metagRoot

F425477

General Info

Members	Datasets	Scaffolds	Average Seq Length
370	256	364	240

Family's Representative Sequence

Representative Sequence	3300039062\|Ga0400483_271930\|Ga0400483_271930_853_1650
Length	265
Sequence	MTDPTTQHSGPAPTTDGRVALVTGGGRGIGREICLGLAREGRRIAVADLRADEAATTVDLIQQSGGTALVVAMDVSNSDSVAEGLLQVVDELGPVEILVNCAGWDELKPFLDTDEEFWDRIIEVNYKGALRTVHGCLPAMIDAGWGRIVNIGSDAGRVGSSLEAVYSGAKGGIIAFTKTIAREVARKGITANTVCPGPTDTPLLDEIVSAGDDGDKVIGAMARAVPMKRVGQPAEVASAVVYFCSEQAGFVSGQTLSVSGGLTMA

Samples

	Sample ID	Description	Type	Environment
1	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
2	2643221604	Nocardioides sp. Root190	Isolate	Unclassified
3	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
4	2751185897	Sphingomonas panacis DCY99	Isolate	Unclassified
5	2862507626	Streptomyces sp. NWU339	Isolate	Unclassified
6	3001889506	Janibacter sp. YIM B02568	Isolate	Unclassified
7	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
8	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
9	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
10	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
11	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
12	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
20	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
21	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
22	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
23	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
24	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
25	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
26	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
31	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
32	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
33	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
34	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
35	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
36	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
37	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
38	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
39	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
42	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
43	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
46	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
47	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
48	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
49	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
50	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
51	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
52	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
53	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
54	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
55	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
56	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
57	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
58	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
59	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
60	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
61	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
62	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
63	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
67	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
68	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
70	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
72	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
75	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
80	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
81	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
82	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
83	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
84	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
85	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
86	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
87	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
125	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
128	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
129	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
130	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
131	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
132	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
133	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
134	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
135	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
136	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
137	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
138	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
139	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
140	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
141	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
142	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
143	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
144	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
145	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
146	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
147	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
148	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
149	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
150	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
151	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
