F425513

General Info

Members Datasets Scaffolds Average Seq Length
370 240 367 74

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000276|Ga0495606_0000276_73438_73695
Length 85
Sequence MRQRFHIMATEDKMQKVSFELNGEFVELNQLLKLAGLCDSGGAGKQIVASGDVKVDGKQELRKTAKIRAGQQVSVGDVRISVVAA

Samples

Sample ID Description Type Environment
1 2643221695 Lysobacter sp. Root494 Isolate Unclassified
2 2919513703 Luteimonas sp. 3794 Isolate Unclassified
3 2919675420 Luteimonas terrae 4099 Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
55 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
56 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
218 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
219 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
222 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
223 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
227 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
239 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.54
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.59
Nodule 0.54
Rhizoplane 4.32
Rhizosphere 67.57
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10009141 3300001989 Bacteria 3697
2 JGI24735J21928_10100314 3300002067 Bacteria 831
3 JGI25156J39149_1011524 3300002705 Bacteria 1993
4 JGI25162J39368_1000765 3300002737 Bacteria 21737
5 JGI25162J39368_1001305 3300002737 Bacteria 14046
6 JGI25162J39368_1002278 3300002737 Bacteria 7739
7 JGI25154J39366_1010331 3300002738 Bacteria 1109
8 JGI25157J39369_1001444 3300002741 Bacteria 8923
9 JGI25157J39369_1002286 3300002741 Bacteria 5070
10 JGI25164J39214_1000149 3300002772 Bacteria 67364
11 JGI25164J39214_1000663 3300002772 Bacteria 14046
12 JGI25164J39214_1000732 3300002772 Bacteria 12289
13 JGI25165J46597_1000088 3300003214 Bacteria 169821
14 JGI25165J46597_1001316 3300003214 Bacteria 14046
15 JGI25165J46597_1002023 3300003214 Bacteria 7717
16 rootH2_10000275 3300003320 Bacteria 56950
17 Ga0006562J51391_1018790 3300003578 Bacteria 2145
18 Ga0055539_1000774 3300003752 Bacteria 7695
19 Ga0055525_1000242 3300003759 Bacteria 55608
20 Ga0055527_1000063 3300003760 Bacteria 89044
21 Ga0055527_1004746 3300003760 Bacteria 1834
22 Ga0055535_1000175 3300003761 Bacteria 68715
23 Ga0055535_1000406 3300003761 Bacteria 40592
24 Ga0055542_1000146 3300003762 Bacteria 88772
25 Ga0055542_1000155 3300003762 Bacteria 86663
26 Ga0055529_1000182 3300003763 Bacteria 86667
27 Ga0055529_1000597 3300003763 Bacteria 28068
28 Ga0055526_1000176 3300003771 Bacteria 56708
29 Ga0065715_10028338 3300005293 Bacteria 1377
30 Ga0065715_10972907 3300005293 Bacteria 549
31 Ga0070658_10002745 3300005327 Bacteria 14655
32 Ga0068869_100002466 3300005334 Bacteria 11157
33 Ga0070666_10000005 3300005335 Bacteria 343092
34 Ga0070661_100121584 3300005344 Bacteria 1956
35 Ga0070668_100071129 3300005347 Bacteria 2710
36 Ga0070668_101825641 3300005347 Bacteria 559
37 Ga0070675_101468041 3300005354 Bacteria 629
38 Ga0070659_100305237 3300005366 Bacteria 1328
39 Ga0070667_101922067 3300005367 Bacteria 557
40 Ga0070714_100007079 3300005435 Bacteria 8699
41 Ga0070713_100023851 3300005436 Bacteria 4755
42 Ga0070663_100093513 3300005455 Bacteria 2231
43 Ga0070662_100374247 3300005457 Bacteria 1171
44 Ga0070679_100448279 3300005530 Bacteria 1235
45 Ga0070665_100001925 3300005548 Bacteria 23425
46 Ga0068855_100138059 3300005563 Bacteria 2780
47 Ga0068855_100322719 3300005563 Bacteria 1706
48 Ga0068857_100006575 3300005577 Bacteria 9978
49 Ga0068854_100002097 3300005578 Bacteria 12219
50 Ga0068854_100058609 3300005578 Bacteria 2780
51 Ga0068856_100568779 3300005614 Bacteria 1155
52 Ga0068852_100008252 3300005616 Bacteria 7659
53 Ga0068859_100129457 3300005617 Bacteria 2595
54 Ga0068851_10248621 3300005834 Bacteria 1008
55 Ga0068858_100089398 3300005842 Bacteria 2866
56 Ga0068860_100181992 3300005843 Bacteria 2031
57 Ga0075364_10008154 3300006051 Bacteria 6252
58 Ga0075364_10118118 3300006051 Bacteria 1774
59 Ga0075364_10528069 3300006051 Bacteria 807
60 Ga0097620_100129460 3300006931 Bacteria 2595
61 Ga0099826_10000005 3300006948 Bacteria 465206
62 Ga0105244_10001128 3300009036 Bacteria 22199
63 Ga0105240_10000343 3300009093 Bacteria 87196
64 Ga0105240_10000525 3300009093 Bacteria 70614
65 Ga0105240_10011192 3300009093 Bacteria 12520
66 Ga0105240_10206031 3300009093 Bacteria 2302
67 Ga0105240_10350573 3300009093 Bacteria 1675
68 Ga0105240_12668316 3300009093 Bacteria 516
69 Ga0105237_10000026 3300009545 Bacteria 212619
70 Ga0105238_10000060 3300009551 Bacteria 129934
71 Ga0105238_11776098 3300009551 Bacteria 648
72 Ga0105249_10066966 3300009553 Bacteria 3307
73 Ga0105249_10299111 3300009553 Bacteria 1613
74 Ga0105239_10000020 3300010375 Bacteria 264435
75 Ga0105239_10011493 3300010375 Bacteria 9874
76 Ga0157345_1027280 3300012498 Bacteria 620
77 Ga0157314_1000831 3300012500 Bacteria 2593
78 Ga0157347_1023439 3300012502 Bacteria 736
79 Ga0157373_10340587 3300013100 Bacteria 1069
80 Ga0157373_10412437 3300013100 Bacteria 969
81 Ga0157371_10180552 3300013102 Bacteria 1510
82 Ga0157370_10057553 3300013104 Bacteria 3696
83 Ga0157370_11689734 3300013104 Bacteria 568
84 Ga0157374_10059635 3300013296 Bacteria 3569
85 Ga0163162_10000060 3300013306 Bacteria 106982
86 Ga0163162_12022224 3300013306 Bacteria 660
