga0105249_11850383	Ga0105249_118503831	176
66	3300011119	Ga0105246_11066369	Ga0105246_110663692	176
67	3300013297	Ga0157378_10021140	Ga0157378_100211405	176
68	3300013297	Ga0157378_11171385	Ga0157378_111713852	176
69	3300013308	Ga0157375_10431301	Ga0157375_104313012	176
70	3300014326	Ga0157380_10025694	Ga0157380_100256942	176
71	3300014745	Ga0157377_10169683	Ga0157377_101696832	176
72	3300014969	Ga0157376_10833335	Ga0157376_108333352	176
73	3300025885	Ga0207653_10087815	Ga0207653_100878152	176
74	3300025898	Ga0207692_10033732	Ga0207692_100337322	176
75	3300025908	Ga0207643_10203480	Ga0207643_102034802	176
76	3300025909	Ga0207705_10081149	Ga0207705_100811492	176
77	3300025915	Ga0207693_10018655	Ga0207693_100186552	176
78	3300025915	Ga0207693_10185967	Ga0207693_101859672	176
79	3300025922	Ga0207646_10966514	Ga0207646_109665141	176
80	3300025928	Ga0207700_10011222	Ga0207700_100112223	176
81	3300025928	Ga0207700_10370598	Ga0207700_103705982	176
82	3300025929	Ga0207664_10477018	Ga0207664_104770182	176
83	3300025929	Ga0207664_10845636	Ga0207664_108456362	176
84	3300025932	Ga0207690_10696821	Ga0207690_106968212	176
85	3300025972	Ga0207668_10181936	Ga0207668_101819362	176
86	3300026035	Ga0207703_10781904	Ga0207703_107819042	176
87	3300026089	Ga0207648_10768927	Ga0207648_107689272	176
88	3300027907	Ga0207428_10057763	Ga0207428_100577632	176
89	3300028023	Ga0265357_1005918	Ga0265357_10059182	176
90	3300028653	Ga0265323_10191698	Ga0265323_101916981	176
91	3300031344	Ga0265316_10075446	Ga0265316_100754463	176
92	3300031711	Ga0265314_10085762	Ga0265314_100857622	176
93	3300031731	Ga0307405_10511858	Ga0307405_105118582	176
94	3300031901	Ga0307406_10090484	Ga0307406_100904842	176
95	3300031901	Ga0307406_10275361	Ga0307406_102753612	176
96	3300032133	Ga0316583_10049493	Ga0316583_100494932	176
97	3300032168	Ga0316593_10216642	Ga0316593_102166422	176
98	3300035207	Ga0373942_0132410	Ga0373942_0132410_190_720	176
99	3300035695	Ga0373927_0167477	Ga0373927_0167477_37_567	176
100	3300035725	Ga0373947_0821134	Ga0373947_0821134_79_609	176
101	3300036712	Ga0316584_0953723	Ga0316584_0953723_11_541	176
102	3300038726	Ga0400490_09372	Ga0400490_09372_9683_10213	176
103	3300038726	Ga0400490_28656	Ga0400490_28656_6693_7223	176
104	3300039062	Ga0400483_117460	Ga0400483_117460_815_1345	176
105	3300039062	Ga0400483_234344	Ga0400483_234344_20_550	176
106	3300039093	Ga0400489_86832	Ga0400489_86832_12378_12914	176
107	3300041494	Ga0451837_1554724	Ga0451837_1554724_52_582	176
108	3300044673	Ga0453683_0052505	Ga0453683_0052505_1607_2137	176
109	3300044712	Ga0453684_1350427	Ga0453684_1350427_23_553	176
110	3300045051	Ga0451576_0453869	Ga0451576_0453869_417_947	176
111	3300046462	Ga0495651_0199202	Ga0495651_0199202_772_1302	176
112	3300046472	Ga0495580_0031187	Ga0495580_0031187_687_1217	176
113	3300046557	Ga0495622_0108502	Ga0495622_0108502_181_711	176
114	3300048915	Ga0496112_0209468	Ga0496112_0209468_242_772	176