152	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
153	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
154	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
155	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
156	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
157	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
158	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
159	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
160	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
161	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
162	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
163	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
164	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
165	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
166	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
167	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
168	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
169	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
170	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
171	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
172	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
173	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
174	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
175	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
176	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
177	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
178	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
179	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
180	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
181	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
182	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
183	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
184	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
185	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
186	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
187	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
188	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
189	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
190	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
191	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
192	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
193	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
194	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
195	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
196	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
197	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
198	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
199	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
200	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
201	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
202	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
203	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
204	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
205	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
206	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
207	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
208	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
209	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
210	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
211	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
212	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
213	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
214	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
215	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
216	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
217	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
218	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
219	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
227	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
228	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
229	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
230	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
231	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
232	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
233	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
234	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
235	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
236	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
237	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
238	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
239	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
240	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
241	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
242	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
243	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
244	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
245	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
246	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
247	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
248	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
249	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
250	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
251	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
252	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
253	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
254	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
255	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
256	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.84
Metatranscriptomes	0.54
Isolates	1.62

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.92
Nodule	0
Rhizoplane	1.62
Rhizosphere	84.86
Stem	0
Stem Tuber	0
Unclassified	4.59

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1000005	3300001904	Bacteria	48556
2	JGI24740J21852_10019618	3300001979	Bacteria	2377
3	JGI24737J22298_10004882	3300001990	Bacteria	4649
4	JGI24735J21928_10005707	3300002067	Bacteria	4114
5	JGI24738J21930_10006264	3300002075	Bacteria	2804
6	Ga0070658_10000186	3300005327	Bacteria	54785
7	Ga0070658_10000304	3300005327	Bacteria	42569
8	Ga0070658_10277601	3300005327	Bacteria	1426
9	Ga0070680_100001179	3300005336	Bacteria	18807
10	Ga0070680_100001985	3300005336	Bacteria	15054
11	Ga0070682_100275105	3300005337	Bacteria	1225
12	Ga0070660_100298930	3300005339	Bacteria	1319
13	Ga0070661_100150109	3300005344	Bacteria	1761
14	Ga0070674_100013009	3300005356	Bacteria	5129
15	Ga0070688_100012466	3300005365	Bacteria	4765
16	Ga0070667_100019146	3300005367	Bacteria	5677
17	Ga0070709_10006146	3300005434	Bacteria	6532
18	Ga0070714_100034520	3300005435	Bacteria	4236
19	Ga0070714_100194614	3300005435	Bacteria	1852
20	Ga0070710_10179234	3300005437	Unclassified	1325
21	Ga0070711_100013075	3300005439	Bacteria	5205
22	Ga0070705_100013314	3300005440	Bacteria	4203
23	Ga0070700_100086029	3300005441	Bacteria	2040
24	Ga0070708_100019171	3300005445	Bacteria	5742
25	Ga0070678_100026640	3300005456	Bacteria	3912
26	Ga0070681_10000212	3300005458	Bacteria	45340
27	Ga0068867_100109900	3300005459	Bacteria	2117
28	Ga0070706_100003801	3300005467	Bacteria	14744
29	Ga0070706_100011750	3300005467	Bacteria	8124
30	Ga0070707_100001669	3300005468	Bacteria	21472
31	Ga0070707_100100277	3300005468	Bacteria	2805
32	Ga0070707_100101597	3300005468	Bacteria	2787
33	Ga0070698_100000587	3300005471	Bacteria	39046
34	Ga0070698_100018169	3300005471	Bacteria	7402
35	Ga0070698_100627721	3300005471	Bacteria	1015
36	Ga0070699_100000902	3300005518	Bacteria	27723
37	Ga0070679_100048869	3300005530	Bacteria	4214
38	Ga0070679_100086869	3300005530	Bacteria	3114
39	Ga0070697_100000792	3300005536	Bacteria	23732
40	Ga0070697_100293498	3300005536	Bacteria	1397
41	Ga0068853_100002727	3300005539	Bacteria	13333
42	Ga0070696_100245500	3300005546	Bacteria	1352
43	Ga0070693_100074740	3300005547	Bacteria	2005
44	Ga0070704_100009329	3300005549	Bacteria	5921
45	Ga0068855_100009282	3300005563	Bacteria	11881
46	Ga0068855_100071801	3300005563	Bacteria	4024
47	Ga0068855_100187895	3300005563	Bacteria	2332
48	Ga0068855_100193722	3300005563	Bacteria	2291
49	Ga0068857_100104335	3300005577	Bacteria	2545
50	Ga0068854_100000322	3300005578	Bacteria	31553
51	Ga0068856_100004551	3300005614	Bacteria	13781
52	Ga0068856_100623564	3300005614	Bacteria	1099
53	Ga0068852_100002126	3300005616	Bacteria	13576
54	Ga0068852_100051163	3300005616	Bacteria	3543
55	Ga0068866_10061125	3300005718	Bacteria	1955
56	Ga0068851_10008342	3300005834	Bacteria	4790
57	Ga0068851_10100382	3300005834	Bacteria	1535
58	Ga0068862_100440625	3300005844	Bacteria	1226
59	Ga0081455_10002011	3300005937	Bacteria	24306
60	Ga0081455_10060376	3300005937	Bacteria	3197
61	Ga0081455_10151174	3300005937	Bacteria	1790
62	Ga0081455_10154226	3300005937	Bacteria	1768
63	Ga0081538_10002383	3300005981	Bacteria	18452
64	Ga0070717_10014616	3300006028	Bacteria	6045
65	Ga0070717_10020650	3300006028	Bacteria	5184
66	Ga0075365_10018056	3300006038	Bacteria	4330
67	Ga0075365_10101732	3300006038	Bacteria	1968
68	Ga0075365_10257263	3300006038	Bacteria	1227
69	Ga0075368_10025573	3300006042	Bacteria	2265
70	Ga0075363_100009329	3300006048	Bacteria	4611
71	Ga0075364_10000483	3300006051	Bacteria	20215
72	Ga0075364_10020723	3300006051	Bacteria	4137
73	Ga0070716_100006080	3300006173	Bacteria	5885
74	Ga0070712_100005799	3300006175	Bacteria	7634
75	Ga0075362_10029001	3300006177	Bacteria	2381
76	Ga0075362_10050732	3300006177	Bacteria	1855
77	Ga0075369_10000886	3300006186	Bacteria	9932
78	Ga0075369_10002056	3300006186	Bacteria	7096
79	Ga0075366_10101498	3300006195	Bacteria	1726
80	Ga0075370_10105700	3300006353	Bacteria	1632
81	Ga0075428_100015098	3300006844	Bacteria	8577
82	Ga0075428_100022112	3300006844	Bacteria	7041
83	Ga0075428_100022528	3300006844	Bacteria	6975
84	Ga0075428_100174767	3300006844	Bacteria	2327
85	Ga0075430_100054907	3300006846	Bacteria	3351
86	Ga0075430_100262451	3300006846	Bacteria	1430
87	Ga0075431_100020301	3300006847	Bacteria	6786
88	Ga0075431_100200262	3300006847	Bacteria	2043
89	Ga0075429_100165146	3300006880	Bacteria	1939
90	Ga0068865_100026166	3300006881	Bacteria	3845
91	Ga0099794_10077647	3300007265	Bacteria	1634
92	Ga0099794_10159411	3300007265	Bacteria	1147
93	Ga0105240_10023389	3300009093	Bacteria	8172
94	Ga0105240_10027768	3300009093	Bacteria	7406
95	Ga0105240_10475376	3300009093	Bacteria	1394
96	Ga0111539_10000716	3300009094	Bacteria	43096
97	Ga0111539_10046921	3300009094	Bacteria	5165
98	Ga0105245_10044872	3300009098	Bacteria	3946
99	Ga0105245_10247329	3300009098	Bacteria	1731
100	Ga0114129_10044831	3300009147	Bacteria	6220
101	Ga0114129_10273325	3300009147	Bacteria	2260
102	Ga0114129_11471528	3300009147	Bacteria	838
103	Ga0105243_10359504	3300009148	Bacteria	1340
104	Ga0105242_10215551	3300009176	Bacteria	1713
