F425516

General Info

Members Datasets Scaffolds Average Seq Length
370 283 369 411

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0126998|Ga0495618_0126998_231_1589
Length 452
Sequence MSSDWAVQALLADENKLSPYEPQQQMLLPQALQDWLPEGHLAYYISDAVDSLDLSAFHAQYAGGGARNQPFHPAMMVKVLVYGYATGVFSSRKLARKLHEDVAFRVLAAGNYPAHRTLCDFRARHLKELSDLFVQVVKLAKECGLVKLGTVAVDGTKIKANASRHKAMSYERMKKVELELKEQIDALLAKAKAADAAEKNEPELDIPAEITRREDRLAVIRAARARLEERQRQTDIARGRSDDDAPPHADGEPKKKSRFKXXFGEPKPDAQENFTDPESRIMKHAGGGFDYSYNAQAAVDEAGHIIVAAELGNSAADSGQLPTVLAAVLRDAGADPKQVLADAGYRSEATFEQLREHPAELIVALGREGKKDVKIDASKRPLCAAMAEKFTSAETQAAYRKRKWLSEPPNAWVKSVLGFRQFSMRGLAKAQAEWKLVCTALNLRRMAKMMYA

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
173 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
174 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
178 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
179 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
180 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
181 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
182 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
183 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
184 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
185 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
277 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
278 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
281 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0.54
Rhizoplane 5.95
Rhizosphere 79.73
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1003938 3300002126 Bacteria 1407
2 JGI24033J26618_1004065 3300002155 Bacteria 1566
3 JGI24742J22300_10001999 3300002244 Bacteria 3250
4 JGI25156J39149_1012890 3300002705 Bacteria 1808
5 JGI25154J39366_1007552 3300002738 Bacteria 1474
6 rootH1_10163812 3300003323 Bacteria 1576
7 Ga0055527_1004444 3300003760 Bacteria 1927
8 Ga0055535_1010387 3300003761 Bacteria 1532
9 Ga0055542_1008917 3300003762 Bacteria 1925
10 Ga0055529_1007123 3300003763 Bacteria 1532
11 Ga0055526_1026027 3300003771 Bacteria 1859
12 Ga0055526_1030232 3300003771 Bacteria 1585
13 Ga0055537_1014528 3300003773 Bacteria 1426
14 Ga0055524_1027369 3300003775 Bacteria 1731
15 Ga0055524_1029476 3300003775 Bacteria 1621
16 Ga0055534_1015087 3300003784 Bacteria 1426
17 Ga0055528_1030532 3300003790 Bacteria 1426
18 Ga0055540_1007059 3300003792 Bacteria 4319
19 Ga0065715_10012785 3300005293 Bacteria 3830
20 Ga0065707_10000686 3300005295 Bacteria 18034
21 Ga0065707_10160916 3300005295 Bacteria 1544
22 Ga0065707_10176848 3300005295 Bacteria 1445
23 Ga0070658_10169543 3300005327 Bacteria 1833
24 Ga0070658_10189259 3300005327 Bacteria 1734
25 Ga0070676_10020200 3300005328 Bacteria 3715
26 Ga0070690_100015328 3300005330 Bacteria 4569
27 Ga0070677_10001085 3300005333 Bacteria 8767
28 Ga0068868_100033565 3300005338 Bacteria 3956
29 Ga0070660_100003463 3300005339 Bacteria 10864
30 Ga0070661_100159883 3300005344 Bacteria 1706
31 Ga0070668_100200967 3300005347 Bacteria 1636
32 Ga0070671_100197363 3300005355 Bacteria 1706
33 Ga0070688_100127970 3300005365 Bacteria 1709
34 Ga0070659_100113405 3300005366 Bacteria 2190
35 Ga0070667_100014688 3300005367 Bacteria 6468
36 Ga0070709_10094988 3300005434 Bacteria 1974
37 Ga0070714_100012033 3300005435 Bacteria 6886
38 Ga0070714_100167001 3300005435 Bacteria 1995
39 Ga0070713_100175225 3300005436 Bacteria 1924
40 Ga0070710_10121293 3300005437 Bacteria 1583
41 Ga0070711_100133594 3300005439 Bacteria 1851
42 Ga0070694_100129206 3300005444 Bacteria 1823
43 Ga0070708_100215968 3300005445 Bacteria 1797
44 Ga0070663_100078240 3300005455 Bacteria 2424
45 Ga0070663_100100784 3300005455 Bacteria 2154
46 Ga0070663_100249215 3300005455 Bacteria 1405
47 Ga0070678_100177430 3300005456 Bacteria 1741
48 Ga0070662_100008731 3300005457 Bacteria 6608
49 Ga0070662_100049587 3300005457 Bacteria 3028
50 Ga0070662_100093149 3300005457 Unclassified 2266
51 Ga0070662_100190813 3300005457 Bacteria 1620
52 Ga0068867_100206744 3300005459 Bacteria 1574
53 Ga0070685_10049765 3300005466 Bacteria 2418
54 Ga0068853_100084541 3300005539 Bacteria 2780
55 Ga0068853_100183599 3300005539 Bacteria 1898
56 Ga0070695_100140868 3300005545 Bacteria 1672
57 Ga0070665_100193499 3300005548 Bacteria 2034
58 Ga0068855_100002393 3300005563 Bacteria 23141
59 Ga0068855_100157847 3300005563 Bacteria 2576
60 Ga0068855_100198017 3300005563 Bacteria 2263
61 Ga0068855_100342516 3300005563 Bacteria 1648
62 Ga0070664_100013566 3300005564 Bacteria 6638
63 Ga0070664_100123687 3300005564 Bacteria 2267
64 Ga0068857_100080913 3300005577 Bacteria 2900
65 Ga0068857_100187589 3300005577 Bacteria 1883
66 Ga0068854_100094989 3300005578 Bacteria 2225
67 Ga0068856_100254256 3300005614 Bacteria 1772
68 Ga0070702_100009331 3300005615 Bacteria 4798
69 Ga0068852_100075768 3300005616 Bacteria 2968
70 Ga0068852_100162602 3300005616 Bacteria 2086
71 Ga0068852_100241218 3300005616 Bacteria 1727
72 Ga0068859_100281912 3300005617 Bacteria 1755
73 Ga0068863_100187970 3300005841 Bacteria 1985
74 Ga0068858_100165396 3300005842 Bacteria 2084
75 Ga0075432_10031501 3300006058 Bacteria 1836
76 Ga0070715_10053036 3300006163 Bacteria 1751
77 Ga0070716_100102520 3300006173 Bacteria 1757
78 Ga0075366_10070728 3300006195 Bacteria 2078
79 Ga0075366_10078446 3300006195 Bacteria 1971
80 Ga0075370_10054104 3300006353 Bacteria 2278
81 Ga0075428_100345253 3300006844 Bacteria 1598
82 Ga0075434_100207491 3300006871 Bacteria 1980
83 Ga0068865_100074295 3300006881 Bacteria 2420
84 Ga0097620_100281893 3300006931 Bacteria 1755
85 Ga0099826_10126166 3300006948 Bacteria 1500
86 Ga0075435_100201534 3300007076 Bacteria 1686
87 Ga0105240_10198339 3300009093 Bacteria 2354
88 Ga0105240_10278060 3300009093 Bacteria 1924
89 Ga0105240_10368094 3300009093 Bacteria 1626
90 Ga0105247_10102070 3300009101 Bacteria 1835
91 Ga0105243_10139815 3300009148 Bacteria 2064
92 Ga0105241_10189948 3300009174 Bacteria 1709
93 Ga0105248_10169574 3300009177 Bacteria 2460