115	3300048915	Ga0496112_0262915	Ga0496112_0262915_964_1494	176
116	3300049515	Ga0501292_030973	Ga0501292_030973_121_654	176
117	3300049568	Ga0501031_0032414	Ga0501031_0032414_209_739	176
118	3300049569	Ga0501032_0036179	Ga0501032_0036179_930_1460	176
119	3300049570	Ga0501033_0321994	Ga0501033_0321994_539_1072	176
120	3300049572	Ga0501036_0129456	Ga0501036_0129456_974_1504	176
121	3300049574	Ga0501038_0004862	Ga0501038_0004862_8959_9489	176
122	3300049575	Ga0501039_0156672	Ga0501039_0156672_221_751	176
123	3300049575	Ga0501039_0434656	Ga0501039_0434656_20_553	176
124	3300049576	Ga0501040_0007699	Ga0501040_0007699_3261_3791	176
125	3300049576	Ga0501040_0442041	Ga0501040_0442041_151_681	176
126	3300049577	Ga0501041_0000920	Ga0501041_0000920_13434_13964	176
127	3300049578	Ga0501042_0001626	Ga0501042_0001626_254_784	176
128	3300049579	Ga0501043_0242650	Ga0501043_0242650_112_642	176
129	3300049582	Ga0501048_0003386	Ga0501048_0003386_2955_3485	176
130	3300049586	Ga0501070_0102977	Ga0501070_0102977_249_779	176
131	3300049587	Ga0501071_0003254	Ga0501071_0003254_8817_9347	176
132	3300049588	Ga0501072_0000756	Ga0501072_0000756_10177_10707	176
133	3300049589	Ga0501073_0250327	Ga0501073_0250327_526_1056	176
134	3300049590	Ga0501074_0447129	Ga0501074_0447129_302_832	176
135	3300049591	Ga0501075_0000100	Ga0501075_0000100_3177_3707	176
136	3300049592	Ga0501076_0680594	Ga0501076_0680594_213_746	176
137	3300049593	Ga0501077_0001718	Ga0501077_0001718_749_1279	176
138	3300049741	Ga0501079_0723095	Ga0501079_0723095_120_650	176
139	3300049742	Ga0501080_0001073	Ga0501080_0001073_20678_21208	176
140	3300049822	Ga0501035_0062725	Ga0501035_0062725_2301_2831	176
141	3300049823	Ga0501044_0423070	Ga0501044_0423070_293_823	176
142	3300049824	Ga0501045_0000694	Ga0501045_0000694_12153_12683	176
143	3300050507	nmdc:mga05p37_370252_c1	nmdc:mga05p37_370252_c1_296_826	176
144	3300050507	nmdc:mga05p37_384810_c1	nmdc:mga05p37_384810_c1_352_882	176
145	3300050507	nmdc:mga05p37_570139_c1	nmdc:mga05p37_570139_c1_106_636	176
146	3300050508	nmdc:mga09592_35351_c1	nmdc:mga09592_35351_c1_2604_3134	176
147	3300050510	nmdc:mga06r32_1024607_c1	nmdc:mga06r32_1024607_c1_91_621	176
148	3300050510	nmdc:mga06r32_345830_c1	nmdc:mga06r32_345830_c1_157_687	176
149	3300050511	nmdc:mga08y16_1002943_c1	nmdc:mga08y16_1002943_c1_265_795	176
150	3300050511	nmdc:mga08y16_137210_c1	nmdc:mga08y16_137210_c1_1870_2400	176
151	3300050512	nmdc:mga0n895_4107_c1	nmdc:mga0n895_4107_c1_4350_4880	176
152	3300050513	nmdc:mga0rr50_15549_c1	nmdc:mga0rr50_15549_c1_2998_3528	176
153	3300050514	nmdc:mga08x19_28441_c1	nmdc:mga08x19_28441_c1_2840_3370	176
154	3300050515	nmdc:mga0a205_41525_c1	nmdc:mga0a205_41525_c1_934_1464	176
155	3300053085	Ga0495619_0475905	Ga0495619_0475905_242_778	176
156	3300053087	Ga0500643_008637	Ga0500643_008637_250_783	176
157	3300054114	Ga0501084_0000458	Ga0501084_0000458_3766_4296	176
158	3300059426	Ga0590077_040308	Ga0590077_040308_100_633	176