87 Ga0157372_12923331 3300013307 Bacteria 547
88 Ga0157375_12130975 3300013308 Bacteria 667
89 Ga0157375_13601170 3300013308 Bacteria 515
90 Ga0182008_10012866 3300014497 Bacteria 4407
91 Ga0182008_10083828 3300014497 Bacteria 1569
92 Ga0182008_10532828 3300014497 Bacteria 650
93 Ga0157379_10522956 3300014968 Bacteria 1101
94 Ga0182006_1039280 3300015261 Bacteria 1868
95 Ga0182006_1060899 3300015261 Bacteria 1425
96 Ga0182007_10012631 3300015262 Bacteria 3242
97 Ga0182007_10112257 3300015262 Bacteria 907
98 Ga0182007_10201019 3300015262 Bacteria 697
99 Ga0209674_103399 3300025226 Bacteria 2944
100 Ga0209672_100007 3300025228 Bacteria 959482
101 Ga0209672_100515 3300025228 Bacteria 21332
102 Ga0209147_120005 3300025229 Bacteria 611
103 Ga0209563_100071 3300025230 Bacteria 232653
104 Ga0207427_100021 3300025231 Bacteria 494115
105 Ga0207427_100115 3300025231 Bacteria 104282
106 Ga0207427_100130 3300025231 Bacteria 94510
107 Ga0209437_100020 3300025233 Bacteria 656374
108 Ga0209437_100079 3300025233 Bacteria 275948
109 Ga0209437_100087 3300025233 Bacteria 253432
110 Ga0209258_100017 3300025242 Bacteria 590785
111 Ga0209258_100275 3300025242 Bacteria 86719
112 Ga0207425_1062408 3300025245 Bacteria 655
113 Ga0209646_1005223 3300025246 Bacteria 2288
114 Ga0209026_1000105 3300025250 Bacteria 150738
115 Ga0209026_1008964 3300025250 Bacteria 2023
116 Ga0209148_1000044 3300025254 Bacteria 458417
117 Ga0209148_1000245 3300025254 Bacteria 86719
118 Ga0209759_1001270 3300025256 Bacteria 15182
119 Ga0209759_1003331 3300025256 Bacteria 6453
120 Ga0209129_1011945 3300025258 Bacteria 2035
121 Ga0209233_1000020 3300025261 Bacteria 798224
122 Ga0209233_1000023 3300025261 Bacteria 738870
123 Ga0209233_1000121 3300025261 Bacteria 233309
124 Ga0209455_1000010 3300025272 Bacteria 959482
125 Ga0209455_1000202 3300025272 Bacteria 86719
126 Ga0209758_1000266 3300025297 Bacteria 104007
127 Ga0207656_10018932 3300025321 Bacteria 2717
128 Ga0207680_10000002 3300025903 Bacteria 1018646
129 Ga0207647_10002132 3300025904 Bacteria 15123
130 Ga0207645_10374944 3300025907 Bacteria 954
131 Ga0207705_10003087 3300025909 Bacteria 12705
132 Ga0207707_10318266 3300025912 Bacteria 1344
133 Ga0207707_11108022 3300025912 Bacteria 645
134 Ga0207695_10000318 3300025913 Bacteria 116126
135 Ga0207695_10000382 3300025913 Bacteria 100524
136 Ga0207695_10008840 3300025913 Bacteria 12542
137 Ga0207695_11678845 3300025913 Bacteria 516
138 Ga0207671_10000041 3300025914 Bacteria 216095
139 Ga0207693_10398467 3300025915 Bacteria 1076
140 Ga0207649_10084674 3300025920 Bacteria 2062
141 Ga0207694_10000197 3300025924 Bacteria 60419
142 Ga0207694_10700152 3300025924 Bacteria 854
143 Ga0207700_10354425 3300025928 Bacteria 1278
144 Ga0207664_10001606 3300025929 Bacteria 14867
145 Ga0207690_10234004 3300025932 Bacteria 1412
146 Ga0207706_10056116 3300025933 Bacteria 3473
147 Ga0207711_10306067 3300025941 Bacteria 1467
148 Ga0207689_10021241 3300025942 Bacteria 5457
149 Ga0207667_10000094 3300025949 Bacteria 145771
150 Ga0207667_10000157 3300025949 Bacteria 101449
151 Ga0207712_10442909 3300025961 Bacteria 1100
152 Ga0207668_10039042 3300025972 Bacteria 3192
153 Ga0207640_10001582 3300025981 Bacteria 12226
154 Ga0207640_10001788 3300025981 Bacteria 11539
155 Ga0207658_11798503 3300025986 Bacteria 559
156 Ga0207703_10268594 3300026035 Bacteria 1544
157 Ga0207639_10898469 3300026041 Bacteria 828
158 Ga0207678_10115794 3300026067 Bacteria 2287
159 Ga0207674_10001266 3300026116 Bacteria 33027
160 Ga0207674_12034479 3300026116 Bacteria 539
161 Ga0209973_1069283 3300027252 Bacteria 550
162 Ga0209282_1000003 3300027666 Bacteria 856377
163 Ga0268266_10000004 3300028379 Bacteria 1495817
164 Ga0268264_10069904 3300028381 Bacteria 2971
165 Ga0316181_1117109 3300030744 Bacteria 972
166 Ga0316182_1197589 3300030745 Bacteria 1138
167 Ga0265332_10280027 3300031238 Bacteria 689
168 Ga0265327_10002234 3300031251 Bacteria 21022
169 Ga0265327_10047689 3300031251 Bacteria 2258
170 Ga0265316_10298055 3300031344 Bacteria 1175
171 Ga0307513_10148737 3300031456 Bacteria 2256
172 Ga0307405_11346421 3300031731 Bacteria 622
173 Ga0307413_10397620 3300031824 Bacteria 1078
174 Ga0307406_10484657 3300031901 Bacteria 999
175 Ga0307412_10889739 3300031911 Bacteria 779
176 Ga0307416_102531466 3300032002 Bacteria 611
177 Ga0307414_10183593 3300032004 Bacteria 1685
178 Ga0307414_10185252 3300032004 Bacteria 1678
179 Ga0307414_11113309 3300032004 Bacteria 729
180 Ga0307414_11744913 3300032004 Bacteria 581
181 Ga0307411_10123742 3300032005 Bacteria 1876
182 Ga0307415_100734819 3300032126 Bacteria 894
183 Ga0307510_10012312 3300033180 Bacteria 10145
184 Ga0395899_0008203 3300037312 Bacteria 8049
185 Ga0395898_0000460 3300037466 Bacteria 81440
186 Ga0395898_0189169 3300037466 Bacteria 1967
187 Ga0395898_0817407 3300037466 Bacteria 872
188 Ga0395901_0270536 3300038443 Bacteria 1767
189 Ga0395901_0336899 3300038443 Bacteria 1559
190 Ga0395901_1732955 3300038443 Bacteria 575
191 Ga0436361_0266436 3300039447 Bacteria 4061
192 Ga0439436_0030622 3300041404 Bacteria 1563
193 Ga0439436_0069015 3300041404 Bacteria 986
194 Ga0439439_0135378 3300041406 Bacteria 693
195 Ga0451791_0408094 3300041451 Unclassified 1414
196 Ga0451791_1379670 3300041451 Bacteria 628
197 Ga0451791_1455614 3300041451 Bacteria 506