105	Ga0105242_10521533	3300009176	Bacteria	1134
106	Ga0105248_10498538	3300009177	Bacteria	1373
107	Ga0105237_10282222	3300009545	Bacteria	1663
108	Ga0105238_10628130	3300009551	Bacteria	1083
109	Ga0105249_10036049	3300009553	Bacteria	4487
110	Ga0105249_10409833	3300009553	Bacteria	1387
111	Ga0099796_10002826	3300010159	Bacteria	3904
112	Ga0105246_10318965	3300011119	Bacteria	1262
113	Ga0157371_10308879	3300013102	Bacteria	1146
114	Ga0157370_10009037	3300013104	Bacteria	10694
115	Ga0163162_10787557	3300013306	Bacteria	1069
116	Ga0206354_11044650	3300020081	Bacteria	2242
117	Ga0206353_10237024	3300020082	Bacteria	7357
118	Ga0213873_10012985	3300021358	Bacteria	1818
119	Ga0213876_10001894	3300021384	Bacteria	12588
120	Ga0224572_1018885	3300024225	Bacteria	1325
121	Ga0207656_10098410	3300025321	Bacteria	1338
122	Ga0207692_10010092	3300025898	Bacteria	3967
123	Ga0207642_10042238	3300025899	Bacteria	2003
124	Ga0207647_10000202	3300025904	Bacteria	48749
125	Ga0207647_10003676	3300025904	Bacteria	11480
126	Ga0207699_10003209	3300025906	Bacteria	7786
127	Ga0207705_10000007	3300025909	Bacteria	597387
128	Ga0207705_10000631	3300025909	Bacteria	29436
129	Ga0207705_10010305	3300025909	Bacteria	6798
130	Ga0207705_10016513	3300025909	Bacteria	5289
131	Ga0207684_10003660	3300025910	Bacteria	14924
132	Ga0207654_10049458	3300025911	Bacteria	2412
133	Ga0207707_10000309	3300025912	Bacteria	51263
134	Ga0207707_10088306	3300025912	Bacteria	2708
135	Ga0207695_10004559	3300025913	Bacteria	18839
136	Ga0207695_10009783	3300025913	Bacteria	11789
137	Ga0207695_10015634	3300025913	Bacteria	8926
138	Ga0207671_10002153	3300025914	Bacteria	21470
139	Ga0207693_10000419	3300025915	Bacteria	38578
140	Ga0207663_10017417	3300025916	Bacteria	4003
141	Ga0207660_10000387	3300025917	Bacteria	28945
142	Ga0207657_10041729	3300025919	Bacteria	4054
143	Ga0207652_10000050	3300025921	Bacteria	120417
144	Ga0207646_10002043	3300025922	Bacteria	24256
145	Ga0207646_10024211	3300025922	Bacteria	5564
146	Ga0207646_10291168	3300025922	Bacteria	1475
147	Ga0207694_10100167	3300025924	Bacteria	2295
148	Ga0207687_10041967	3300025927	Bacteria	3144
149	Ga0207664_10046618	3300025929	Bacteria	3403
150	Ga0207664_10072532	3300025929	Bacteria	2776
151	Ga0207690_10170303	3300025932	Bacteria	1631
152	Ga0207669_10013798	3300025937	Bacteria	4029
153	Ga0207704_10011745	3300025938	Bacteria	4326
154	Ga0207661_10457337	3300025944	Bacteria	1163
155	Ga0207667_10001655	3300025949	Bacteria	28074
156	Ga0207667_10005039	3300025949	Bacteria	16138
157	Ga0207667_10039999	3300025949	Bacteria	4992
158	Ga0207712_10036810	3300025961	Bacteria	3335
159	Ga0207668_10144633	3300025972	Bacteria	1833
160	Ga0207640_10000501	3300025981	Bacteria	23670
161	Ga0207640_10559716	3300025981	Bacteria	962
162	Ga0207658_10000964	3300025986	Bacteria	23722
163	Ga0207677_10121165	3300026023	Bacteria	1968
164	Ga0207639_10004659	3300026041	Bacteria	9233
165	Ga0207639_10468115	3300026041	Bacteria	1147
166	Ga0207639_10474493	3300026041	Bacteria	1139
167	Ga0207678_10024199	3300026067	Bacteria	5305
168	Ga0207708_10136031	3300026075	Bacteria	1925
169	Ga0207708_10427312	3300026075	Bacteria	1099
170	Ga0207702_10002371	3300026078	Bacteria	17996
171	Ga0207702_10014036	3300026078	Bacteria	6651
172	Ga0207702_10540586	3300026078	Bacteria	1139
173	Ga0207674_10035931	3300026116	Bacteria	5168
174	Ga0207674_10091441	3300026116	Bacteria	3033
175	Ga0207674_10131740	3300026116	Bacteria	2463
176	Ga0207674_10189803	3300026116	Bacteria	2005
177	Ga0207683_10043704	3300026121	Bacteria	3916
178	Ga0207698_10000305	3300026142	Bacteria	29478
179	Ga0207698_10029746	3300026142	Bacteria	3917
180	Ga0207698_10067608	3300026142	Bacteria	2818
181	Ga0207698_10156689	3300026142	Bacteria	1985
182	Ga0207428_10000801	3300027907	Bacteria	35543
183	Ga0268265_10170678	3300028380	Bacteria	1859
184	Ga0268265_10490396	3300028380	Bacteria	1156
185	Ga0268264_10051549	3300028381	Bacteria	3429
186	Ga0307515_10065868	3300028794	Bacteria	5031
187	Ga0307511_10199002	3300030521	Bacteria	1044
188	Ga0265325_10108193	3300031241	Bacteria	1354
189	Ga0265316_10346901	3300031344	Bacteria	1075
190	Ga0307513_10348663	3300031456	Bacteria	1229
191	Ga0316576_10047201	3300031727	Bacteria	3120
192	Ga0307516_10521439	3300031730	Bacteria	842
193	Ga0307410_10035140	3300031852	Bacteria	3252
194	Ga0307410_10108845	3300031852	Bacteria	2002
195	Ga0326468_10005757	3300031889	Bacteria	1127
196	Ga0307406_10462379	3300031901	Bacteria	1020
197	Ga0307412_10003957	3300031911	Bacteria	8257
198	Ga0307412_10034159	3300031911	Bacteria	3239
199	Ga0307412_10205697	3300031911	Bacteria	1498
200	Ga0307409_100199308	3300031995	Bacteria	1789
201	Ga0307414_10000576	3300032004	Bacteria	19123
202	Ga0307414_10127754	3300032004	Bacteria	1967
203	Ga0307414_10932479	3300032004	Bacteria	797
204	Ga0307411_10004722	3300032005	Bacteria	6582
205	Ga0307507_10257062	3300033179	Bacteria	1120
206	Ga0373926_0081983	3300035083	Bacteria	1194
207	Ga0373934_0063931	3300035086	Bacteria	1468
208	Ga0373944_0005151	3300035089	Bacteria	3435
209	Ga0373944_0117769	3300035089	Bacteria	913
210	Ga0373945_0194093	3300035116	Bacteria	840
211	Ga0373953_0083384	3300035117	Bacteria	1332
212	Ga0373954_0033428	3300035118	Bacteria	2380
213	Ga0373956_0004879	3300035119	Bacteria	5372
214	Ga0373956_0024327	3300035119	Bacteria	2608
215	Ga0373957_0084225	3300035120	Bacteria	1258
216	Ga0373957_0162246	3300035120	Bacteria	921
217	Ga0373943_0046122	3300035170	Bacteria	2126