94 Ga0105248_10214724 3300009177 Bacteria 2167
95 Ga0105248_10444727 3300009177 Bacteria 1460
96 Ga0105237_10112206 3300009545 Bacteria 2718
97 Ga0105238_10198703 3300009551 Bacteria 1980
98 Ga0105238_10351614 3300009551 Bacteria 1463
99 Ga0105239_10082768 3300010375 Bacteria 3534
100 Ga0157370_10103409 3300013104 Bacteria 2666
101 Ga0157370_10291314 3300013104 Bacteria 1508
102 Ga0157369_10171621 3300013105 Bacteria 2285
103 Ga0157378_10142269 3300013297 Bacteria 2228
104 Ga0163162_10177398 3300013306 Bacteria 2256
105 Ga0157372_10150678 3300013307 Bacteria 2684
106 Ga0157375_10322010 3300013308 Bacteria 1711
107 Ga0157380_10174757 3300014326 Bacteria 1880
108 Ga0182008_10055590 3300014497 Bacteria 1957
109 Ga0157377_10032738 3300014745 Bacteria 2833
110 Ga0157377_10046816 3300014745 Bacteria 2421
111 Ga0163161_10019381 3300017792 Bacteria 4772
112 Ga0213876_10067893 3300021384 Bacteria 1883
113 Ga0224572_1017396 3300024225 Bacteria 1380
114 Ga0209672_102611 3300025228 Bacteria 4266
115 Ga0209258_107952 3300025242 Bacteria 1532
116 Ga0209646_1006327 3300025246 Bacteria 1995
117 Ga0209026_1009955 3300025250 Bacteria 1813
118 Ga0209148_1003311 3300025254 Bacteria 4542
119 Ga0209759_1020199 3300025256 Bacteria 1553
120 Ga0209565_1019889 3300025263 Bacteria 1426
121 Ga0209455_1014973 3300025272 Bacteria 1728
122 Ga0209455_1017124 3300025272 Bacteria 1533
123 Ga0209673_1037420 3300025273 Bacteria 1426
124 Ga0209675_1026836 3300025291 Bacteria 1426
125 Ga0209564_1014546 3300025295 Bacteria 3266
126 Ga0209256_1011122 3300025299 Bacteria 3645
127 Ga0209051_1011651 3300025303 Bacteria 4321
128 Ga0207697_10007690 3300025315 Bacteria 4778
129 Ga0207697_10013905 3300025315 Bacteria 3351
130 Ga0207697_10039474 3300025315 Bacteria 1937
131 Ga0207713_1053642 3300025735 Bacteria 1587
132 Ga0207682_10000730 3300025893 Bacteria 15257
133 Ga0207682_10034273 3300025893 Bacteria 2046
134 Ga0207688_10063569 3300025901 Bacteria 2082
135 Ga0207680_10096051 3300025903 Bacteria 1895
136 Ga0207685_10053609 3300025905 Bacteria 1567
137 Ga0207699_10115531 3300025906 Bacteria 1727
138 Ga0207645_10117996 3300025907 Bacteria 1721
139 Ga0207705_10160397 3300025909 Bacteria 1689
140 Ga0207705_10203433 3300025909 Bacteria 1501
141 Ga0207695_10237984 3300025913 Bacteria 1723
142 Ga0207695_10301588 3300025913 Bacteria 1493
143 Ga0207693_10137075 3300025915 Bacteria 1924
144 Ga0207662_10077217 3300025918 Bacteria 2026
145 Ga0207657_10031127 3300025919 Bacteria 4837
146 Ga0207657_10207918 3300025919 Bacteria 1572
147 Ga0207681_10176524 3300025923 Bacteria 1623
148 Ga0207681_10189193 3300025923 Bacteria 1573
149 Ga0207694_10141066 3300025924 Bacteria 1938
150 Ga0207694_10201812 3300025924 Bacteria 1618
151 Ga0207694_10206673 3300025924 Bacteria 1599
152 Ga0207659_10042949 3300025926 Bacteria 3172
153 Ga0207700_10048100 3300025928 Bacteria 3165
154 Ga0207664_10019000 3300025929 Bacteria 5071
155 Ga0207664_10210959 3300025929 Bacteria 1680
156 Ga0207690_10095685 3300025932 Bacteria 2110
157 Ga0207706_10115846 3300025933 Bacteria 2357
158 Ga0207706_10119913 3300025933 Bacteria 2313
159 Ga0207686_10151022 3300025934 Bacteria 1617
160 Ga0207669_10076009 3300025937 Bacteria 2130
161 Ga0207704_10105931 3300025938 Bacteria 1887
162 Ga0207665_10158836 3300025939 Bacteria 1625
163 Ga0207711_10008804 3300025941 Bacteria 8440
164 Ga0207711_10266228 3300025941 Bacteria 1576
165 Ga0207711_10266472 3300025941 Bacteria 1575
166 Ga0207689_10088249 3300025942 Bacteria 2548
167 Ga0207679_10052728 3300025945 Bacteria 2985
168 Ga0207679_10191870 3300025945 Bacteria 1699
169 Ga0207679_10218582 3300025945 Bacteria 1602
170 Ga0207679_10233009 3300025945 Bacteria 1556
171 Ga0207667_10014927 3300025949 Bacteria 8833
172 Ga0207667_10155950 3300025949 Bacteria 2349
173 Ga0207667_10182259 3300025949 Bacteria 2156
174 Ga0207651_10012804 3300025960 Bacteria 4766
175 Ga0207668_10210646 3300025972 Bacteria 1554
176 Ga0207677_10166611 3300026023 Bacteria 1718
177 Ga0207703_10245516 3300026035 Bacteria 1611
178 Ga0207639_10259093 3300026041 Bacteria 1520
179 Ga0207678_10107394 3300026067 Bacteria 2381
180 Ga0207678_10284281 3300026067 Bacteria 1420
181 Ga0207708_10058449 3300026075 Bacteria 2942
182 Ga0207708_10221862 3300026075 Bacteria 1515
183 Ga0207641_10274329 3300026088 Bacteria 1583
184 Ga0207641_10280671 3300026088 Bacteria 1566
185 Ga0207648_10090041 3300026089 Bacteria 2680
186 Ga0207676_10017021 3300026095 Bacteria 5266
187 Ga0207674_10214670 3300026116 Bacteria 1873
188 Ga0207674_10222266 3300026116 Bacteria 1837
189 Ga0207675_100034315 3300026118 Bacteria 4730
190 Ga0207675_100049434 3300026118 Bacteria 3925
191 Ga0207683_10225483 3300026121 Bacteria 1708
192 Ga0207698_10049899 3300026142 Bacteria 3188
193 Ga0207698_10117810 3300026142 Bacteria 2241
194 Ga0207698_10172117 3300026142 Bacteria 1908
195 Ga0209973_1001040 3300027252 Bacteria 2299
196 Ga0209983_1020296 3300027665 Unclassified 1384
197 Ga0209282_1011632 3300027666 Bacteria 5588
198 Ga0209971_1005407 3300027682 Bacteria 3034
199 Ga0209998_10009221 3300027717 Bacteria 2047
200 Ga0209974_10001448 3300027876 Bacteria 8611
201 Ga0209974_10035522 3300027876 Unclassified 1655
202 Ga0307517_10132113 3300028786 Bacteria 1792
203 Ga0265340_10030600 3300031247 Bacteria 2697
204 Ga0265316_10063413 3300031344 Bacteria 2866
205 Ga0307513_10223971 3300031456 Bacteria 1699
206 Ga0316575_10047715 3300031665 Bacteria 1702
207 Ga0316579_10061224 3300031691 Bacteria 1771
208 Ga0265342_10111306 3300031712 Bacteria 1549
209 Ga0316578_10110270 3300031728 Bacteria 1652
210 Ga0307405_10079123 3300031731 Bacteria 2142
211 Ga0307518_10101319 3300031838 Bacteria 2061
212 Ga0307406_10062595 3300031901 Bacteria 2408
213 Ga0307416_100205003 3300032002 Unclassified 1875
214 Ga0307510_10175049 3300033180 Bacteria 1718
215 Ga0316587_1000496 3300033529 Bacteria 4013
216 Ga0373939_0023484 3300035114 Bacteria 1709
217 Ga0373927_0143417 3300035695 Bacteria 1563