198 Ga0451837_0016953 3300041494 Bacteria 3433
199 Ga0451837_0441912 3300041494 Bacteria 813
200 Ga0451837_0733553 3300041494 Bacteria 1913
201 Ga0451843_0708084 3300041509 Bacteria 503
202 Ga0451843_0747783 3300041509 Bacteria 2390
203 Ga0439433_0206477 3300041999 Bacteria 520
204 Ga0439448_0083849 3300042005 Bacteria 1072
205 Ga0439432_001933 3300042006 Bacteria 7824
206 Ga0439432_015768 3300042006 Bacteria 2547
207 Ga0439432_039700 3300042006 Bacteria 1495
208 Ga0439449_0012076 3300042007 Bacteria 3246
209 Ga0439449_0139717 3300042007 Bacteria 901
210 Ga0439449_0299101 3300042007 Bacteria 607
211 Ga0439462_0014244 3300042015 Bacteria 2042
212 Ga0439446_0121539 3300042156 Bacteria 841
213 Ga0466969_0004995 3300044656 Bacteria 7063
214 Ga0466969_0005400 3300044656 Bacteria 6799
215 Ga0466969_0207696 3300044656 Bacteria 892
216 Ga0466989_0320174 3300044663 Bacteria 858
217 Ga0466965_0004502 3300044683 Bacteria 6205
218 Ga0466966_0050484 3300044684 Bacteria 2645
219 Ga0466966_0076016 3300044684 Bacteria 2097
220 Ga0466961_0001259 3300044693 Bacteria 15614
221 Ga0466961_0014605 3300044693 Bacteria 5044
222 Ga0466961_0132861 3300044693 Bacteria 1559
223 Ga0466963_0102938 3300044694 Bacteria 1956
224 Ga0466963_0389866 3300044694 Bacteria 982
225 Ga0466964_0043688 3300044706 Bacteria 1819
226 Ga0466964_0245724 3300044706 Bacteria 880
227 Ga0466971_0009703 3300044719 Bacteria 4201
228 Ga0466971_0500762 3300044719 Bacteria 599
229 Ga0466970_0002513 3300044765 Bacteria 8841
230 Ga0466957_0017721 3300044842 Bacteria 4176
231 Ga0466957_0093441 3300044842 Bacteria 1888
232 Ga0466960_0161877 3300044901 Bacteria 1202
233 Ga0466959_0037082 3300045049 Bacteria 3601
234 Ga0466959_0049712 3300045049 Bacteria 3080
235 Ga0466959_0289719 3300045049 Bacteria 1122
236 Ga0466958_0067009 3300045836 Bacteria 2192
237 Ga0466958_0081734 3300045836 Bacteria 1989
238 Ga0466967_1564068 3300045976 Bacteria 657
239 Ga0495638_0060223 3300046460 Bacteria 2349
240 Ga0495653_0000008 3300046463 Bacteria 307868
241 Ga0495650_0000253 3300046471 Bacteria 104338
242 Ga0495650_0000464 3300046471 Bacteria 62788
243 Ga0495605_0000082 3300046474 Bacteria 125136
244 Ga0495607_0047278 3300046501 Bacteria 2522
245 Ga0495606_0000048 3300046507 Bacteria 207840
246 Ga0495606_0000276 3300046507 Bacteria 90441
247 Ga0495610_0000894 3300046512 Bacteria 27733
248 Ga0495610_0013164 3300046512 Bacteria 4929
249 Ga0495616_0360698 3300046513 Bacteria 604
250 Ga0495643_0155061 3300046522 Bacteria 1131
251 Ga0495663_0195584 3300046525 Bacteria 704
252 Ga0495654_0120185 3300046530 Bacteria 1190
253 Ga0495621_0363262 3300046539 Bacteria 609
254 Ga0495597_0156014 3300046542 Bacteria 934
255 Ga0495633_0000342 3300046558 Bacteria 51832
256 Ga0495633_0017289 3300046558 Bacteria 3692
257 Ga0495633_0056599 3300046558 Bacteria 1842
258 Ga0495656_0028595 3300046615 Bacteria 2237
259 Ga0495656_0168507 3300046615 Bacteria 1069
260 Ga0495668_0000388 3300046616 Bacteria 58021
261 Ga0495668_0005089 3300046616 Bacteria 9043
262 Ga0495625_0047619 3300046660 Bacteria 3091
263 Ga0495625_0057535 3300046660 Bacteria 2764
264 Ga0495659_0016947 3300046664 Bacteria 2409
265 Ga0495659_0203767 3300046664 Bacteria 812
266 Ga0495588_0029068 3300046674 Bacteria 2770
267 Ga0495649_0008220 3300046694 Bacteria 6288
268 Ga0495636_0003120 3300047318 Bacteria 6422
269 Ga0495636_0005464 3300047318 Bacteria 4994
270 Ga0495636_0025083 3300047318 Bacteria 2419
271 Ga0495687_035580 3300047443 Bacteria 2237
272 Ga0495685_081146 3300047447 Bacteria 1080
273 Ga0495673_0000060 3300047469 Bacteria 231642
274 Ga0495686_0004322 3300047472 Bacteria 11744
275 Ga0495686_0004880 3300047472 Bacteria 10818
276 Ga0496100_0107682 3300048903 Bacteria 1931
277 Ga0496101_0030485 3300048904 Bacteria 3782
278 Ga0496102_0134396 3300048905 Bacteria 2317
279 Ga0496103_0000737 3300048906 Bacteria 24109
280 Ga0496104_0103495 3300048907 Bacteria 2727
281 Ga0496105_0045701 3300048908 Bacteria 3614
282 Ga0496106_0090521 3300048909 Bacteria 2361
283 Ga0496107_0293792 3300048910 Bacteria 1209
284 Ga0496107_0482763 3300048910 Bacteria 920
285 Ga0496110_0188150 3300048913 Bacteria 1875
286 Ga0496111_0623024 3300048914 Bacteria 789
287 Ga0496114_1334546 3300048917 Bacteria 604
288 Ga0496115_1223944 3300048918 Bacteria 563
289 Ga0496116_0075891 3300048919 Bacteria 2108
290 Ga0496117_0038415 3300048920 Bacteria 3549
291 Ga0496117_0088824 3300048920 Bacteria 1998
292 Ga0496118_0000224 3300048921 Bacteria 98813
293 Ga0496118_0003540 3300048921 Bacteria 19531
294 Ga0496118_0206775 3300048921 Bacteria 1156
295 Ga0496119_0000139 3300048922 Bacteria 101548
296 Ga0496119_0008163 3300048922 Bacteria 9268
297 Ga0496119_0441081 3300048922 Bacteria 615
298 Ga0496120_0000185 3300048923 Bacteria 106472
299 Ga0496120_0000862 3300048923 Bacteria 42878
300 Ga0496121_0000241 3300048924 Bacteria 117612
301 Ga0496121_0016218 3300048924 Bacteria 7709
302 Ga0496121_0025870 3300048924 Bacteria 5553
303 Ga0496121_0033051 3300048924 Bacteria 4690
304 Ga0496121_0122356 3300048924 Bacteria 1962
305 Ga0496121_0194325 3300048924 Bacteria 1452
306 Ga0496122_0013612 3300048925 Bacteria 7943
307 Ga0496123_0028209 3300048926 Bacteria 4161
308 Ga0496124_0065469 3300048927 Bacteria 3030
309 Ga0496124_0185862 3300048927 Bacteria 1595