218	Ga0373943_0088314	3300035170	Bacteria	1601
219	Ga0373955_0061586	3300035172	Bacteria	2073
220	Ga0373955_0085580	3300035172	Bacteria	1789
221	Ga0316574_0178537	3300035398	Bacteria	1366
222	Ga0373924_0053644	3300035410	Bacteria	1675
223	Ga0373935_0025838	3300035692	Bacteria	3619
224	Ga0373935_0077936	3300035692	Bacteria	2149
225	Ga0373935_0121266	3300035692	Bacteria	1747
226	Ga0373935_0195204	3300035692	Bacteria	1396
227	Ga0373927_0002164	3300035695	Bacteria	14426
228	Ga0373933_0001397	3300035724	Bacteria	14182
229	Ga0373933_0041758	3300035724	Bacteria	2709
230	Ga0373947_0008433	3300035725	Bacteria	5938
231	Ga0373947_0156009	3300035725	Bacteria	1473
232	Ga0373937_0000020	3300036401	Bacteria	131263
233	Ga0373937_0006679	3300036401	Bacteria	9962
234	Ga0373937_0014671	3300036401	Bacteria	6919
235	Ga0373937_0135813	3300036401	Bacteria	2300
236	Ga0373937_0357644	3300036401	Bacteria	1383
237	Ga0373925_0003842	3300037068	Bacteria	11510
238	Ga0395899_0001978	3300037312	Bacteria	16855
239	Ga0395899_0112227	3300037312	Bacteria	1959
240	Ga0395900_0044247	3300037418	Bacteria	4588
241	Ga0395900_0044617	3300037418	Bacteria	4567
242	Ga0395898_0249238	3300037466	Bacteria	1694
243	Ga0395898_0790260	3300037466	Bacteria	890
244	Ga0395905_0228347	3300037471	Bacteria	1741
245	Ga0395905_0556805	3300037471	Bacteria	1048
246	Ga0395901_0001952	3300038443	Bacteria	21231
247	Ga0395901_0021996	3300038443	Bacteria	6536
248	Ga0395901_0399687	3300038443	Bacteria	1412
249	Ga0400483_171132	3300039062	Bacteria	5367
250	Ga0400483_271930	3300039062	Bacteria	12318
251	Ga0436365_0036866	3300039437	Bacteria	1011
252	Ga0436365_0473069	3300039437	Bacteria	25772
253	Ga0436363_1471705	3300039450	Bacteria	1292
254	Ga0436362_0259081	3300039453	Bacteria	2969
255	Ga0439466_0047842	3300041411	Bacteria	1409
256	Ga0439446_0007871	3300042156	Bacteria	2813
257	Ga0439459_0018424	3300042438	Bacteria	1312
258	Ga0451577_0426152	3300042876	Bacteria	1205
259	Ga0466966_0180426	3300044684	Bacteria	1281
260	Ga0466961_0005898	3300044693	Bacteria	7764
261	Ga0466964_0064162	3300044706	Bacteria	1536
262	Ga0466968_0080704	3300044735	Bacteria	1429
263	Ga0466957_0291583	3300044842	Bacteria	1094
264	Ga0466960_0002946	3300044901	Bacteria	6484
265	Ga0466959_0026167	3300045049	Bacteria	4326
266	Ga0451576_0711287	3300045051	Bacteria	1055
267	Ga0466958_0012700	3300045836	Bacteria	4776
268	Ga0466967_0009435	3300045976	Bacteria	7239
269	Ga0466967_0299876	3300045976	Bacteria	1546
270	Ga0466967_1010506	3300045976	Bacteria	828
271	Ga0495617_000027	3300046452	Bacteria	157385
272	Ga0495629_0082011	3300046459	Bacteria	2250
273	Ga0495651_0020743	3300046462	Bacteria	5102
274	Ga0495651_0041084	3300046462	Bacteria	3593
275	Ga0495651_0062303	3300046462	Bacteria	2854
276	Ga0495653_0085093	3300046463	Bacteria	2327
277	Ga0495580_0127535	3300046472	Bacteria	1766
278	Ga0495639_0008293	3300046475	Bacteria	4459
279	Ga0495664_0366394	3300046477	Bacteria	867
280	Ga0495594_0182216	3300046499	Bacteria	1195
281	Ga0495608_0110088	3300046511	Bacteria	1771
282	Ga0495618_0122470	3300046514	Bacteria	1666
283	Ga0495630_0242882	3300046517	Bacteria	1376
284	Ga0495666_0031841	3300046526	Bacteria	2584
285	Ga0495652_0060648	3300046529	Bacteria	3196
286	Ga0495665_0059177	3300046531	Bacteria	2022
287	Ga0495640_0033838	3300046533	Bacteria	3630
288	Ga0495587_0000093	3300046536	Bacteria	69004
289	Ga0495587_0010753	3300046536	Bacteria	5811
290	Ga0495645_0416375	3300046543	Bacteria	854
291	Ga0495667_0018156	3300046559	Bacteria	4751
292	Ga0495667_0257811	3300046559	Bacteria	1109
293	Ga0495634_0226378	3300046642	Bacteria	1152
294	Ga0495635_0098088	3300046663	Bacteria	2003
295	Ga0495658_0065612	3300046683	Bacteria	2094
296	Ga0495600_0012132	3300046809	Bacteria	5382
297	Ga0495600_0143113	3300046809	Bacteria	1551
298	Ga0495581_0039991	3300047315	Bacteria	2714
299	Ga0495674_0119105	3300047319	Bacteria	2232
300	Ga0495674_0610789	3300047319	Bacteria	863
301	Ga0495676_0092705	3300047321	Bacteria	2254
302	Ga0495680_0006388	3300047322	Bacteria	10965
303	Ga0495684_0009579	3300047471	Bacteria	7467
304	Ga0495593_0041301	3300047673	Bacteria	2480
305	Ga0495602_0000037	3300048088	Bacteria	132280
306	Ga0495602_0093194	3300048088	Bacteria	2493
307	Ga0495602_0124111	3300048088	Bacteria	2072
308	Ga0496100_0236891	3300048903	Bacteria	1345
309	Ga0496102_0409159	3300048905	Bacteria	1275
310	Ga0496106_0130277	3300048909	Bacteria	1972
311	Ga0496109_0113018	3300048912	Bacteria	2526
312	Ga0496112_0002366	3300048915	Bacteria	15154
313	Ga0496114_0031787	3300048917	Bacteria	4343
314	Ga0496126_0153899	3300048929	Bacteria	1969
315	Ga0501033_0000106	3300049570	Bacteria	80617
316	Ga0501034_0001140	3300049571	Bacteria	37002
317	Ga0501034_0001685	3300049571	Bacteria	28484
318	Ga0501034_0120841	3300049571	Bacteria	2606
319	Ga0501036_0183188	3300049572	Bacteria	1763
320	Ga0501068_0005551	3300049584	Bacteria	6910
321	Ga0501069_0017665	3300049585	Bacteria	3844
322	Ga0501069_0020188	3300049585	Bacteria	3608
323	Ga0501070_0066773	3300049586	Bacteria	2979
324	Ga0501070_0122442	3300049586	Bacteria	2150
325	Ga0501073_0179533	3300049589	Bacteria	1465
326	Ga0501223_000001	3300049663	Bacteria	156895
327	Ga0501224_000003	3300049664	Bacteria	189031
328	Ga0501233_000005	3300049668	Bacteria	42581
329	Ga0501235_000002	3300049669	Bacteria	59874
330	Ga0501225_0000001	3300049705	Bacteria	185804
331	Ga0501234_000019	3300049707	Bacteria	17231
332	Ga0501044_0005260	3300049823	Bacteria	14397
333	Ga0501226_000013	3300049853	Bacteria	175177