159	3300060353	Ga0501082_0023609	Ga0501082_0023609_2019_2549	176
160	3300061734	Ga0530510_0000157	Ga0530510_0000157_1569_2099	176
161	3300002155	JGI24033J26618_1005775	JGI24033J26618_10057752	177
162	3300005290	Ga0065712_10069472	Ga0065712_100694723	177
163	3300005331	Ga0070670_100021623	Ga0070670_1000216233	177
164	3300005334	Ga0068869_100104670	Ga0068869_1001046703	177
165	3300005354	Ga0070675_100074553	Ga0070675_1000745532	177
166	3300005365	Ga0070688_100177383	Ga0070688_1001773831	177
167	3300005543	Ga0070672_100163169	Ga0070672_1001631691	177
168	3300014326	Ga0157380_10018891	Ga0157380_100188914	177
169	3300025926	Ga0207659_10065221	Ga0207659_100652212	177
170	3300025940	Ga0207691_10310930	Ga0207691_103109302	177
171	3300049582	Ga0501048_0077031	Ga0501048_0077031_1753_2292	177
172	3300005444	Ga0070694_100023118	Ga0070694_1000231184	178
173	3300005468	Ga0070707_100163482	Ga0070707_1001634822	178
174	3300005518	Ga0070699_100042368	Ga0070699_1000423682	178
175	3300005545	Ga0070695_100013633	Ga0070695_1000136333	178
176	3300005546	Ga0070696_100003525	Ga0070696_1000035254	178
177	3300005937	Ga0081455_10092773	Ga0081455_100927732	178
178	3300006852	Ga0075433_10022691	Ga0075433_100226915	178
179	3300006871	Ga0075434_100781178	Ga0075434_1007811782	178
180	3300007076	Ga0075435_100661715	Ga0075435_1006617152	178
181	3300025936	Ga0207670_10321347	Ga0207670_103213472	178
182	3300036647	Ga0316582_0025709	Ga0316582_0025709_2790_3329	178
183	3300049743	Ga0501081_0810742	Ga0501081_0810742_103_657	178
184	3300049823	Ga0501044_0340165	Ga0501044_0340165_275_820	178
185	3300050512	nmdc:mga0n895_897983_c1	nmdc:mga0n895_897983_c1_16_552	178
186	3300050515	nmdc:mga0a205_388224_c1	nmdc:mga0a205_388224_c1_638_1174	178
187	3300003320	rootH2_10091878	rootH2_100918782	179
188	3300005295	Ga0065707_10018763	Ga0065707_100187632	179
189	3300005337	Ga0070682_100081319	Ga0070682_1000813192	179
190	3300005435	Ga0070714_100423682	Ga0070714_1004236822	179
191	3300005436	Ga0070713_100054734	Ga0070713_1000547343	179
192	3300005439	Ga0070711_100594066	Ga0070711_1005940661	179
193	3300005441	Ga0070700_100325785	Ga0070700_1003257852	179
194	3300005445	Ga0070708_100008880	Ga0070708_1000088806	179
195	3300005456	Ga0070678_101039216	Ga0070678_1010392161	179
196	3300005458	Ga0070681_10004534	Ga0070681_100045349	179
197	3300005467	Ga0070706_100036726	Ga0070706_1000367262	179
198	3300005468	Ga0070707_100002643	Ga0070707_10000264313	179
199	3300005471	Ga0070698_100004148	Ga0070698_10000414810	179
200	3300005518	Ga0070699_100444109	Ga0070699_1004441092	179
201	3300005530	Ga0070679_100290833	Ga0070679_1002908332	179
202	3300005535	Ga0070684_101469088	Ga0070684_1014690881	179
203	3300005536	Ga0070697_100009909	Ga0070697_1000099099	179
204	3300005543	Ga0070672_100474131	Ga0070672_1004741312	179
205	3300005844	Ga0068862_100989545	Ga0068862_1009895451	179
206	3300006028	Ga0070717_10655087	Ga0070717_106550872	179
207	3300006844	Ga0075428_100226506	Ga0075428_1002265062	179