310 Ga0496125_0000198 3300048928 Bacteria 127026
311 Ga0496125_0452701 3300048928 Bacteria 735
312 Ga0496126_0000935 3300048929 Bacteria 50389
313 Ga0496126_0318436 3300048929 Bacteria 1279
314 Ga0496126_0439221 3300048929 Bacteria 1052
315 Ga0501031_0003405 3300049568 Bacteria 10206
316 Ga0501032_0001984 3300049569 Bacteria 16120
317 Ga0501032_0580552 3300049569 Bacteria 714
318 Ga0501033_0041051 3300049570 Bacteria 3453
319 Ga0501033_0212085 3300049570 Bacteria 1381
320 Ga0501033_1026212 3300049570 Bacteria 550
321 Ga0501034_0018398 3300049571 Bacteria 7164
322 Ga0501034_0358647 3300049571 Bacteria 1385
323 Ga0501034_0443165 3300049571 Bacteria 1217
324 Ga0501034_0772936 3300049571 Bacteria 855
325 Ga0501036_0003871 3300049572 Bacteria 12006
326 Ga0501036_0048971 3300049572 Bacteria 3578
327 Ga0501036_0646982 3300049572 Bacteria 875
328 Ga0501037_0001712 3300049573 Bacteria 15932
329 Ga0501037_0031615 3300049573 Bacteria 3909
330 Ga0501038_0499720 3300049574 Bacteria 930
331 Ga0501043_0030550 3300049579 Bacteria 4234
332 Ga0501047_0268211 3300049581 Bacteria 1553
333 Ga0501047_0302203 3300049581 Bacteria 1442
334 Ga0501047_0318562 3300049581 Bacteria 1395
335 Ga0501070_0006903 3300049586 Bacteria 9662
336 Ga0501070_0169308 3300049586 Bacteria 1800
337 Ga0501073_0039579 3300049589 Bacteria 3339
338 Ga0501073_0979951 3300049589 Bacteria 582
339 Ga0501238_004092 3300049671 Bacteria 1810
340 Ga0501239_013137 3300049672 Bacteria 944
341 Ga0501242_008671 3300049674 Bacteria 1192
342 Ga0501249_012624 3300049679 Bacteria 1787
343 Ga0501252_049979 3300049682 Bacteria 629
344 Ga0501253_030042 3300049683 Bacteria 1030
345 Ga0501260_010340 3300049689 Bacteria 936
346 Ga0501225_0051087 3300049705 Bacteria 1151
347 Ga0501080_0003863 3300049742 Bacteria 13244
348 Ga0501232_058901 3300049757 Bacteria 610
349 Ga0501241_142066 3300049758 Bacteria 548
350 Ga0501241_142896 3300049758 Bacteria 547
351 Ga0501268_052969 3300049765 Bacteria 789
352 Ga0501269_000533 3300049766 Bacteria 7448
353 Ga0501035_0004809 3300049822 Bacteria 12799
354 Ga0501035_0017227 3300049822 Bacteria 6659
355 Ga0501044_0019195 3300049823 Bacteria 7318
356 Ga0501045_0988827 3300049824 Bacteria 617
357 nmdc:mga03683_14377_c1 3300050489 Bacteria 2927
358 nmdc:mga03n38_45245_c1 3300050490 Bacteria 1937
359 nmdc:mga00v17_2353_c1 3300050491 Bacteria 9681
360 nmdc:mga00v17_617191_c1 3300050491 Bacteria 699
361 Ga0500594_0005604 3300053118 Bacteria 2788
362 Ga0500618_001100 3300053125 Bacteria 13287
363 Ga0500618_069706 3300053125 Bacteria 789
364 Ga0500609_055806 3300053731 Bacteria 550
365 Ga0587091_002660 3300059511 Bacteria 2150
366 Ga0466962_0021739 3300061719 Bacteria 3079
367 Ga0466962_0239943 3300061719 Bacteria 889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1000176 Ga0055526_100017640 67
2 iso_pu_bacteria 2643221695 2644528495 69
3 3300005327 Ga0070658_10002745 Ga0070658_100027455 70
4 3300005334 Ga0068869_100002466 Ga0068869_1000024665 70
5 3300005335 Ga0070666_10000005 Ga0070666_10000005337 70
6 3300005344 Ga0070661_100121584 Ga0070661_1001215842 70
7 3300005347 Ga0070668_101825641 Ga0070668_1018256412 70
8 3300005548 Ga0070665_100001925 Ga0070665_10000192524 70
9 3300005843 Ga0068860_100181992 Ga0068860_1001819924 70
10 3300009551 Ga0105238_10000060 Ga0105238_100000606 70
11 3300009553 Ga0105249_10299111 Ga0105249_102991111 70
12 3300013296 Ga0157374_10059635 Ga0157374_100596355 70
13 3300013306 Ga0163162_10000060 Ga0163162_1000006075 70
14 3300013308 Ga0157375_13601170 Ga0157375_136011702 70
15 3300014968 Ga0157379_10522956 Ga0157379_105229562 70
16 3300025903 Ga0207680_10000002 Ga0207680_10000002837 70
17 3300025909 Ga0207705_10003087 Ga0207705_100030875 70
18 3300025912 Ga0207707_10318266 Ga0207707_103182662 70
19 3300025920 Ga0207649_10084674 Ga0207649_100846742 70
20 3300025924 Ga0207694_10000197 Ga0207694_100001979 70
21 3300025942 Ga0207689_10021241 Ga0207689_100212415 70
22 3300025961 Ga0207712_10442909 Ga0207712_104429093 70
23 3300026041 Ga0207639_10898469 Ga0207639_108984692 70
24 3300028379 Ga0268266_10000004 Ga0268266_10000004831 70
25 3300028381 Ga0268264_10069904 Ga0268264_100699042 70
26 3300033180 Ga0307510_10012312 Ga0307510_1001231211 70
27 3300037312 Ga0395899_0008203 Ga0395899_0008203_3932_4147 70
28 3300037466 Ga0395898_0000460 Ga0395898_0000460_63618_63833 70
29 3300037466 Ga0395898_0189169 Ga0395898_0189169_1271_1483 70
30 3300038443 Ga0395901_0270536 Ga0395901_0270536_902_1114 70
31 3300038443 Ga0395901_0336899 Ga0395901_0336899_940_1152 70
32 3300038443 Ga0395901_1732955 Ga0395901_1732955_331_546 70
33 3300044694 Ga0466963_0389866 Ga0466963_0389866_119_331 70
34 3300044842 Ga0466957_0093441 Ga0466957_0093441_307_519 70
35 3300046471 Ga0495650_0000253 Ga0495650_0000253_73850_74062 70
36 3300046660 Ga0495625_0047619 Ga0495625_0047619_2668_2880 70
37 3300046674 Ga0495588_0029068 Ga0495588_0029068_1422_1634 70
38 3300048922 Ga0496119_0441081 Ga0496119_0441081_146_358 70
39 3300048924 Ga0496121_0025870 Ga0496121_0025870_536_748 70
40 3300048928 Ga0496125_0452701 Ga0496125_0452701_482_694 70
41 3300048929 Ga0496126_0439221 Ga0496126_0439221_36_248 70
42 3300049569 Ga0501032_0580552 Ga0501032_0580552_477_689 70
43 3300049570 Ga0501033_0041051 Ga0501033_0041051_2390_2602 70