218 Ga0316582_0045263 3300036647 Bacteria 2770
219 Ga0395898_0261017 3300037466 Bacteria 1652
220 Ga0395905_0273149 3300037471 Bacteria 1576
221 Ga0242420_009553 3300038996 Unclassified 1593
222 Ga0436365_1371508 3300039437 Bacteria 2166
223 Ga0436360_0563443 3300039438 Bacteria 1753
224 Ga0436361_0074117 3300039447 Bacteria 1830
225 Ga0436361_0171722 3300039447 Bacteria 1585
226 Ga0439453_0001763 3300041408 Bacteria 2856
227 Ga0439461_0003040 3300041410 Bacteria 2735
228 Ga0439437_002287 3300042000 Bacteria 2045
229 Ga0439437_002634 3300042000 Unclassified 1928
230 Ga0439441_002562 3300042001 Unclassified 2576
231 Ga0439443_000882 3300042003 Bacteria 3032
232 Ga0439451_003109 3300042009 Bacteria 3372
233 Ga0439454_000414 3300042011 Bacteria 3350
234 Ga0439456_005911 3300042013 Bacteria 2490
235 Ga0450914_000550 3300042118 Bacteria 1845
236 Ga0450914_000941 3300042118 Bacteria 1645
237 Ga0450917_002250 3300042120 Bacteria 1379
238 Ga0450888_000902 3300042126 Bacteria 2829
239 Ga0450888_001430 3300042126 Bacteria 2289
240 Ga0450892_001877 3300042130 Bacteria 1890
241 Ga0450904_003177 3300042139 Bacteria 1810
242 Ga0450905_005314 3300042142 Unclassified 1728
243 Ga0439435_0020791 3300042436 Unclassified 1696
244 Ga0439444_0006999 3300042437 Unclassified 1720
245 Ga0439464_0007436 3300042439 Bacteria 2865
246 Ga0439460_0018768 3300042461 Unclassified 1865
247 Ga0450916_001499 3300042530 Bacteria 2344
248 Ga0450893_0000870 3300042532 Bacteria 4490
249 Ga0450893_0002429 3300042532 Bacteria 2900
250 Ga0450901_001291 3300042533 Bacteria 2886
251 Ga0439440_0003858 3300042993 Bacteria 2916
252 Ga0439440_0017447 3300042993 Bacteria 1581
253 Ga0466964_0039960 3300044706 Bacteria 1892
254 Ga0451576_0304056 3300045051 Bacteria 1668
255 Ga0466967_0093550 3300045976 Bacteria 2735
256 Ga0495592_0070265 3300046454 Bacteria 2551
257 Ga0495590_0044626 3300046457 Bacteria 1545
258 Ga0495629_0114248 3300046459 Bacteria 1882
259 Ga0495629_0147198 3300046459 Bacteria 1637
260 Ga0495651_0155418 3300046462 Bacteria 1644
261 Ga0495653_0104987 3300046463 Bacteria 2041
262 Ga0495580_0175480 3300046472 Bacteria 1480
263 Ga0495662_0086636 3300046476 Bacteria 1525
264 Ga0495664_0046207 3300046477 Bacteria 2583
265 Ga0495596_0040287 3300046500 Bacteria 1844
266 Ga0495583_0078830 3300046506 Bacteria 1434
267 Ga0495608_0099862 3300046511 Bacteria 1872
268 Ga0495618_0126998 3300046514 Bacteria 1633
269 Ga0495628_0082522 3300046516 Bacteria 2497
270 Ga0495628_0121934 3300046516 Bacteria 1999
271 Ga0495630_0151830 3300046517 Bacteria 1762
272 Ga0495642_0008749 3300046528 Bacteria 3867
273 Ga0495652_0114454 3300046529 Bacteria 2164
274 Ga0495652_0156735 3300046529 Bacteria 1772
275 Ga0495654_0062361 3300046530 Bacteria 1787
276 Ga0495640_0106053 3300046533 Bacteria 1840
277 Ga0495586_0038751 3300046535 Bacteria 2561
278 Ga0495587_0043468 3300046536 Bacteria 2676
279 Ga0495598_0026906 3300046537 Bacteria 1581
280 Ga0495609_0072985 3300046538 Bacteria 1506
281 Ga0495621_0015939 3300046539 Bacteria 2404
282 Ga0495621_0026390 3300046539 Bacteria 1959
283 Ga0495621_0043263 3300046539 Bacteria 1588
284 Ga0495645_0046241 3300046543 Bacteria 3172
285 Ga0495622_0000088 3300046557 Bacteria 82716
286 Ga0495656_0080726 3300046615 Bacteria 1467
287 Ga0495599_0039716 3300046678 Bacteria 2957
288 Ga0495623_0060666 3300046679 Bacteria 2373
289 Ga0495646_0012963 3300046680 Bacteria 5300
290 Ga0495613_0040105 3300046689 Bacteria 3470
291 Ga0495613_0194924 3300046689 Bacteria 1430
292 Ga0495624_0013266 3300046690 Bacteria 5617
293 Ga0495624_0024875 3300046690 Bacteria 3939
294 Ga0495600_0135287 3300046809 Bacteria 1601
295 Ga0495581_0155985 3300047315 Bacteria 1334
296 Ga0495674_0131848 3300047319 Bacteria 2105
297 Ga0495674_0140398 3300047319 Bacteria 2031
298 Ga0495672_0096514 3300047320 Bacteria 1611
299 Ga0495687_062159 3300047443 Bacteria 1533
300 Ga0495675_0128857 3300047444 Bacteria 1573
301 Ga0495681_0070690 3300047470 Bacteria 1582
302 Ga0495681_0071012 3300047470 Bacteria 1577
303 Ga0495593_0014799 3300047673 Bacteria 4432
304 Ga0495593_0088370 3300047673 Bacteria 1597
305 Ga0495614_0059467 3300048089 Bacteria 1641
306 Ga0495615_0011245 3300048090 Bacteria 1813
307 Ga0495615_0015459 3300048090 Bacteria 1630
308 Ga0496101_0180499 3300048904 Bacteria 1625
309 Ga0496101_0188851 3300048904 Bacteria 1589
310 Ga0496102_0247856 3300048905 Bacteria 1679
311 Ga0496104_0128202 3300048907 Bacteria 2436
312 Ga0496104_0159950 3300048907 Bacteria 2160
313 Ga0496105_0136652 3300048908 Bacteria 2019
314 Ga0496105_0212030 3300048908 Bacteria 1578
315 Ga0496106_0168791 3300048909 Bacteria 1733
316 Ga0496106_0174533 3300048909 Bacteria 1705
317 Ga0496107_0207529 3300048910 Bacteria 1456
318 Ga0496110_0061039 3300048913 Bacteria 3326
319 Ga0496110_0136616 3300048913 Bacteria 2216
320 Ga0496110_0157662 3300048913 Bacteria 2056
321 Ga0496111_0115429 3300048914 Bacteria 1979
322 Ga0496112_0213081 3300048915 Bacteria 1888
323 Ga0496112_0282567 3300048915 Bacteria 1606
324 Ga0496113_0075654 3300048916 Bacteria 2570
325 Ga0496113_0196957 3300048916 Bacteria 1600
326 Ga0496113_0210757 3300048916 Unclassified 1547
327 Ga0496114_0193014 3300048917 Bacteria 1782
328 Ga0496115_0188284 3300048918 Bacteria 1705
329 Ga0496115_0208912 3300048918 Bacteria 1612
330 Ga0496125_0020080 3300048928 Bacteria 6282
331 Ga0495682_0046298 3300049460 Bacteria 1588
332 Ga0501031_0140302 3300049568 Bacteria 1579
333 Ga0501036_0197699 3300049572 Bacteria 1691
334 Ga0501039_0116087 3300049575 Bacteria 2095
335 Ga0501039_0174323 3300049575 Bacteria 1691
336 Ga0501041_0115640 3300049577 Bacteria 1665
337 Ga0501041_0141320 3300049577 Bacteria 1501
338 Ga0501042_0161386 3300049578 Bacteria 1617
339 Ga0501047_0248267 3300049581 Bacteria 1628
340 Ga0501070_0115107 3300049586 Bacteria 2221
341 Ga0501072_0044770 3300049588 Bacteria 3480
342 Ga0501074_0202814 3300049590 Bacteria 1413
343 Ga0501075_0151798 3300049591 Bacteria 1765