208	3300006846	Ga0075430_100000065	Ga0075430_10000006541	179
209	3300006846	Ga0075430_100074047	Ga0075430_1000740472	179
210	3300006847	Ga0075431_100000849	Ga0075431_10000084919	179
211	3300006852	Ga0075433_10303466	Ga0075433_103034662	179
212	3300006871	Ga0075434_100643812	Ga0075434_1006438121	179
213	3300006880	Ga0075429_100339385	Ga0075429_1003393852	179
214	3300006881	Ga0068865_100462807	Ga0068865_1004628072	179
215	3300006914	Ga0075436_100071945	Ga0075436_1000719452	179
216	3300007265	Ga0099794_10000292	Ga0099794_1000029210	179
217	3300009093	Ga0105240_10003974	Ga0105240_1000397419	179
218	3300009094	Ga0111539_10081170	Ga0111539_100811704	179
219	3300009094	Ga0111539_10718707	Ga0111539_107187071	179
220	3300009147	Ga0114129_10009073	Ga0114129_100090737	179
221	3300009147	Ga0114129_10215012	Ga0114129_102150122	179
222	3300009545	Ga0105237_10004265	Ga0105237_1000426513	179
223	3300009553	Ga0105249_10251780	Ga0105249_102517802	179
224	3300011119	Ga0105246_10398816	Ga0105246_103988161	179
225	3300013104	Ga0157370_10233604	Ga0157370_102336042	179
226	3300013105	Ga0157369_10203030	Ga0157369_102030302	179
227	3300013297	Ga0157378_11771802	Ga0157378_117718021	179
228	3300013307	Ga0157372_11128362	Ga0157372_111283622	179
229	3300013308	Ga0157375_10202145	Ga0157375_102021452	179
230	3300014326	Ga0157380_10000314	Ga0157380_1000031425	179
231	3300014326	Ga0157380_10050863	Ga0157380_100508632	179
232	3300014326	Ga0157380_10130729	Ga0157380_101307292	179
233	3300021361	Ga0213872_10004710	Ga0213872_100047107	179
234	3300021384	Ga0213876_10171897	Ga0213876_101718972	179
235	3300025893	Ga0207682_10277636	Ga0207682_102776361	179
236	3300025910	Ga0207684_10034064	Ga0207684_100340644	179
237	3300025910	Ga0207684_10331204	Ga0207684_103312042	179
238	3300025912	Ga0207707_10029895	Ga0207707_100298953	179
239	3300025913	Ga0207695_10012403	Ga0207695_100124037	179
240	3300025914	Ga0207671_10049663	Ga0207671_100496633	179
241	3300025921	Ga0207652_10435132	Ga0207652_104351321	179
242	3300025922	Ga0207646_10041057	Ga0207646_100410574	179
243	3300025928	Ga0207700_10007846	Ga0207700_100078462	179
244	3300025931	Ga0207644_10258678	Ga0207644_102586782	179
245	3300025938	Ga0207704_10663784	Ga0207704_106637842	179
246	3300025940	Ga0207691_10556415	Ga0207691_105564152	179
247	3300025961	Ga0207712_10384561	Ga0207712_103845612	179
248	3300026088	Ga0207641_10213002	Ga0207641_102130022	179
249	3300027671	Ga0209588_1001847	Ga0209588_10018472	179
250	3300027671	Ga0209588_1013160	Ga0209588_10131601	179
251	3300027907	Ga0207428_10130572	Ga0207428_101305722	179
252	3300028380	Ga0268265_10663063	Ga0268265_106630632	179
253	3300032126	Ga0307415_100508425	Ga0307415_1005084251	179
254	3300032168	Ga0316593_10006768	Ga0316593_100067681	179
255	3300039437	Ga0436365_0930066	Ga0436365_0930066_279_845	179
256	3300039437	Ga0436365_1485815	Ga0436365_1485815_322_888	179
257	3300039447	Ga0436361_1126806	Ga0436361_1126806_815_1387	179