44 3300049570 Ga0501033_1026212 Ga0501033_1026212_230_442 70
45 3300049571 Ga0501034_0443165 Ga0501034_0443165_681_893 70
46 3300049572 Ga0501036_0048971 Ga0501036_0048971_710_922 70
47 3300049572 Ga0501036_0646982 Ga0501036_0646982_257_469 70
48 3300049573 Ga0501037_0031615 Ga0501037_0031615_3261_3473 70
49 3300049579 Ga0501043_0030550 Ga0501043_0030550_3450_3662 70
50 3300049581 Ga0501047_0268211 Ga0501047_0268211_1326_1538 70
51 3300049581 Ga0501047_0302203 Ga0501047_0302203_893_1105 70
52 3300049586 Ga0501070_0169308 Ga0501070_0169308_21_233 70
53 3300049589 Ga0501073_0979951 Ga0501073_0979951_145_357 70
54 3300049822 Ga0501035_0017227 Ga0501035_0017227_5399_5611 70
55 3300049824 Ga0501045_0988827 Ga0501045_0988827_31_243 70
56 iso_pu_bacteria 2919513703 2919516619 70
57 iso_pu_bacteria 2919675420 2919675628 70
58 3300046542 Ga0495597_0156014 Ga0495597_0156014_254_469 71
59 3300047443 Ga0495687_035580 Ga0495687_035580_1710_1967 71
60 3300049571 Ga0501034_0358647 Ga0501034_0358647_38_253 71
61 3300049574 Ga0501038_0499720 Ga0501038_0499720_105_320 71
62 3300059511 Ga0587091_002660 Ga0587091_002660_703_918 71
63 3300002705 JGI25156J39149_1011524 JGI25156J39149_10115242 72
64 3300002737 JGI25162J39368_1000765 JGI25162J39368_10007655 72
65 3300002738 JGI25154J39366_1010331 JGI25154J39366_10103312 72
66 3300002741 JGI25157J39369_1002286 JGI25157J39369_10022866 72
67 3300002772 JGI25164J39214_1000149 JGI25164J39214_100014946 72
68 3300003214 JGI25165J46597_1000088 JGI25165J46597_1000088146 72
69 3300003752 Ga0055539_1000774 Ga0055539_10007749 72
70 3300003759 Ga0055525_1000242 Ga0055525_100024229 72
71 3300003760 Ga0055527_1000063 Ga0055527_100006362 72
72 3300003760 Ga0055527_1004746 Ga0055527_10047463 72
73 3300003761 Ga0055535_1000175 Ga0055535_100017558 72
74 3300003761 Ga0055535_1000406 Ga0055535_100040622 72
75 3300003762 Ga0055542_1000146 Ga0055542_100014662 72
76 3300003762 Ga0055542_1000155 Ga0055542_100015529 72
77 3300003763 Ga0055529_1000182 Ga0055529_100018229 72
78 3300003763 Ga0055529_1000597 Ga0055529_10005978 72
79 3300009036 Ga0105244_10001128 Ga0105244_100011289 72
80 3300009093 Ga0105240_10000343 Ga0105240_100003439 72
81 3300009093 Ga0105240_10000525 Ga0105240_1000052511 72
82 3300009551 Ga0105238_11776098 Ga0105238_117760981 72
83 3300010375 Ga0105239_10000020 Ga0105239_10000020157 72
84 3300025228 Ga0209672_100007 Ga0209672_100007523 72
85 3300025228 Ga0209672_100515 Ga0209672_1005156 72
86 3300025229 Ga0209147_120005 Ga0209147_1200052 72
87 3300025230 Ga0209563_100071 Ga0209563_100071192 72
88 3300025231 Ga0207427_100021 Ga0207427_10002146 72
89 3300025233 Ga0209437_100087 Ga0209437_10008746 72
90 3300025242 Ga0209258_100017 Ga0209258_100017295 72
91 3300025242 Ga0209258_100275 Ga0209258_10027556 72
92 3300025246 Ga0209646_1005223 Ga0209646_10052232 72
93 3300025250 Ga0209026_1008964 Ga0209026_10089643 72
94 3300025254 Ga0209148_1000044 Ga0209148_1000044296 72
95 3300025254 Ga0209148_1000245 Ga0209148_100024528 72
96 3300025256 Ga0209759_1001270 Ga0209759_10012702 72
97 3300025261 Ga0209233_1000023 Ga0209233_1000023576 72
98 3300025272 Ga0209455_1000010 Ga0209455_1000010523 72
99 3300025272 Ga0209455_1000202 Ga0209455_100020228 72
100 3300025907 Ga0207645_10374944 Ga0207645_103749442 72
101 3300025913 Ga0207695_10000318 Ga0207695_1000031844 72
102 3300025913 Ga0207695_10000382 Ga0207695_1000038253 72
103 3300026116 Ga0207674_12034479 Ga0207674_120344791 72
104 3300032004 Ga0307414_10183593 Ga0307414_101835931 72
105 3300032004 Ga0307414_10185252 Ga0307414_101852522 72
106 3300037466 Ga0395898_0817407 Ga0395898_0817407_457_693 72
107 3300039447 Ga0436361_0266436 Ga0436361_0266436_322_540 72
108 3300041451 Ga0451791_1455614 Ga0451791_1455614_26_244 72
109 3300041509 Ga0451843_0708084 Ga0451843_0708084_35_253 72
110 3300044656 Ga0466969_0004995 Ga0466969_0004995_5690_5908 72
111 3300044656 Ga0466969_0207696 Ga0466969_0207696_605_823 72
112 3300044683 Ga0466965_0004502 Ga0466965_0004502_338_559 72
113 3300044684 Ga0466966_0076016 Ga0466966_0076016_215_433 72
114 3300044693 Ga0466961_0001259 Ga0466961_0001259_5762_5983 72
115 3300044693 Ga0466961_0014605 Ga0466961_0014605_45_263 72
116 3300044706 Ga0466964_0043688 Ga0466964_0043688_80_298 72
117 3300044706 Ga0466964_0245724 Ga0466964_0245724_236_454 72
118 3300044719 Ga0466971_0009703 Ga0466971_0009703_2725_2946 72
119 3300044765 Ga0466970_0002513 Ga0466970_0002513_7172_7390 72
120 3300044842 Ga0466957_0017721 Ga0466957_0017721_1123_1344 72
121 3300044901 Ga0466960_0161877 Ga0466960_0161877_891_1109 72
122 3300045049 Ga0466959_0049712 Ga0466959_0049712_370_591 72
123 3300045049 Ga0466959_0289719 Ga0466959_0289719_399_617 72
124 3300045836 Ga0466958_0067009 Ga0466958_0067009_1634_1855 72
125 3300046460 Ga0495638_0060223 Ga0495638_0060223_375_611 72
126 3300046463 Ga0495653_0000008 Ga0495653_0000008_24492_24728 72
127 3300046471 Ga0495650_0000464 Ga0495650_0000464_25834_26070 72
128 3300046474 Ga0495605_0000082 Ga0495605_0000082_45978_46214 72
129 3300046501 Ga0495607_0047278 Ga0495607_0047278_170_460 72
130 3300046507 Ga0495606_0000048 Ga0495606_0000048_186045_186281 72
131 3300046507 Ga0495606_0000276 Ga0495606_0000276_73438_73695 72
132 3300046512 Ga0495610_0000894 Ga0495610_0000894_12198_12434 72