344 Ga0501077_0140692 3300049593 Bacteria 1530
345 Ga0501079_0243929 3300049741 Bacteria 1404
346 Ga0501080_0104606 3300049742 Bacteria 2625
347 Ga0501080_0294489 3300049742 Bacteria 1473
348 Ga0501083_0124345 3300049744 Bacteria 1691
349 Ga0501035_0210955 3300049822 Bacteria 1661
350 Ga0501045_0138199 3300049824 Bacteria 1812
351 nmdc:mga0k408_106323_c1 3300050493 Bacteria 1658
352 nmdc:mga0k408_64031_c1 3300050493 Bacteria 1765
353 nmdc:mga07m45_14499_c1 3300050496 Bacteria 4199
354 nmdc:mga07m45_21714_c1 3300050496 Bacteria 3499
355 nmdc:mga09592_243139_c1 3300050508 Unclassified 1560
356 nmdc:mga0n895_196313_c1 3300050512 Bacteria 2049
357 nmdc:mga0rr50_239225_c1 3300050513 Bacteria 1505
358 nmdc:mga08x19_208336_c1 3300050514 Bacteria 1342
359 Ga0500610_0085254 3300053079 Unclassified 1645
360 Ga0495655_0011651 3300053083 Bacteria 1773
361 Ga0495655_0031473 3300053083 Bacteria 1291
362 Ga0500607_096655 3300053121 Bacteria 1475
363 Ga0500608_003419 3300053122 Bacteria 5949
364 Ga0500626_030009 3300053128 Bacteria 2453
365 Ga0500559_0002730 3300053136 Bacteria 8959
366 Ga0500574_010095 3300053141 Bacteria 2080
367 Ga0500609_007252 3300053731 Unclassified 1497
368 Ga0501084_0213422 3300054114 Bacteria 1628
369 Ga0501082_0219282 3300060353 Bacteria 1655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053083 Ga0495655_0031473 Ga0495655_0031473_199_1278 303
2 3300046516 Ga0495628_0082522 Ga0495628_0082522_22_1119 309
3 3300002155 JGI24033J26618_1004065 JGI24033J26618_10040652 318
4 3300042120 Ga0450917_002250 Ga0450917_002250_35_1162 318
5 3300050514 nmdc:mga08x19_208336_c1 nmdc:mga08x19_208336_c1_176_1306 320
6 3300035695 Ga0373927_0143417 Ga0373927_0143417_20_1156 322
7 3300046538 Ga0495609_0072985 Ga0495609_0072985_312_1454 322
8 3300025960 Ga0207651_10012804 Ga0207651_100128041 340
9 3300006844 Ga0075428_100345253 Ga0075428_1003452532 343
10 3300005295 Ga0065707_10160916 Ga0065707_101609161 344
11 3300025919 Ga0207657_10031127 Ga0207657_100311275 350
12 3300049577 Ga0501041_0141320 Ga0501041_0141320_15_1301 351
13 3300038996 Ga0242420_009553 Ga0242420_009553_222_1538 356
14 3300053079 Ga0500610_0085254 Ga0500610_0085254_78_1367 356
15 3300053731 Ga0500609_007252 Ga0500609_007252_187_1476 356
16 3300005295 Ga0065707_10000686 Ga0065707_100006863 357
17 3300005444 Ga0070694_100129206 Ga0070694_1001292061 357
18 3300005545 Ga0070695_100140868 Ga0070695_1001408681 357
19 3300045051 Ga0451576_0304056 Ga0451576_0304056_193_1515 357
20 3300046529 Ga0495652_0114454 Ga0495652_0114454_611_1855 359
21 3300046533 Ga0495640_0106053 Ga0495640_0106053_570_1814 359
22 3300046689 Ga0495613_0040105 Ga0495613_0040105_1623_2942 362
23 3300047319 Ga0495674_0140398 Ga0495674_0140398_400_1680 362
24 3300053122 Ga0500608_003419 Ga0500608_003419_4351_5613 362
25 3300025315 Ga0207697_10013905 Ga0207697_100139052 363
26 3300049575 Ga0501039_0174323 Ga0501039_0174323_145_1422 363
27 3300049824 Ga0501045_0138199 Ga0501045_0138199_412_1689 363
28 3300009551 Ga0105238_10198703 Ga0105238_101987032 364
29 3300025924 Ga0207694_10141066 Ga0207694_101410661 364
30 3300046506 Ga0495583_0078830 Ga0495583_0078830_113_1402 365
31 3300046689 Ga0495613_0194924 Ga0495613_0194924_113_1402 365
32 3300047315 Ga0495581_0155985 Ga0495581_0155985_31_1320 365
33 3300049460 Ga0495682_0046298 Ga0495682_0046298_33_1322 365
34 3300042530 Ga0450916_001499 Ga0450916_001499_636_1922 366
35 3300005435 Ga0070714_100167001 Ga0070714_1001670011 367
36 3300027682 Ga0209971_1005407 Ga0209971_10054072 367
37 3300041410 Ga0439461_0003040 Ga0439461_0003040_360_1634 367
38 3300042000 Ga0439437_002287 Ga0439437_002287_589_1863 367
39 3300042118 Ga0450914_000550 Ga0450914_000550_381_1655 367
40 3300042126 Ga0450888_001430 Ga0450888_001430_829_2103 367
41 3300042130 Ga0450892_001877 Ga0450892_001877_279_1553 367
42 3300042139 Ga0450904_003177 Ga0450904_003177_201_1475 367
43 3300042532 Ga0450893_0000870 Ga0450893_0000870_892_2166 367
44 3300042533 Ga0450901_001291 Ga0450901_001291_1257_2531 367
45 3300042993 Ga0439440_0017447 Ga0439440_0017447_142_1416 367
46 3300005457 Ga0070662_100049587 Ga0070662_1000495872 368
47 3300005564 Ga0070664_100013566 Ga0070664_1000135664 368
48 3300014745 Ga0157377_10032738 Ga0157377_100327381 368
49 3300025942 Ga0207689_10088249 Ga0207689_100882491 368
50 3300025945 Ga0207679_10052728 Ga0207679_100527281 368
51 3300026075 Ga0207708_10058449 Ga0207708_100584491 368
52 3300031901 Ga0307406_10062595 Ga0307406_100625952 368
53 3300032002 Ga0307416_100205003 Ga0307416_1002050032 368
54 3300041408 Ga0439453_0001763 Ga0439453_0001763_1392_2678 368
55 3300042000 Ga0439437_002634 Ga0439437_002634_488_1774 368
56 3300042001 Ga0439441_002562 Ga0439441_002562_589_1875 368
57 3300042003 Ga0439443_000882 Ga0439443_000882_1529_2815 368
58 3300042011 Ga0439454_000414 Ga0439454_000414_346_1632 368
59 3300042013 Ga0439456_005911 Ga0439456_005911_1028_2314 368
60 3300042126 Ga0450888_000902 Ga0450888_000902_174_1460 368
61 3300042142 Ga0450905_005314 Ga0450905_005314_304_1590 368
62 3300042436 Ga0439435_0020791 Ga0439435_0020791_181_1467 368
63 3300042437 Ga0439444_0006999 Ga0439444_0006999_322_1608 368
64 3300042439 Ga0439464_0007436 Ga0439464_0007436_1415_2701 368
65 3300042461 Ga0439460_0018768 Ga0439460_0018768_409_1695 368
66 3300042532 Ga0450893_0002429 Ga0450893_0002429_247_1533 368
67 3300042993 Ga0439440_0003858 Ga0439440_0003858_1445_2731 368
68 3300048916 Ga0496113_0210757 Ga0496113_0210757_227_1513 368
69 3300050508 nmdc:mga09592_243139_c1 nmdc:mga09592_243139_c1_113_1399 368
70 3300003762 Ga0055542_1008917 Ga0055542_10089172 369
71 3300025228 Ga0209672_102611 Ga0209672_1026113 369
72 3300025242 Ga0209258_107952 Ga0209258_1079521 369
73 3300025246 Ga0209646_1006327 Ga0209646_10063271 369
74 3300025250 Ga0209026_1009955 Ga0209026_10099551 369
75 3300025254 Ga0209148_1003311 Ga0209148_10033113 369
76 3300025256 Ga0209759_1020199 Ga0209759_10201991 369