334	nmdc:mga03683_49281_c1	3300050489	Bacteria	1753
335	nmdc:mga03n38_10281_c1	3300050490	Bacteria	3434
336	nmdc:mga00v17_16182_c1	3300050491	Bacteria	4202
337	nmdc:mga00v17_403_c1	3300050491	Bacteria	24477
338	nmdc:mga0yw44_82850_c1	3300050492	Bacteria	2013
339	nmdc:mga0k408_140574_c1	3300050493	Bacteria	1436
340	nmdc:mga0k408_207056_c1	3300050493	Bacteria	1171
341	nmdc:mga0k408_8651_c1	3300050493	Bacteria	5472
342	nmdc:mga06z11_103803_c1	3300050494	Bacteria	1564
343	nmdc:mga07m45_111858_c1	3300050496	Bacteria	1573
344	nmdc:mga05p37_324937_c1	3300050507	Bacteria	1819
345	nmdc:mga05p37_71452_c1	3300050507	Bacteria	4269
346	nmdc:mga09592_183800_c1	3300050508	Bacteria	1809
347	nmdc:mga06r32_728697_c1	3300050510	Bacteria	956
348	nmdc:mga08y16_22112_c1	3300050511	Bacteria	6714
349	nmdc:mga08y16_478471_c1	3300050511	Bacteria	1267
350	nmdc:mga08y16_695507_c1	3300050511	Bacteria	1017
351	nmdc:mga0a205_333404_c1	3300050515	Bacteria	1386
352	nmdc:mga0sz30_2003_c1	3300050516	Bacteria	7280
353	nmdc:mga0sz30_21434_c1	3300050516	Bacteria	2615
354	nmdc:mga0sz30_922_c1	3300050516	Bacteria	10588
355	Ga0495601_0203590	3300053077	Bacteria	1293
356	Ga0495612_0044207	3300053078	Bacteria	1822
357	Ga0495619_0025023	3300053085	Bacteria	3830
358	Ga0500651_0036271	3300053093	Bacteria	3107
359	Ga0500641_0004206	3300053096	Bacteria	5079
360	Ga0500568_0008733	3300053139	Bacteria	4860
361	Ga0500577_0001678	3300053142	Bacteria	5667
362	Ga0500616_0001986	3300053153	Bacteria	18171
363	Ga0500620_066317	3300053155	Bacteria	1236
364	Ga0500552_001661	3300053733	Bacteria	2125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035120	Ga0373957_0162246	Ga0373957_0162246_136_894	179
2	3300035692	Ga0373935_0077936	Ga0373935_0077936_1372_2130	179
3	3300046536	Ga0495587_0010753	Ga0495587_0010753_1035_1793	179
4	3300035117	Ga0373953_0083384	Ga0373953_0083384_55_813	180
5	3300035119	Ga0373956_0004879	Ga0373956_0004879_1294_2052	180
6	3300035172	Ga0373955_0085580	Ga0373955_0085580_995_1753	180
7	3300036401	Ga0373937_0357644	Ga0373937_0357644_310_1092	180
8	3300046462	Ga0495651_0020743	Ga0495651_0020743_1284_2042	180
9	3300046463	Ga0495653_0085093	Ga0495653_0085093_263_1021	180
10	3300046511	Ga0495608_0110088	Ga0495608_0110088_75_833	180
11	3300046514	Ga0495618_0122470	Ga0495618_0122470_52_810	180
12	3300046517	Ga0495630_0242882	Ga0495630_0242882_370_1128	180
13	3300046543	Ga0495645_0416375	Ga0495645_0416375_86_844	180
14	3300046559	Ga0495667_0018156	Ga0495667_0018156_3168_3926	180
15	3300046809	Ga0495600_0143113	Ga0495600_0143113_416_1198	180
16	3300047319	Ga0495674_0119105	Ga0495674_0119105_269_1027	180
17	3300047322	Ga0495680_0006388	Ga0495680_0006388_5191_5949	180
18	3300048088	Ga0495602_0124111	Ga0495602_0124111_579_1337	180
19	3300044901	Ga0466960_0002946	Ga0466960_0002946_4820_5530	196
20	3300035089	Ga0373944_0117769	Ga0373944_0117769_102_860	198
21	3300005981	Ga0081538_10002383	Ga0081538_1000238311	200
22	3300035410	Ga0373924_0053644	Ga0373924_0053644_990_1661	201
23	3300005563	Ga0068855_100071801	Ga0068855_1000718012	204
24	3300005577	Ga0068857_100104335	Ga0068857_1001043352	204
25	3300005578	Ga0068854_100000322	Ga0068854_10000032220	204
26	3300005614	Ga0068856_100004551	Ga0068856_1000045517	204
27	3300005616	Ga0068852_100002126	Ga0068852_1000021268	204
28	3300025904	Ga0207647_10003676	Ga0207647_100036765	204
29	3300025909	Ga0207705_10000007	Ga0207705_10000007460	204
30	3300025913	Ga0207695_10009783	Ga0207695_100097839	204
31	3300025949	Ga0207667_10039999	Ga0207667_100399993	204
32	3300025981	Ga0207640_10000501	Ga0207640_1000050119	204
33	3300026041	Ga0207639_10468115	Ga0207639_104681151	204
34	3300026078	Ga0207702_10014036	Ga0207702_100140367	204
35	3300026116	Ga0207674_10131740	Ga0207674_101317402	204
36	3300026142	Ga0207698_10000305	Ga0207698_1000030515	204
37	3300002075	JGI24738J21930_10006264	JGI24738J21930_100062642	205
38	3300005337	Ga0070682_100275105	Ga0070682_1002751052	205
39	3300026041	Ga0207639_10474493	Ga0207639_104744931	205
40	3300026067	Ga0207678_10024199	Ga0207678_100241993	205
41	3300026142	Ga0207698_10067608	Ga0207698_100676082	205
42	3300044693	Ga0466961_0005898	Ga0466961_0005898_6773_7519	206
43	3300031911	Ga0307412_10034159	Ga0307412_100341593	208
44	3300032004	Ga0307414_10000576	Ga0307414_1000057610	208
45	3300049663	Ga0501223_000001	Ga0501223_000001_56299_57048	208
46	3300049664	Ga0501224_000003	Ga0501224_000003_88449_89198	208
47	3300049668	Ga0501233_000005	Ga0501233_000005_37663_38412	208
48	3300049669	Ga0501235_000002	Ga0501235_000002_48989_49738	208
49	3300049705	Ga0501225_0000001	Ga0501225_0000001_99848_100597	208
50	3300049707	Ga0501234_000019	Ga0501234_000019_8287_9036	208
51	3300049853	Ga0501226_000013	Ga0501226_000013_74630_75379	208
52	3300005435	Ga0070714_100194614	Ga0070714_1001946142	210
53	3300025929	Ga0207664_10072532	Ga0207664_100725323	210
54	3300031852	Ga0307410_10035140	Ga0307410_100351402	211
55	3300031995	Ga0307409_100199308	Ga0307409_1001993082	211
56	3300032004	Ga0307414_10127754	Ga0307414_101277541	211
57	3300005327	Ga0070658_10000304	Ga0070658_100003042	212
58	3300006844	Ga0075428_100174767	Ga0075428_1001747672	212
59	3300009093	Ga0105240_10023389	Ga0105240_100233895	212
60	3300035083	Ga0373926_0081983	Ga0373926_0081983_10_681	212
61	3300047321	Ga0495676_0092705	Ga0495676_0092705_441_1184	214
62	3300035692	Ga0373935_0195204	Ga0373935_0195204_181_906	217
63	3300047319	Ga0495674_0610789	Ga0495674_0610789_100_807	217