258	3300039450	Ga0436363_0149102	Ga0436363_0149102_1997_2563	179
259	3300042876	Ga0451577_0222624	Ga0451577_0222624_784_1326	179
260	3300044673	Ga0453683_0038240	Ga0453683_0038240_1061_1624	179
261	3300044712	Ga0453684_0250217	Ga0453684_0250217_1423_1965	179
262	3300045051	Ga0451576_0003225	Ga0451576_0003225_17011_17574	179
263	3300045051	Ga0451576_0004797	Ga0451576_0004797_8612_9151	179
264	3300046455	Ga0495603_0098219	Ga0495603_0098219_41_640	179
265	3300046459	Ga0495629_0343283	Ga0495629_0343283_315_914	179
266	3300046477	Ga0495664_0279891	Ga0495664_0279891_58_624	179
267	3300048908	Ga0496105_0670822	Ga0496105_0670822_140_682	179
268	3300049577	Ga0501041_0479300	Ga0501041_0479300_40_579	179
269	3300049581	Ga0501047_0108279	Ga0501047_0108279_283_825	179
270	3300049589	Ga0501073_0206304	Ga0501073_0206304_446_988	179
271	3300049591	Ga0501075_0297142	Ga0501075_0297142_22_561	179
272	3300049592	Ga0501076_0062735	Ga0501076_0062735_824_1363	179
273	3300049593	Ga0501077_0031445	Ga0501077_0031445_115_654	179
274	3300049668	Ga0501233_088458	Ga0501233_088458_98_640	179
275	3300049741	Ga0501079_0007346	Ga0501079_0007346_2786_3325	179
276	3300049744	Ga0501083_0058061	Ga0501083_0058061_1510_2052	179
277	3300049822	Ga0501035_0714640	Ga0501035_0714640_242_781	179
278	3300050507	nmdc:mga05p37_14108_c1	nmdc:mga05p37_14108_c1_1643_2221	179
279	3300050508	nmdc:mga09592_329908_c1	nmdc:mga09592_329908_c1_264_842	179
280	3300050510	nmdc:mga06r32_37688_c1	nmdc:mga06r32_37688_c1_318_896	179
281	3300050511	nmdc:mga08y16_389518_c1	nmdc:mga08y16_389518_c1_326_874	179
282	3300050512	nmdc:mga0n895_779086_c1	nmdc:mga0n895_779086_c1_47_613	179
283	3300050515	nmdc:mga0a205_209680_c1	nmdc:mga0a205_209680_c1_798_1337	179
284	3300060353	Ga0501082_0268818	Ga0501082_0268818_271_810	179
285	3300060353	Ga0501082_1122831	Ga0501082_1122831_48_674	179
286	3300061734	Ga0530510_0325653	Ga0530510_0325653_523_1107	179
287	3300005535	Ga0070684_100676813	Ga0070684_1006768131	180
288	3300028800	Ga0265338_10015618	Ga0265338_100156189	180
289	3300031241	Ga0265325_10000842	Ga0265325_1000084216	180
290	3300031249	Ga0265339_10003997	Ga0265339_1000399710	180
291	3300031250	Ga0265331_10000792	Ga0265331_1000079217	180
292	3300031595	Ga0265313_10001268	Ga0265313_1000126816	180
293	3300031711	Ga0265314_10000078	Ga0265314_10000078100	180
294	3300031712	Ga0265342_10008213	Ga0265342_100082136	180
295	3300001989	JGI24739J22299_10002553	JGI24739J22299_100025536	181
296	3300003215	JGI25153J46596_10012342	JGI25153J46596_100123423	181
297	3300003320	rootH2_10001886	rootH2_1000188682	181
298	3300003320	rootH2_10181079	rootH2_101810792	181
299	3300003354	JGI25160J50197_1002152	JGI25160J50197_10021527	181
300	3300003790	Ga0055528_1001633	Ga0055528_10016334	181
301	3300003790	Ga0055528_1001646	Ga0055528_10016464	181
302	3300003791	Ga0055530_10003030	Ga0055530_100030308	181
303	3300003794	Ga0055531_10044070	Ga0055531_100440702	181
304	3300005262	Ga0065165_1000056	Ga0065165_10000569	181