77 3300025272 Ga0209455_1017124 Ga0209455_10171241 369
78 3300026116 Ga0207674_10222266 Ga0207674_102222662 369
79 3300039447 Ga0436361_0074117 Ga0436361_0074117_298_1578 369
80 3300048915 Ga0496112_0213081 Ga0496112_0213081_479_1759 369
81 3300042118 Ga0450914_000941 Ga0450914_000941_158_1483 370
82 3300002705 JGI25156J39149_1012890 JGI25156J39149_10128902 371
83 3300002738 JGI25154J39366_1007552 JGI25154J39366_10075521 371
84 3300003760 Ga0055527_1004444 Ga0055527_10044441 371
85 3300003761 Ga0055535_1010387 Ga0055535_10103871 371
86 3300003763 Ga0055529_1007123 Ga0055529_10071231 371
87 3300005455 Ga0070663_100078240 Ga0070663_1000782401 371
88 3300006353 Ga0075370_10054104 Ga0075370_100541042 371
89 3300026067 Ga0207678_10107394 Ga0207678_101073942 371
90 3300046690 Ga0495624_0024875 Ga0495624_0024875_1160_2440 371
91 3300050496 nmdc:mga07m45_14499_c1 nmdc:mga07m45_14499_c1_1732_3048 371
92 3300053083 Ga0495655_0011651 Ga0495655_0011651_112_1419 371
93 3300046528 Ga0495642_0008749 Ga0495642_0008749_2356_3687 372
94 3300048910 Ga0496107_0207529 Ga0496107_0207529_157_1443 372
95 3300053121 Ga0500607_096655 Ga0500607_096655_170_1456 372
96 3300009148 Ga0105243_10139815 Ga0105243_101398151 373
97 3300042009 Ga0439451_003109 Ga0439451_003109_209_1495 373
98 3300046511 Ga0495608_0099862 Ga0495608_0099862_379_1701 373
99 3300027252 Ga0209973_1001040 Ga0209973_10010402 374
100 3300027717 Ga0209998_10009221 Ga0209998_100092212 374
101 3300027876 Ga0209974_10001448 Ga0209974_100014489 374
102 3300037471 Ga0395905_0273149 Ga0395905_0273149_118_1416 374
103 3300044706 Ga0466964_0039960 Ga0466964_0039960_198_1496 374
104 3300045976 Ga0466967_0093550 Ga0466967_0093550_691_1989 374
105 3300046472 Ga0495580_0175480 Ga0495580_0175480_128_1447 375
106 3300047320 Ga0495672_0096514 Ga0495672_0096514_215_1534 375
107 3300003771 Ga0055526_1026027 Ga0055526_10260272 376
108 3300003771 Ga0055526_1030232 Ga0055526_10302321 376
109 3300003773 Ga0055537_1014528 Ga0055537_10145281 376
110 3300003775 Ga0055524_1027369 Ga0055524_10273692 376
111 3300003775 Ga0055524_1029476 Ga0055524_10294761 376
112 3300003784 Ga0055534_1015087 Ga0055534_10150871 376
113 3300003790 Ga0055528_1030532 Ga0055528_10305321 376
114 3300005339 Ga0070660_100003463 Ga0070660_1000034639 376
115 3300005539 Ga0068853_100183599 Ga0068853_1001835992 376
116 3300006871 Ga0075434_100207491 Ga0075434_1002074912 376
117 3300006948 Ga0099826_10126166 Ga0099826_101261661 376
118 3300013307 Ga0157372_10150678 Ga0157372_101506781 376
119 3300025263 Ga0209565_1019889 Ga0209565_10198891 376
120 3300025273 Ga0209673_1037420 Ga0209673_10374201 376
121 3300025291 Ga0209675_1026836 Ga0209675_10268361 376
122 3300025295 Ga0209564_1014546 Ga0209564_10145462 376
123 3300025299 Ga0209256_1011122 Ga0209256_10111222 376
124 3300025919 Ga0207657_10207918 Ga0207657_102079182 376
125 3300027666 Ga0209282_1011632 Ga0209282_10116325 376
126 3300050512 nmdc:mga0n895_196313_c1 nmdc:mga0n895_196313_c1_306_1610 376
127 3300046463 Ga0495653_0104987 Ga0495653_0104987_462_1787 377
128 3300046516 Ga0495628_0121934 Ga0495628_0121934_76_1401 377
129 3300046517 Ga0495630_0151830 Ga0495630_0151830_182_1507 377
130 3300046690 Ga0495624_0013266 Ga0495624_0013266_4051_5376 377
131 3300047673 Ga0495593_0014799 Ga0495593_0014799_2940_4265 377
132 3300048089 Ga0495614_0059467 Ga0495614_0059467_236_1561 377
133 3300049742 Ga0501080_0104606 Ga0501080_0104606_824_2137 377
134 3300006195 Ga0075366_10078446 Ga0075366_100784462 378
135 3300028786 Ga0307517_10132113 Ga0307517_101321131 378
136 3300035114 Ga0373939_0023484 Ga0373939_0023484_249_1574 378
137 3300050493 nmdc:mga0k408_64031_c1 nmdc:mga0k408_64031_c1_122_1426 378
138 3300005577 Ga0068857_100187589 Ga0068857_1001875892 379
139 3300046615 Ga0495656_0080726 Ga0495656_0080726_21_1271 379
140 3300005355 Ga0070671_100197363 Ga0070671_1001973632 380
141 3300005434 Ga0070709_10094988 Ga0070709_100949881 380
142 3300005436 Ga0070713_100175225 Ga0070713_1001752251 380
143 3300005437 Ga0070710_10121293 Ga0070710_101212931 380
144 3300005439 Ga0070711_100133594 Ga0070711_1001335942 380
145 3300005445 Ga0070708_100215968 Ga0070708_1002159681 380
146 3300005841 Ga0068863_100187970 Ga0068863_1001879702 380
147 3300006163 Ga0070715_10053036 Ga0070715_100530362 380
148 3300006173 Ga0070716_100102520 Ga0070716_1001025201 380
149 3300009093 Ga0105240_10278060 Ga0105240_102780602 380
150 3300009174 Ga0105241_10189948 Ga0105241_101899481 380
151 3300009177 Ga0105248_10214724 Ga0105248_102147242 380
152 3300009551 Ga0105238_10351614 Ga0105238_103516141 380
153 3300024225 Ga0224572_1017396 Ga0224572_10173961 380
154 3300025735 Ga0207713_1053642 Ga0207713_10536421 380
155 3300025905 Ga0207685_10053609 Ga0207685_100536091 380
156 3300025906 Ga0207699_10115531 Ga0207699_101155311 380
157 3300025915 Ga0207693_10137075 Ga0207693_101370751 380
158 3300025924 Ga0207694_10206673 Ga0207694_102066731 380
159 3300025929 Ga0207664_10210959 Ga0207664_102109592 380
160 3300025939 Ga0207665_10158836 Ga0207665_101588361 380
161 3300025941 Ga0207711_10266472 Ga0207711_102664721 380
162 3300031665 Ga0316575_10047715 Ga0316575_100477152 380
163 3300031691 Ga0316579_10061224 Ga0316579_100612242 380
164 3300031728 Ga0316578_10110270 Ga0316578_101102702 380
165 3300033529 Ga0316587_1000496 Ga0316587_10004964 380
166 3300036647 Ga0316582_0045263 Ga0316582_0045263_1206_2528 380
167 3300039447 Ga0436361_0171722 Ga0436361_0171722_95_1417 380
168 3300048904 Ga0496101_0180499 Ga0496101_0180499_62_1384 380
169 3300048907 Ga0496104_0159950 Ga0496104_0159950_233_1555 380
170 3300048908 Ga0496105_0212030 Ga0496105_0212030_172_1494 380
171 3300048915 Ga0496112_0282567 Ga0496112_0282567_130_1452 380
172 3300048916 Ga0496113_0196957 Ga0496113_0196957_224_1546 380
173 3300048918 Ga0496115_0208912 Ga0496115_0208912_208_1530 380
174 3300049575 Ga0501039_0116087 Ga0501039_0116087_38_1360 380
175 3300049577 Ga0501041_0115640 Ga0501041_0115640_163_1485 380