64	3300049570	Ga0501033_0000106	Ga0501033_0000106_30636_31394	217
65	3300049572	Ga0501036_0183188	Ga0501036_0183188_340_1098	217
66	3300049585	Ga0501069_0017665	Ga0501069_0017665_338_1096	217
67	3300049823	Ga0501044_0005260	Ga0501044_0005260_783_1541	217
68	3300005367	Ga0070667_100019146	Ga0070667_1000191466	218
69	3300009147	Ga0114129_11471528	Ga0114129_114715281	218
70	3300025986	Ga0207658_10000964	Ga0207658_100009646	218
71	3300031911	Ga0307412_10003957	Ga0307412_100039573	218
72	3300045976	Ga0466967_1010506	Ga0466967_1010506_44_760	218
73	3300011119	Ga0105246_10318965	Ga0105246_103189651	220
74	3300005435	Ga0070714_100034520	Ga0070714_1000345203	221
75	3300005471	Ga0070698_100627721	Ga0070698_1006277211	221
76	3300006038	Ga0075365_10018056	Ga0075365_100180562	221
77	3300006353	Ga0075370_10105700	Ga0075370_101057002	221
78	3300006844	Ga0075428_100022528	Ga0075428_1000225283	221
79	3300006846	Ga0075430_100054907	Ga0075430_1000549076	221
80	3300009147	Ga0114129_10273325	Ga0114129_102733253	221
81	3300025929	Ga0207664_10046618	Ga0207664_100466183	221
82	3300025972	Ga0207668_10144633	Ga0207668_101446331	221
83	3300037471	Ga0395905_0228347	Ga0395905_0228347_544_1269	221
84	3300050496	nmdc:mga07m45_111858_c1	nmdc:mga07m45_111858_c1_164_916	221
85	3300050507	nmdc:mga05p37_324937_c1	nmdc:mga05p37_324937_c1_286_1011	221
86	3300050516	nmdc:mga0sz30_21434_c1	nmdc:mga0sz30_21434_c1_1380_2132	221
87	3300005327	Ga0070658_10277601	Ga0070658_102776012	222
88	3300005445	Ga0070708_100019171	Ga0070708_1000191717	222
89	3300005467	Ga0070706_100011750	Ga0070706_1000117508	222
90	3300005468	Ga0070707_100100277	Ga0070707_1001002772	222
91	3300005563	Ga0068855_100009282	Ga0068855_10000928211	222
92	3300006028	Ga0070717_10020650	Ga0070717_100206504	222
93	3300009093	Ga0105240_10475376	Ga0105240_104753761	222
94	3300025922	Ga0207646_10024211	Ga0207646_100242115	222
95	3300025949	Ga0207667_10001655	Ga0207667_1000165521	222
96	3300026116	Ga0207674_10189803	Ga0207674_101898032	222
97	3300026142	Ga0207698_10029746	Ga0207698_100297464	222
98	3300013102	Ga0157371_10308879	Ga0157371_103088792	223
99	3300005844	Ga0068862_100440625	Ga0068862_1004406251	224
100	3300028380	Ga0268265_10490396	Ga0268265_104903961	224
101	3300032005	Ga0307411_10004722	Ga0307411_100047227	224
102	3300035398	Ga0316574_0178537	Ga0316574_0178537_454_1197	224
103	iso_pu_bacteria	2862507626	2862513843	224
104	iso_pu_bacteria	3001889506	3001890451	224
105	3300005327	Ga0070658_10000186	Ga0070658_1000018660	225
106	3300005336	Ga0070680_100001179	Ga0070680_10000117920	225
107	3300005458	Ga0070681_10000212	Ga0070681_1000021237	225
108	3300005467	Ga0070706_100003801	Ga0070706_1000038015	225
109	3300005468	Ga0070707_100001669	Ga0070707_10000166918	225
110	3300005518	Ga0070699_100000902	Ga0070699_1000009029	225
111	3300005530	Ga0070679_100086869	Ga0070679_1000868693	225
112	3300005536	Ga0070697_100000792	Ga0070697_10000079220	225
113	3300005563	Ga0068855_100193722	Ga0068855_1001937224	225
114	3300006028	Ga0070717_10014616	Ga0070717_100146166	225
115	3300006844	Ga0075428_100022112	Ga0075428_1000221121	225
116	3300006846	Ga0075430_100262451	Ga0075430_1002624512	225
117	3300006847	Ga0075431_100200262	Ga0075431_1002002622	225
118	3300006880	Ga0075429_100165146	Ga0075429_1001651462	225
119	3300009094	Ga0111539_10000716	Ga0111539_100007164	225
120	3300020081	Ga0206354_11044650	Ga0206354_110446502	225
121	3300020082	Ga0206353_10237024	Ga0206353_102370245	225
122	3300025909	Ga0207705_10000631	Ga0207705_1000063113	225
123	3300025910	Ga0207684_10003660	Ga0207684_1000366012	225
124	3300025912	Ga0207707_10000309	Ga0207707_1000030946	225
125	3300025917	Ga0207660_10000387	Ga0207660_1000038718	225
126	3300025921	Ga0207652_10000050	Ga0207652_1000005042	225
127	3300025922	Ga0207646_10002043	Ga0207646_1000204320	225
128	3300025944	Ga0207661_10457337	Ga0207661_104573372	225
129	3300027907	Ga0207428_10000801	Ga0207428_1000080112	225
130	3300035172	Ga0373955_0061586	Ga0373955_0061586_802_1548	225
131	3300036401	Ga0373937_0135813	Ga0373937_0135813_208_954	225
132	3300050508	nmdc:mga09592_183800_c1	nmdc:mga09592_183800_c1_406_1137	225
133	3300050511	nmdc:mga08y16_22112_c1	nmdc:mga08y16_22112_c1_5433_6164	225
134	3300031889	Ga0326468_10005757	Ga0326468_100057572	226
135	3300031911	Ga0307412_10205697	Ga0307412_102056972	226
136	3300044706	Ga0466964_0064162	Ga0466964_0064162_228_974	226
137	3300045976	Ga0466967_0009435	Ga0466967_0009435_3011_3757	226
138	3300005834	Ga0068851_10008342	Ga0068851_100083425	227
139	3300009094	Ga0111539_10046921	Ga0111539_100469212	227
140	3300025904	Ga0207647_10000202	Ga0207647_1000020224	227
141	3300025909	Ga0207705_10016513	Ga0207705_100165133	227
142	3300025913	Ga0207695_10004559	Ga0207695_1000455912	227
143	3300025914	Ga0207671_10002153	Ga0207671_1000215315	227
144	3300025919	Ga0207657_10041729	Ga0207657_100417293	227
145	3300025949	Ga0207667_10005039	Ga0207667_1000503911	227
146	3300026078	Ga0207702_10002371	Ga0207702_1000237111	227
147	3300031727	Ga0316576_10047201	Ga0316576_100472012	227
148	3300031852	Ga0307410_10108845	Ga0307410_101088452	227
149	3300031901	Ga0307406_10462379	Ga0307406_104623791	227
150	3300032004	Ga0307414_10932479	Ga0307414_109324791	227
151	3300035089	Ga0373944_0005151	Ga0373944_0005151_2093_2839	227
152	3300035116	Ga0373945_0194093	Ga0373945_0194093_27_773	227
153	3300035118	Ga0373954_0033428	Ga0373954_0033428_227_973	227
154	3300035170	Ga0373943_0088314	Ga0373943_0088314_791_1537	227