305	3300005331	Ga0070670_100078762	Ga0070670_1000787622	181
306	3300005336	Ga0070680_100414527	Ga0070680_1004145272	181
307	3300005337	Ga0070682_100587331	Ga0070682_1005873312	181
308	3300005347	Ga0070668_100128576	Ga0070668_1001285762	181
309	3300005367	Ga0070667_100151254	Ga0070667_1001512541	181
310	3300005444	Ga0070694_100129827	Ga0070694_1001298272	181
311	3300005458	Ga0070681_10235977	Ga0070681_102359773	181
312	3300005458	Ga0070681_10447215	Ga0070681_104472152	181
313	3300005459	Ga0068867_100254401	Ga0068867_1002544012	181
314	3300005530	Ga0070679_100089847	Ga0070679_1000898472	181
315	3300005539	Ga0068853_100015661	Ga0068853_1000156612	181
316	3300005577	Ga0068857_100367011	Ga0068857_1003670112	181
317	3300005616	Ga0068852_100992448	Ga0068852_1009924481	181
318	3300005937	Ga0081455_10108831	Ga0081455_101088312	181
319	3300006846	Ga0075430_100517653	Ga0075430_1005176532	181
320	3300006847	Ga0075431_100504871	Ga0075431_1005048712	181
321	3300009147	Ga0114129_12107431	Ga0114129_121074311	181
322	3300009176	Ga0105242_10014857	Ga0105242_100148572	181
323	3300009545	Ga0105237_10384468	Ga0105237_103844683	181
324	3300009551	Ga0105238_10056297	Ga0105238_100562972	181
325	3300009551	Ga0105238_10460539	Ga0105238_104605392	181
326	3300012495	Ga0157323_1019909	Ga0157323_10199091	181
327	3300013100	Ga0157373_10330279	Ga0157373_103302792	181
328	3300013102	Ga0157371_10054183	Ga0157371_100541832	181
329	3300013104	Ga0157370_10012492	Ga0157370_100124929	181
330	3300013105	Ga0157369_10000744	Ga0157369_1000074419	181
331	3300013297	Ga0157378_10157638	Ga0157378_101576382	181
332	3300013306	Ga0163162_10006177	Ga0163162_100061778	181
333	3300013307	Ga0157372_10028175	Ga0157372_100281755	181
334	3300013307	Ga0157372_10137419	Ga0157372_101374193	181
335	3300020069	Ga0197907_11008217	Ga0197907_110082174	181
336	3300020076	Ga0206355_1578354	Ga0206355_15783541	181
337	3300025273	Ga0209673_1000130	Ga0209673_1000130132	181
338	3300025295	Ga0209564_1002706	Ga0209564_10027069	181
339	3300025295	Ga0209564_1003430	Ga0209564_10034307	181
340	3300025297	Ga0209758_1002696	Ga0209758_10026969	181
341	3300025298	Ga0209050_1000427	Ga0209050_100042715	181
342	3300025302	Ga0207426_1003025	Ga0207426_10030259	181
343	3300025302	Ga0207426_1024659	Ga0207426_10246591	181
344	3300025303	Ga0209051_1037597	Ga0209051_10375972	181
345	3300025304	Ga0209257_1010371	Ga0209257_10103716	181
346	3300025912	Ga0207707_10074718	Ga0207707_100747183	181
347	3300025917	Ga0207660_10282465	Ga0207660_102824652	181
348	3300025921	Ga0207652_10046972	Ga0207652_100469723	181
349	3300025924	Ga0207694_10202147	Ga0207694_102021472	181
350	3300025925	Ga0207650_10071216	Ga0207650_100712162	181
351	3300025934	Ga0207686_10039512	Ga0207686_100395122	181
352	3300025942	Ga0207689_10084615	Ga0207689_100846152	181
353	3300025961	Ga0207712_10339726	Ga0207712_103397262	181
354	3300026041	Ga0207639_10046656	Ga0207639_100466562	181