133 3300046512 Ga0495610_0013164 Ga0495610_0013164_933_1169 72
134 3300046558 Ga0495633_0000342 Ga0495633_0000342_32417_32653 72
135 3300046558 Ga0495633_0017289 Ga0495633_0017289_2506_2742 72
136 3300046558 Ga0495633_0056599 Ga0495633_0056599_350_586 72
137 3300046616 Ga0495668_0000388 Ga0495668_0000388_47350_47586 72
138 3300046616 Ga0495668_0005089 Ga0495668_0005089_6837_7073 72
139 3300046660 Ga0495625_0057535 Ga0495625_0057535_649_885 72
140 3300046694 Ga0495649_0008220 Ga0495649_0008220_5570_5806 72
141 3300047469 Ga0495673_0000060 Ga0495673_0000060_200557_200793 72
142 3300047472 Ga0495686_0004322 Ga0495686_0004322_2126_2344 72
143 3300047472 Ga0495686_0004880 Ga0495686_0004880_9582_9818 72
144 3300048903 Ga0496100_0107682 Ga0496100_0107682_226_444 72
145 3300048904 Ga0496101_0030485 Ga0496101_0030485_3141_3359 72
146 3300048905 Ga0496102_0134396 Ga0496102_0134396_268_486 72
147 3300048906 Ga0496103_0000737 Ga0496103_0000737_3124_3360 72
148 3300048907 Ga0496104_0103495 Ga0496104_0103495_1229_1447 72
149 3300048908 Ga0496105_0045701 Ga0496105_0045701_1043_1261 72
150 3300048909 Ga0496106_0090521 Ga0496106_0090521_665_883 72
151 3300048910 Ga0496107_0293792 Ga0496107_0293792_251_469 72
152 3300048910 Ga0496107_0482763 Ga0496107_0482763_692_910 72
153 3300048914 Ga0496111_0623024 Ga0496111_0623024_520_756 72
154 3300048917 Ga0496114_1334546 Ga0496114_1334546_46_282 72
155 3300048918 Ga0496115_1223944 Ga0496115_1223944_281_517 72
156 3300048919 Ga0496116_0075891 Ga0496116_0075891_1199_1417 72
157 3300048920 Ga0496117_0038415 Ga0496117_0038415_3011_3229 72
158 3300048920 Ga0496117_0088824 Ga0496117_0088824_1577_1795 72
159 3300048921 Ga0496118_0000224 Ga0496118_0000224_34946_35164 72
160 3300048921 Ga0496118_0003540 Ga0496118_0003540_4060_4278 72
161 3300048921 Ga0496118_0206775 Ga0496118_0206775_188_424 72
162 3300048922 Ga0496119_0000139 Ga0496119_0000139_58856_59074 72
163 3300048922 Ga0496119_0008163 Ga0496119_0008163_3831_4049 72
164 3300048923 Ga0496120_0000185 Ga0496120_0000185_35277_35495 72
165 3300048923 Ga0496120_0000862 Ga0496120_0000862_9203_9421 72
166 3300048924 Ga0496121_0000241 Ga0496121_0000241_81091_81309 72
167 3300048924 Ga0496121_0033051 Ga0496121_0033051_3032_3268 72
168 3300048924 Ga0496121_0122356 Ga0496121_0122356_1267_1485 72
169 3300048924 Ga0496121_0194325 Ga0496121_0194325_617_835 72
170 3300048925 Ga0496122_0013612 Ga0496122_0013612_3994_4230 72
171 3300048926 Ga0496123_0028209 Ga0496123_0028209_2095_2331 72
172 3300048927 Ga0496124_0065469 Ga0496124_0065469_2030_2266 72
173 3300048927 Ga0496124_0185862 Ga0496124_0185862_151_387 72
174 3300048929 Ga0496126_0000935 Ga0496126_0000935_9217_9435 72
175 3300048929 Ga0496126_0318436 Ga0496126_0318436_919_1137 72
176 3300049568 Ga0501031_0003405 Ga0501031_0003405_1959_2177 72
177 3300049569 Ga0501032_0001984 Ga0501032_0001984_9303_9521 72
178 3300049570 Ga0501033_0212085 Ga0501033_0212085_300_518 72
179 3300049571 Ga0501034_0018398 Ga0501034_0018398_6225_6443 72
180 3300049572 Ga0501036_0003871 Ga0501036_0003871_11420_11638 72
181 3300049573 Ga0501037_0001712 Ga0501037_0001712_7519_7737 72
182 3300049581 Ga0501047_0318562 Ga0501047_0318562_996_1214 72
183 3300049586 Ga0501070_0006903 Ga0501070_0006903_7513_7731 72
184 3300049589 Ga0501073_0039579 Ga0501073_0039579_2167_2385 72
185 3300049679 Ga0501249_012624 Ga0501249_012624_376_612 72
186 3300049742 Ga0501080_0003863 Ga0501080_0003863_11229_11447 72
187 3300049758 Ga0501241_142066 Ga0501241_142066_245_481 72
188 3300049766 Ga0501269_000533 Ga0501269_000533_3296_3532 72
189 3300049822 Ga0501035_0004809 Ga0501035_0004809_6230_6448 72
190 3300049823 Ga0501044_0019195 Ga0501044_0019195_1886_2104 72
191 3300050489 nmdc:mga03683_14377_c1 nmdc:mga03683_14377_c1_1537_1773 72
192 3300050490 nmdc:mga03n38_45245_c1 nmdc:mga03n38_45245_c1_1552_1788 72
193 3300053118 Ga0500594_0005604 Ga0500594_0005604_1627_1845 72
194 3300053125 Ga0500618_001100 Ga0500618_001100_4879_5097 72
195 3300053125 Ga0500618_069706 Ga0500618_069706_145_381 72
196 3300061719 Ga0466962_0239943 Ga0466962_0239943_142_363 72
197 3300003320 rootH2_10000275 rootH2_1000027540 73
198 3300005347 Ga0070668_100071129 Ga0070668_1000711291 73
199 3300006051 Ga0075364_10008154 Ga0075364_100081544 73
200 3300006051 Ga0075364_10118118 Ga0075364_101181182 73
201 3300006948 Ga0099826_10000005 Ga0099826_10000005241 73
202 3300013100 Ga0157373_10340587 Ga0157373_103405872 73
203 3300025972 Ga0207668_10039042 Ga0207668_100390422 73
204 3300027666 Ga0209282_1000003 Ga0209282_1000003560 73
205 3300030744 Ga0316181_1117109 Ga0316181_11171091 73
206 3300030745 Ga0316182_1197589 Ga0316182_11975892 73
207 3300031731 Ga0307405_11346421 Ga0307405_113464212 73
208 3300031824 Ga0307413_10397620 Ga0307413_103976202 73
209 3300031901 Ga0307406_10484657 Ga0307406_104846571 73
210 3300031911 Ga0307412_10889739 Ga0307412_108897391 73
211 3300032002 Ga0307416_102531466 Ga0307416_1025314662 73
212 3300032004 Ga0307414_11113309 Ga0307414_111133092 73
213 3300032005 Ga0307411_10123742 Ga0307411_101237422 73
214 3300032126 Ga0307415_100734819 Ga0307415_1007348192 73
215 3300041404 Ga0439436_0030622 Ga0439436_0030622_300_521 73
216 3300041404 Ga0439436_0069015 Ga0439436_0069015_347_568 73
217 3300041406 Ga0439439_0135378 Ga0439439_0135378_191_412 73