176 3300049578 Ga0501042_0161386 Ga0501042_0161386_277_1599 380
177 3300049588 Ga0501072_0044770 Ga0501072_0044770_634_1956 380
178 3300049590 Ga0501074_0202814 Ga0501074_0202814_47_1369 380
179 3300049591 Ga0501075_0151798 Ga0501075_0151798_126_1448 380
180 3300049593 Ga0501077_0140692 Ga0501077_0140692_181_1503 380
181 3300049741 Ga0501079_0243929 Ga0501079_0243929_15_1337 380
182 3300049742 Ga0501080_0294489 Ga0501080_0294489_61_1383 380
183 3300049744 Ga0501083_0124345 Ga0501083_0124345_132_1454 380
184 3300054114 Ga0501084_0213422 Ga0501084_0213422_139_1461 380
185 iso_pu_bacteria 2643221603 2644029583 380
186 3300005327 Ga0070658_10189259 Ga0070658_101892591 381
187 3300005435 Ga0070714_100012033 Ga0070714_1000120336 381
188 3300005457 Ga0070662_100093149 Ga0070662_1000931492 381
189 3300005563 Ga0068855_100342516 Ga0068855_1003425161 381
190 3300009093 Ga0105240_10198339 Ga0105240_101983391 381
191 3300013104 Ga0157370_10291314 Ga0157370_102913141 381
192 3300013105 Ga0157369_10171621 Ga0157369_101716213 381
193 3300025909 Ga0207705_10160397 Ga0207705_101603971 381
194 3300025913 Ga0207695_10237984 Ga0207695_102379841 381
195 3300025929 Ga0207664_10019000 Ga0207664_100190001 381
196 3300027665 Ga0209983_1020296 Ga0209983_10202961 381
197 3300027876 Ga0209974_10035522 Ga0209974_100355221 381
198 3300048909 Ga0496106_0174533 Ga0496106_0174533_175_1503 381
199 3300003792 Ga0055540_1007059 Ga0055540_10070594 382
200 3300005327 Ga0070658_10169543 Ga0070658_101695432 382
201 3300005330 Ga0070690_100015328 Ga0070690_1000153281 382
202 3300005456 Ga0070678_100177430 Ga0070678_1001774302 382
203 3300005539 Ga0068853_100084541 Ga0068853_1000845412 382
204 3300005563 Ga0068855_100002393 Ga0068855_1000023931 382
205 3300005563 Ga0068855_100157847 Ga0068855_1001578472 382
206 3300005563 Ga0068855_100198017 Ga0068855_1001980173 382
207 3300005577 Ga0068857_100080913 Ga0068857_1000809132 382
208 3300005578 Ga0068854_100094989 Ga0068854_1000949892 382
209 3300005614 Ga0068856_100254256 Ga0068856_1002542562 382
210 3300005616 Ga0068852_100241218 Ga0068852_1002412182 382
211 3300006058 Ga0075432_10031501 Ga0075432_100315012 382
212 3300007076 Ga0075435_100201534 Ga0075435_1002015341 382
213 3300009093 Ga0105240_10368094 Ga0105240_103680941 382
214 3300009545 Ga0105237_10112206 Ga0105237_101122061 382
215 3300010375 Ga0105239_10082768 Ga0105239_100827682 382
216 3300013104 Ga0157370_10103409 Ga0157370_101034093 382
217 3300025272 Ga0209455_1014973 Ga0209455_10149732 382
218 3300025303 Ga0209051_1011651 Ga0209051_10116514 382
219 3300025909 Ga0207705_10203433 Ga0207705_102034331 382
220 3300025913 Ga0207695_10301588 Ga0207695_103015881 382
221 3300025924 Ga0207694_10201812 Ga0207694_102018121 382
222 3300025934 Ga0207686_10151022 Ga0207686_101510221 382
223 3300025949 Ga0207667_10014927 Ga0207667_100149271 382
224 3300025949 Ga0207667_10155950 Ga0207667_101559501 382
225 3300025949 Ga0207667_10182259 Ga0207667_101822591 382
226 3300026041 Ga0207639_10259093 Ga0207639_102590931 382
227 3300026116 Ga0207674_10214670 Ga0207674_102146701 382
228 3300026118 Ga0207675_100049434 Ga0207675_1000494344 382
229 3300026121 Ga0207683_10225483 Ga0207683_102254831 382
230 3300026142 Ga0207698_10172117 Ga0207698_101721171 382
231 3300031456 Ga0307513_10223971 Ga0307513_102239712 382
232 3300033180 Ga0307510_10175049 Ga0307510_101750492 382
233 3300037466 Ga0395898_0261017 Ga0395898_0261017_72_1406 382
234 3300050513 nmdc:mga0rr50_239225_c1 nmdc:mga0rr50_239225_c1_177_1493 382
235 3300025928 Ga0207700_10048100 Ga0207700_100481003 383
236 3300031247 Ga0265340_10030600 Ga0265340_100306003 383
237 3300031344 Ga0265316_10063413 Ga0265316_100634133 383
238 3300031712 Ga0265342_10111306 Ga0265342_101113061 383
239 3300046557 Ga0495622_0000088 Ga0495622_0000088_28037_29368 383
240 3300049568 Ga0501031_0140302 Ga0501031_0140302_179_1501 383
241 3300049572 Ga0501036_0197699 Ga0501036_0197699_329_1651 383
242 3300049822 Ga0501035_0210955 Ga0501035_0210955_140_1462 383
243 3300002126 JGI24035J26624_1003938 JGI24035J26624_10039381 384
244 3300002244 JGI24742J22300_10001999 JGI24742J22300_100019993 384
245 3300003323 rootH1_10163812 rootH1_101638121 384
246 3300005293 Ga0065715_10012785 Ga0065715_100127852 384
247 3300005295 Ga0065707_10176848 Ga0065707_101768481 384
248 3300005328 Ga0070676_10020200 Ga0070676_100202002 384
249 3300005333 Ga0070677_10001085 Ga0070677_1000108511 384
250 3300005338 Ga0068868_100033565 Ga0068868_1000335654 384
251 3300005344 Ga0070661_100159883 Ga0070661_1001598832 384
252 3300005347 Ga0070668_100200967 Ga0070668_1002009671 384
253 3300005365 Ga0070688_100127970 Ga0070688_1001279701 384
254 3300005366 Ga0070659_100113405 Ga0070659_1001134052 384
255 3300005367 Ga0070667_100014688 Ga0070667_1000146881 384
256 3300005455 Ga0070663_100100784 Ga0070663_1001007841 384
257 3300005455 Ga0070663_100249215 Ga0070663_1002492151 384
258 3300005457 Ga0070662_100008731 Ga0070662_1000087315 384
259 3300005457 Ga0070662_100190813 Ga0070662_1001908131 384
260 3300005459 Ga0068867_100206744 Ga0068867_1002067441 384
261 3300005466 Ga0070685_10049765 Ga0070685_100497652 384
262 3300005548 Ga0070665_100193499 Ga0070665_1001934992 384
263 3300005564 Ga0070664_100123687 Ga0070664_1001236873 384
264 3300005615 Ga0070702_100009331 Ga0070702_1000093314 384
265 3300005616 Ga0068852_100075768 Ga0068852_1000757682 384
266 3300005616 Ga0068852_100162602 Ga0068852_1001626022 384
267 3300005617 Ga0068859_100281912 Ga0068859_1002819122 384
268 3300005842 Ga0068858_100165396 Ga0068858_1001653961 384
269 3300006195 Ga0075366_10070728 Ga0075366_100707282 384
270 3300006881 Ga0068865_100074295 Ga0068865_1000742952 384
271 3300006931 Ga0097620_100281893 Ga0097620_1002818932 384
272 3300009101 Ga0105247_10102070 Ga0105247_101020702 384
273 3300009177 Ga0105248_10169574 Ga0105248_101695741 384
274 3300009177 Ga0105248_10444727 Ga0105248_104447271 384