355	3300026089	Ga0207648_10034657	Ga0207648_100346572	181
356	3300026116	Ga0207674_10355758	Ga0207674_103557582	181
357	3300026142	Ga0207698_10900899	Ga0207698_109008992	181
358	3300028379	Ga0268266_10335504	Ga0268266_103355042	181
359	3300044719	Ga0466971_0043085	Ga0466971_0043085_148_693	181
360	3300045049	Ga0466959_0001548	Ga0466959_0001548_5530_6075	181
361	3300045836	Ga0466958_0225780	Ga0466958_0225780_20_565	181
362	3300046648	Ga0495611_0000057	Ga0495611_0000057_51304_51855	181
363	3300046694	Ga0495649_0063550	Ga0495649_0063550_381_929	181
364	3300047320	Ga0495672_0022419	Ga0495672_0022419_308_853	181
365	3300049569	Ga0501032_0170380	Ga0501032_0170380_141_686	181
366	3300049581	Ga0501047_0092154	Ga0501047_0092154_1025_1570	181
367	3300049823	Ga0501044_0081356	Ga0501044_0081356_1311_1856	181
368	3300050509	nmdc:mga0qj67_583307_c1	nmdc:mga0qj67_583307_c1_147_716	181
369	3300053092	Ga0500583_0000015	Ga0500583_0000015_71248_71793	181
370	3300053136	Ga0500559_0038254	Ga0500559_0038254_1450_1995	181
371	3300061719	Ga0466962_0148466	Ga0466962_0148466_334_879	181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

13

185

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6c46-assembly3.cif.gz_E-2	crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1	0.9566	1	178
1dzt-assembly1.cif.gz_B	rmlc from salmonella typhimurium	0.9563	2	173
7pvi-assembly1.cif.gz_BBB	dtdp-sugar epimerase	0.9551	2	174
3ryk-assembly1.cif.gz_B	1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound	0.9547	2	174
6c46-assembly2.cif.gz_C	crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1	0.9485	1	178

ID	Description	Score	Start	End	Superfamily
5buvB00	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9378	2	174	2.60.120.10
2c0zA01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9363	1	173	2.60.120.10
6dinA00	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9361	2	173	2.60.120.10
1epzA00	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9336	2	173	2.60.120.10
2ixcB00	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9259	1	173	2.60.120.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2D5TFY5-F1-model_v4	dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase)	0.9931	48	173	GO:0005829 GO:0008830 GO:0019305 GO:0045226
AF-A0A4Q3ANJ3-F1-model_v4	deleted	0.9885	42	181
AF-A0A831U845-F1-model_v4	dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase)	0.9884	48	173	GO:0000271 GO:0005829 GO:0008830 GO:0019305
AF-A0A1R3X2U9-F1-model_v4	dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase)	0.9878	2	174	GO:0005829 GO:0008830 GO:0019305 GO:0045226
AF-A0A5B8V454-F1-model_v4	dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase)	0.9875	1	181	GO:0005829 GO:0008830 GO:0019305 GO:0045226

Feature Viewer

pLDDT	pTM	Quality
97.32	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F425671

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

13

185

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map