218 3300041451 Ga0451791_1379670 Ga0451791_1379670_356_577 73
219 3300041999 Ga0439433_0206477 Ga0439433_0206477_37_258 73
220 3300042006 Ga0439432_001933 Ga0439432_001933_860_1081 73
221 3300042006 Ga0439432_015768 Ga0439432_015768_489_710 73
222 3300042006 Ga0439432_039700 Ga0439432_039700_1013_1234 73
223 3300042007 Ga0439449_0012076 Ga0439449_0012076_2856_3077 73
224 3300042007 Ga0439449_0139717 Ga0439449_0139717_235_456 73
225 3300042007 Ga0439449_0299101 Ga0439449_0299101_214_435 73
226 3300042015 Ga0439462_0014244 Ga0439462_0014244_1139_1360 73
227 3300042156 Ga0439446_0121539 Ga0439446_0121539_327_548 73
228 3300044656 Ga0466969_0005400 Ga0466969_0005400_2904_3128 73
229 3300044663 Ga0466989_0320174 Ga0466989_0320174_21_245 73
230 3300044684 Ga0466966_0050484 Ga0466966_0050484_512_736 73
231 3300044693 Ga0466961_0132861 Ga0466961_0132861_452_676 73
232 3300044694 Ga0466963_0102938 Ga0466963_0102938_1400_1624 73
233 3300044719 Ga0466971_0500762 Ga0466971_0500762_84_308 73
234 3300045049 Ga0466959_0037082 Ga0466959_0037082_627_851 73
235 3300045836 Ga0466958_0081734 Ga0466958_0081734_1474_1698 73
236 3300046525 Ga0495663_0195584 Ga0495663_0195584_50_271 73
237 3300046539 Ga0495621_0363262 Ga0495621_0363262_281_502 73
238 3300046615 Ga0495656_0028595 Ga0495656_0028595_1761_1982 73
239 3300046615 Ga0495656_0168507 Ga0495656_0168507_303_524 73
240 3300046664 Ga0495659_0016947 Ga0495659_0016947_1088_1309 73
241 3300047318 Ga0495636_0003120 Ga0495636_0003120_510_746 73
242 3300047318 Ga0495636_0005464 Ga0495636_0005464_1970_2191 73
243 3300047318 Ga0495636_0025083 Ga0495636_0025083_1596_1817 73
244 3300047447 Ga0495685_081146 Ga0495685_081146_617_853 73
245 3300048913 Ga0496110_0188150 Ga0496110_0188150_660_881 73
246 3300049671 Ga0501238_004092 Ga0501238_004092_455_676 73
247 3300049672 Ga0501239_013137 Ga0501239_013137_132_353 73
248 3300049674 Ga0501242_008671 Ga0501242_008671_675_896 73
249 3300049682 Ga0501252_049979 Ga0501252_049979_384_605 73
250 3300049683 Ga0501253_030042 Ga0501253_030042_318_539 73
251 3300049689 Ga0501260_010340 Ga0501260_010340_675_896 73
252 3300049705 Ga0501225_0051087 Ga0501225_0051087_47_268 73
253 3300049757 Ga0501232_058901 Ga0501232_058901_208_429 73
254 3300049758 Ga0501241_142896 Ga0501241_142896_10_231 73
255 3300049765 Ga0501268_052969 Ga0501268_052969_167_388 73
256 3300050491 nmdc:mga00v17_2353_c1 nmdc:mga00v17_2353_c1_3189_3413 73
257 3300050491 nmdc:mga00v17_617191_c1 nmdc:mga00v17_617191_c1_414_638 73
258 3300061719 Ga0466962_0021739 Ga0466962_0021739_1317_1541 73
259 3300009093 Ga0105240_10350573 Ga0105240_103505734 74
260 3300031251 Ga0265327_10002234 Ga0265327_1000223412 74
261 3300031344 Ga0265316_10298055 Ga0265316_102980551 74
262 3300046513 Ga0495616_0360698 Ga0495616_0360698_274_498 74
263 3300046522 Ga0495643_0155061 Ga0495643_0155061_799_1023 74
264 3300046530 Ga0495654_0120185 Ga0495654_0120185_29_253 74
265 3300049571 Ga0501034_0772936 Ga0501034_0772936_414_638 74
266 3300053731 Ga0500609_055806 Ga0500609_055806_204_428 74
267 3300002737 JGI25162J39368_1001305 JGI25162J39368_10013058 75
268 3300002737 JGI25162J39368_1002278 JGI25162J39368_10022788 75
269 3300002741 JGI25157J39369_1001444 JGI25157J39369_10014446 75
270 3300002772 JGI25164J39214_1000663 JGI25164J39214_10006638 75
271 3300002772 JGI25164J39214_1000732 JGI25164J39214_100073210 75
272 3300003214 JGI25165J46597_1001316 JGI25165J46597_10013168 75
273 3300003214 JGI25165J46597_1002023 JGI25165J46597_10020239 75
274 3300005435 Ga0070714_100007079 Ga0070714_1000070794 75
275 3300005436 Ga0070713_100023851 Ga0070713_1000238513 75
276 3300005530 Ga0070679_100448279 Ga0070679_1004482792 75
277 3300005563 Ga0068855_100322719 Ga0068855_1003227194 75
278 3300005578 Ga0068854_100002097 Ga0068854_1000020971 75
279 3300006051 Ga0075364_10528069 Ga0075364_105280692 75
280 3300009093 Ga0105240_10206031 Ga0105240_102060311 75
281 3300009093 Ga0105240_12668316 Ga0105240_126683161 75
282 3300013100 Ga0157373_10412437 Ga0157373_104124371 75
283 3300013104 Ga0157370_10057553 Ga0157370_100575534 75
284 3300013104 Ga0157370_11689734 Ga0157370_116897342 75
285 3300014497 Ga0182008_10012866 Ga0182008_100128666 75
286 3300014497 Ga0182008_10083828 Ga0182008_100838282 75
287 3300014497 Ga0182008_10532828 Ga0182008_105328281 75
288 3300015261 Ga0182006_1039280 Ga0182006_10392803 75
289 3300015261 Ga0182006_1060899 Ga0182006_10608994 75
290 3300015262 Ga0182007_10012631 Ga0182007_100126316 75
291 3300015262 Ga0182007_10112257 Ga0182007_101122572 75
292 3300015262 Ga0182007_10201019 Ga0182007_102010192 75
293 3300025226 Ga0209674_103399 Ga0209674_1033994 75
294 3300025231 Ga0207427_100115 Ga0207427_10011545 75
295 3300025231 Ga0207427_100130 Ga0207427_10013041 75
296 3300025233 Ga0209437_100020 Ga0209437_100020184 75
297 3300025233 Ga0209437_100079 Ga0209437_100079229 75
298 3300025250 Ga0209026_1000105 Ga0209026_100010569 75
299 3300025256 Ga0209759_1003331 Ga0209759_10033315 75
300 3300025261 Ga0209233_1000020 Ga0209233_1000020441 75
301 3300025261 Ga0209233_1000121 Ga0209233_1000121186 75
302 3300025912 Ga0207707_11108022 Ga0207707_111080222 75
303 3300025913 Ga0207695_11678845 Ga0207695_116788451 75
304 3300025915 Ga0207693_10398467 Ga0207693_103984672 75