275 3300013297 Ga0157378_10142269 Ga0157378_101422693 384
276 3300013306 Ga0163162_10177398 Ga0163162_101773982 384
277 3300013308 Ga0157375_10322010 Ga0157375_103220101 384
278 3300014326 Ga0157380_10174757 Ga0157380_101747571 384
279 3300014497 Ga0182008_10055590 Ga0182008_100555901 384
280 3300014745 Ga0157377_10046816 Ga0157377_100468162 384
281 3300017792 Ga0163161_10019381 Ga0163161_100193811 384
282 3300021384 Ga0213876_10067893 Ga0213876_100678932 384
283 3300025315 Ga0207697_10007690 Ga0207697_100076901 384
284 3300025315 Ga0207697_10039474 Ga0207697_100394742 384
285 3300025893 Ga0207682_10000730 Ga0207682_1000073017 384
286 3300025893 Ga0207682_10034273 Ga0207682_100342731 384
287 3300025901 Ga0207688_10063569 Ga0207688_100635692 384
288 3300025903 Ga0207680_10096051 Ga0207680_100960511 384
289 3300025907 Ga0207645_10117996 Ga0207645_101179962 384
290 3300025918 Ga0207662_10077217 Ga0207662_100772172 384
291 3300025923 Ga0207681_10176524 Ga0207681_101765241 384
292 3300025923 Ga0207681_10189193 Ga0207681_101891931 384
293 3300025926 Ga0207659_10042949 Ga0207659_100429492 384
294 3300025932 Ga0207690_10095685 Ga0207690_100956852 384
295 3300025933 Ga0207706_10115846 Ga0207706_101158462 384
296 3300025933 Ga0207706_10119913 Ga0207706_101199132 384
297 3300025937 Ga0207669_10076009 Ga0207669_100760091 384
298 3300025938 Ga0207704_10105931 Ga0207704_101059311 384
299 3300025941 Ga0207711_10008804 Ga0207711_100088045 384
300 3300025941 Ga0207711_10266228 Ga0207711_102662281 384
301 3300025945 Ga0207679_10191870 Ga0207679_101918701 384
302 3300025945 Ga0207679_10218582 Ga0207679_102185821 384
303 3300025945 Ga0207679_10233009 Ga0207679_102330091 384
304 3300025972 Ga0207668_10210646 Ga0207668_102106461 384
305 3300026023 Ga0207677_10166611 Ga0207677_101666111 384
306 3300026035 Ga0207703_10245516 Ga0207703_102455161 384
307 3300026067 Ga0207678_10284281 Ga0207678_102842811 384
308 3300026075 Ga0207708_10221862 Ga0207708_102218621 384
309 3300026088 Ga0207641_10274329 Ga0207641_102743291 384
310 3300026088 Ga0207641_10280671 Ga0207641_102806711 384
311 3300026089 Ga0207648_10090041 Ga0207648_100900413 384
312 3300026095 Ga0207676_10017021 Ga0207676_100170216 384
313 3300026118 Ga0207675_100034315 Ga0207675_1000343153 384
314 3300026142 Ga0207698_10049899 Ga0207698_100498992 384
315 3300026142 Ga0207698_10117810 Ga0207698_101178103 384
316 3300031731 Ga0307405_10079123 Ga0307405_100791231 384
317 3300031838 Ga0307518_10101319 Ga0307518_101013192 384
318 3300039437 Ga0436365_1371508 Ga0436365_1371508_185_1483 384
319 3300039438 Ga0436360_0563443 Ga0436360_0563443_266_1615 384
320 3300046454 Ga0495592_0070265 Ga0495592_0070265_192_1514 384
321 3300046457 Ga0495590_0044626 Ga0495590_0044626_181_1500 384
322 3300046459 Ga0495629_0114248 Ga0495629_0114248_269_1624 384
323 3300046459 Ga0495629_0147198 Ga0495629_0147198_191_1513 384
324 3300046462 Ga0495651_0155418 Ga0495651_0155418_198_1520 384
325 3300046476 Ga0495662_0086636 Ga0495662_0086636_22_1344 384
326 3300046477 Ga0495664_0046207 Ga0495664_0046207_858_2180 384
327 3300046500 Ga0495596_0040287 Ga0495596_0040287_188_1510 384
328 3300046514 Ga0495618_0126998 Ga0495618_0126998_231_1589 384
329 3300046529 Ga0495652_0156735 Ga0495652_0156735_187_1509 384
330 3300046530 Ga0495654_0062361 Ga0495654_0062361_308_1630 384
331 3300046535 Ga0495586_0038751 Ga0495586_0038751_1084_2406 384
332 3300046536 Ga0495587_0043468 Ga0495587_0043468_1239_2594 384
333 3300046537 Ga0495598_0026906 Ga0495598_0026906_189_1511 384
334 3300046539 Ga0495621_0015939 Ga0495621_0015939_329_1651 384
335 3300046539 Ga0495621_0026390 Ga0495621_0026390_283_1608 384
336 3300046539 Ga0495621_0043263 Ga0495621_0043263_77_1399 384
337 3300046543 Ga0495645_0046241 Ga0495645_0046241_1579_2901 384
338 3300046678 Ga0495599_0039716 Ga0495599_0039716_1458_2780 384
339 3300046679 Ga0495623_0060666 Ga0495623_0060666_895_2217 384
340 3300046680 Ga0495646_0012963 Ga0495646_0012963_438_1760 384
341 3300046809 Ga0495600_0135287 Ga0495600_0135287_115_1437 384
342 3300047319 Ga0495674_0131848 Ga0495674_0131848_710_2032 384
343 3300047443 Ga0495687_062159 Ga0495687_062159_61_1383 384
344 3300047444 Ga0495675_0128857 Ga0495675_0128857_85_1407 384
345 3300047470 Ga0495681_0070690 Ga0495681_0070690_135_1469 384
346 3300047470 Ga0495681_0071012 Ga0495681_0071012_186_1508 384
347 3300047673 Ga0495593_0088370 Ga0495593_0088370_150_1472 384
348 3300048090 Ga0495615_0011245 Ga0495615_0011245_306_1634 384
349 3300048090 Ga0495615_0015459 Ga0495615_0015459_113_1435 384
350 3300048904 Ga0496101_0188851 Ga0496101_0188851_238_1560 384
351 3300048905 Ga0496102_0247856 Ga0496102_0247856_144_1472 384
352 3300048907 Ga0496104_0128202 Ga0496104_0128202_573_1895 384
353 3300048908 Ga0496105_0136652 Ga0496105_0136652_432_1754 384
354 3300048909 Ga0496106_0168791 Ga0496106_0168791_275_1597 384
355 3300048913 Ga0496110_0061039 Ga0496110_0061039_163_1491 384
356 3300048913 Ga0496110_0136616 Ga0496110_0136616_516_1844 384
357 3300048913 Ga0496110_0157662 Ga0496110_0157662_176_1498 384
358 3300048914 Ga0496111_0115429 Ga0496111_0115429_542_1864 384
359 3300048916 Ga0496113_0075654 Ga0496113_0075654_522_1844 384
360 3300048917 Ga0496114_0193014 Ga0496114_0193014_333_1655 384
361 3300048918 Ga0496115_0188284 Ga0496115_0188284_117_1436 384
362 3300048928 Ga0496125_0020080 Ga0496125_0020080_120_1442 384
363 3300049581 Ga0501047_0248267 Ga0501047_0248267_283_1608 384
364 3300049586 Ga0501070_0115107 Ga0501070_0115107_708_2033 384
365 3300050493 nmdc:mga0k408_106323_c1 nmdc:mga0k408_106323_c1_308_1630 384
366 3300050496 nmdc:mga07m45_21714_c1 nmdc:mga07m45_21714_c1_2114_3439 384
367 3300053128 Ga0500626_030009 Ga0500626_030009_950_2275 384
368 3300053136 Ga0500559_0002730 Ga0500559_0002730_2691_4016 384
369 3300053141 Ga0500574_010095 Ga0500574_010095_696_2021 384
370 3300060353 Ga0501082_0219282 Ga0501082_0219282_214_1539 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05598

DUF772

Transposase domain (DUF772)

67

136

0.96

PF13751

DDE_Tnp_1_6

Transposase DDE domain

365

447

0.92

PF01609

DDE_Tnp_1

Transposase DDE domain

262

443

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i4a-assembly2.cif.gz_C x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna 0.6253 225 295
5i4a-assembly1.cif.gz_A x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna 0.6127 225 295
5ux0-assembly1.cif.gz_A x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna and target dna 0.6021 225 295
5guh-assembly1.cif.gz_A crystal structure of silkworm piwi-clade argonaute siwi bound to pirna 0.5973 225 295
6oon-assembly1.cif.gz_A human argonaute4 bound to guide rna 0.5559 225 275
ID Description Score Start End Superfamily
af_Q2FXN1_1_235_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.805 217 374 3.30.420.10
af_A0A1D8PCX0_531_672_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7577 221 246 2.60.40.150
af_E9P851_289_424_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7459 226 250 2.60.40.150
af_O50414_43_217_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7299 198 374 3.30.420.10
af_O50414_43_217_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7032 198 374 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A0K8P8L5-F1-model_v4 Mobile element protein 0.9278 215 382
AF-T1BAS4-F1-model_v4 Transposase IS4 family protein 0.9187 21 134
AF-A0A0K8P8L5-F1-model_v4 Mobile element protein 0.917 215 382
AF-A0A6L5F159-F1-model_v4 IS1182 family transposase 0.8918 21 134
AF-A0A250K3U8-F1-model_v4 Transposase 0.8862 5 123

Feature Viewer

pLDDT pTM Quality
81.64 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map