305 3300025928 Ga0207700_10354425 Ga0207700_103544253 75
306 3300025929 Ga0207664_10001606 Ga0207664_1000160613 75
307 3300025941 Ga0207711_10306067 Ga0207711_103060673 75
308 3300025949 Ga0207667_10000094 Ga0207667_100000941 75
309 3300025981 Ga0207640_10001582 Ga0207640_1000158213 75
310 3300031238 Ga0265332_10280027 Ga0265332_102800272 75
311 3300041494 Ga0451837_0016953 Ga0451837_0016953_2285_2512 75
312 3300041494 Ga0451837_0733553 Ga0451837_0733553_677_904 75
313 3300041509 Ga0451843_0747783 Ga0451843_0747783_1965_2192 75
314 3300045976 Ga0466967_1564068 Ga0466967_1564068_82_309 75
315 3300005293 Ga0065715_10028338 Ga0065715_100283382 76
316 3300005293 Ga0065715_10972907 Ga0065715_109729072 76
317 3300005354 Ga0070675_101468041 Ga0070675_1014680411 76
318 3300013306 Ga0163162_12022224 Ga0163162_120222242 76
319 3300013308 Ga0157375_12130975 Ga0157375_121309751 76
320 3300027252 Ga0209973_1069283 Ga0209973_10692831 76
321 3300041451 Ga0451791_0408094 Ga0451791_0408094_274_510 76
322 3300041494 Ga0451837_0441912 Ga0451837_0441912_546_782 76
323 3300031251 Ga0265327_10047689 Ga0265327_100476893 77
324 3300031456 Ga0307513_10148737 Ga0307513_101487374 77
325 3300032004 Ga0307414_11744913 Ga0307414_117449132 77
326 3300046664 Ga0495659_0203767 Ga0495659_0203767_202_435 77
327 3300001989 JGI24739J22299_10009141 JGI24739J22299_100091411 79
328 3300002067 JGI24735J21928_10100314 JGI24735J21928_101003141 79
329 3300003578 Ga0006562J51391_1018790 Ga0006562J51391_10187904 79
330 3300005366 Ga0070659_100305237 Ga0070659_1003052372 79
331 3300005367 Ga0070667_101922067 Ga0070667_1019220671 79
332 3300005455 Ga0070663_100093513 Ga0070663_1000935131 79
333 3300005457 Ga0070662_100374247 Ga0070662_1003742472 79
334 3300005563 Ga0068855_100138059 Ga0068855_1001380594 79
335 3300005577 Ga0068857_100006575 Ga0068857_1000065754 79
336 3300005578 Ga0068854_100058609 Ga0068854_1000586092 79
337 3300005614 Ga0068856_100568779 Ga0068856_1005687793 79
338 3300005616 Ga0068852_100008252 Ga0068852_1000082527 79
339 3300005617 Ga0068859_100129457 Ga0068859_1001294571 79
340 3300005834 Ga0068851_10248621 Ga0068851_102486212 79
341 3300005842 Ga0068858_100089398 Ga0068858_1000893984 79
342 3300006931 Ga0097620_100129460 Ga0097620_1001294601 79
343 3300009093 Ga0105240_10011192 Ga0105240_100111927 79
344 3300009545 Ga0105237_10000026 Ga0105237_10000026175 79
345 3300009553 Ga0105249_10066966 Ga0105249_100669664 79
346 3300010375 Ga0105239_10011493 Ga0105239_100114935 79
347 3300012498 Ga0157345_1027280 Ga0157345_10272802 79
348 3300012500 Ga0157314_1000831 Ga0157314_10008314 79
349 3300012502 Ga0157347_1023439 Ga0157347_10234392 79
350 3300013102 Ga0157371_10180552 Ga0157371_101805521 79
351 3300013307 Ga0157372_12923331 Ga0157372_129233312 79
352 3300025245 Ga0207425_1062408 Ga0207425_10624081 79
353 3300025258 Ga0209129_1011945 Ga0209129_10119454 79
354 3300025297 Ga0209758_1000266 Ga0209758_10002667 79
355 3300025321 Ga0207656_10018932 Ga0207656_100189322 79
356 3300025904 Ga0207647_10002132 Ga0207647_1000213211 79
357 3300025913 Ga0207695_10008840 Ga0207695_100088405 79
358 3300025914 Ga0207671_10000041 Ga0207671_1000004113 79
359 3300025924 Ga0207694_10700152 Ga0207694_107001522 79
360 3300025932 Ga0207690_10234004 Ga0207690_102340043 79
361 3300025933 Ga0207706_10056116 Ga0207706_100561162 79
362 3300025949 Ga0207667_10000157 Ga0207667_1000015782 79
363 3300025981 Ga0207640_10001788 Ga0207640_100017884 79
364 3300025986 Ga0207658_11798503 Ga0207658_117985032 79
365 3300026035 Ga0207703_10268594 Ga0207703_102685943 79
366 3300026067 Ga0207678_10115794 Ga0207678_101157941 79
367 3300026116 Ga0207674_10001266 Ga0207674_1000126626 79
368 3300042005 Ga0439448_0083849 Ga0439448_0083849_20_259 79
369 3300048924 Ga0496121_0016218 Ga0496121_0016218_1365_1604 79
370 3300048928 Ga0496125_0000198 Ga0496125_0000198_115974_116213 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13275

S4_2

S4 domain

19

83

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9605 16 64
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9575 16 65
5mrc-assembly1.cif.gz_DD structure of the yeast mitochondrial ribosome - class a 0.9449 16 65
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9432 16 57
7pao-assembly1.cif.gz_C 70s ribosome with ef-g, a*- and p/e-site trnas in mycoplasma pneumoniae cells 0.9366 16 66
ID Description Score Start End Superfamily
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9808 16 64 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9712 16 60 1.10.1050.10
af_Q5A6Q6_103_204_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9587 16 65 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.953 16 65 3.10.290.10
af_Q6R9N5_90_173_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.952 16 66 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A846V2Q8-F1-model_v4 Ribosome-associated protein 1.006 1 74 GO:0003723
AF-A0A6I1NDQ0-F1-model_v4 RNA-binding protein 1.001 1 73 GO:0003723
AF-A0A2N3RMP0-F1-model_v4 RNA-binding protein 0.9999 1 74 GO:0003723
AF-A0A522H6A4-F1-model_v4 RNA-binding S4 domain-containing protein 0.9986 1 75 GO:0003723
AF-A0A2N7QPB7-F1-model_v4 Uncharacterized protein 0.9979 1 73 GO:0003723

Feature Viewer

pLDDT pTM Quality
89.97 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map