155	3300035692	Ga0373935_0025838	Ga0373935_0025838_2798_3544	227
156	3300035695	Ga0373927_0002164	Ga0373927_0002164_3762_4508	227
157	3300035725	Ga0373947_0156009	Ga0373947_0156009_249_995	227
158	3300036401	Ga0373937_0014671	Ga0373937_0014671_258_1004	227
159	3300037068	Ga0373925_0003842	Ga0373925_0003842_3783_4529	227
160	3300046459	Ga0495629_0082011	Ga0495629_0082011_302_1048	227
161	3300046462	Ga0495651_0062303	Ga0495651_0062303_317_1063	227
162	3300046475	Ga0495639_0008293	Ga0495639_0008293_399_1145	227
163	3300046531	Ga0495665_0059177	Ga0495665_0059177_178_924	227
164	3300046533	Ga0495640_0033838	Ga0495640_0033838_601_1347	227
165	3300046559	Ga0495667_0257811	Ga0495667_0257811_100_846	227
166	3300046642	Ga0495634_0226378	Ga0495634_0226378_87_833	227
167	3300046663	Ga0495635_0098088	Ga0495635_0098088_55_801	227
168	3300046683	Ga0495658_0065612	Ga0495658_0065612_250_996	227
169	3300046809	Ga0495600_0012132	Ga0495600_0012132_3620_4366	227
170	3300047315	Ga0495581_0039991	Ga0495581_0039991_1681_2427	227
171	3300047471	Ga0495684_0009579	Ga0495684_0009579_5546_6292	227
172	3300047673	Ga0495593_0041301	Ga0495593_0041301_1592_2338	227
173	3300049585	Ga0501069_0020188	Ga0501069_0020188_921_1661	227
174	3300049586	Ga0501070_0066773	Ga0501070_0066773_1918_2658	227
175	3300053085	Ga0495619_0025023	Ga0495619_0025023_3059_3805	227
176	iso_pu_bacteria	2523231044	2523383048	227
177	iso_pu_bacteria	2643221604	2644034742	227
178	iso_pu_bacteria	2738543028	2739332547	227
179	3300005937	Ga0081455_10154226	Ga0081455_101542263	228
180	3300039450	Ga0436363_1471705	Ga0436363_1471705_406_1206	228
181	3300044735	Ga0466968_0080704	Ga0466968_0080704_391_1137	228
182	3300044842	Ga0466957_0291583	Ga0466957_0291583_22_768	228
183	3300045836	Ga0466958_0012700	Ga0466958_0012700_3829_4575	228
184	3300045976	Ga0466967_0299876	Ga0466967_0299876_183_929	228
185	3300046499	Ga0495594_0182216	Ga0495594_0182216_225_968	229
186	3300046526	Ga0495666_0031841	Ga0495666_0031841_760_1503	229
187	3300005336	Ga0070680_100001985	Ga0070680_1000019853	230
188	3300005365	Ga0070688_100012466	Ga0070688_1000124664	230
189	3300005530	Ga0070679_100048869	Ga0070679_1000488694	230
190	3300005546	Ga0070696_100245500	Ga0070696_1002455002	230
191	3300005563	Ga0068855_100187895	Ga0068855_1001878953	230
192	3300005937	Ga0081455_10060376	Ga0081455_100603762	230
193	3300006177	Ga0075362_10050732	Ga0075362_100507322	230
194	3300009093	Ga0105240_10027768	Ga0105240_100277684	230
195	3300009098	Ga0105245_10247329	Ga0105245_102473292	230
196	3300009176	Ga0105242_10521533	Ga0105242_105215332	230
197	3300009177	Ga0105248_10498538	Ga0105248_104985382	230
198	3300009551	Ga0105238_10628130	Ga0105238_106281301	230
199	3300013306	Ga0163162_10787557	Ga0163162_107875572	230
200	3300024225	Ga0224572_1018885	Ga0224572_10188851	230
201	3300025909	Ga0207705_10010305	Ga0207705_100103056	230
202	3300025912	Ga0207707_10088306	Ga0207707_100883063	230
203	3300025913	Ga0207695_10015634	Ga0207695_100156347	230
204	3300026116	Ga0207674_10091441	Ga0207674_100914414	230
205	3300037312	Ga0395899_0001978	Ga0395899_0001978_1934_2686	230
206	3300037312	Ga0395899_0112227	Ga0395899_0112227_650_1402	230
207	3300037418	Ga0395900_0044617	Ga0395900_0044617_2633_3385	230
208	3300037466	Ga0395898_0249238	Ga0395898_0249238_742_1488	230
209	3300038443	Ga0395901_0001952	Ga0395901_0001952_4125_4877	230
210	3300038443	Ga0395901_0021996	Ga0395901_0021996_1642_2394	230
211	3300039437	Ga0436365_0036866	Ga0436365_0036866_153_905	230
212	3300044684	Ga0466966_0180426	Ga0466966_0180426_144_881	230
213	3300049571	Ga0501034_0001140	Ga0501034_0001140_34366_35118	230
214	3300049571	Ga0501034_0001685	Ga0501034_0001685_20749_21501	230
215	3300049571	Ga0501034_0120841	Ga0501034_0120841_455_1207	230
216	3300049584	Ga0501068_0005551	Ga0501068_0005551_67_819	230
217	3300049586	Ga0501070_0122442	Ga0501070_0122442_185_937	230
218	3300049589	Ga0501073_0179533	Ga0501073_0179533_434_1186	230
219	3300050493	nmdc:mga0k408_8651_c1	nmdc:mga0k408_8651_c1_588_1340	230
220	3300050511	nmdc:mga08y16_695507_c1	nmdc:mga08y16_695507_c1_180_929	230
221	3300053077	Ga0495601_0203590	Ga0495601_0203590_378_1133	230
222	3300053153	Ga0500616_0001986	Ga0500616_0001986_11174_11926	230
223	3300053155	Ga0500620_066317	Ga0500620_066317_155_907	230
224	3300053733	Ga0500552_001661	Ga0500552_001661_171_923	230
225	3300005356	Ga0070674_100013009	Ga0070674_1000130093	231
226	3300005434	Ga0070709_10006146	Ga0070709_100061464	231
227	3300005437	Ga0070710_10179234	Ga0070710_101792341	231
228	3300005439	Ga0070711_100013075	Ga0070711_1000130754	231
229	3300005440	Ga0070705_100013314	Ga0070705_1000133143	231
230	3300005441	Ga0070700_100086029	Ga0070700_1000860292	231
231	3300005456	Ga0070678_100026640	Ga0070678_1000266404	231
232	3300005459	Ga0068867_100109900	Ga0068867_1001099002	231
233	3300005471	Ga0070698_100018169	Ga0070698_1000181696	231
234	3300005547	Ga0070693_100074740	Ga0070693_1000747402	231
235	3300005549	Ga0070704_100009329	Ga0070704_1000093293	231
236	3300005718	Ga0068866_10061125	Ga0068866_100611253	231
237	3300006038	Ga0075365_10101732	Ga0075365_101017322	231
238	3300006048	Ga0075363_100009329	Ga0075363_1000093294	231
239	3300006051	Ga0075364_10000483	Ga0075364_1000048317	231
240	3300006051	Ga0075364_10020723	Ga0075364_100207232	231
241	3300006173	Ga0070716_100006080	Ga0070716_1000060806	231
242	3300006175	Ga0070712_100005799	Ga0070712_1000057995	231
243	3300006186	Ga0075369_10000886	Ga0075369_100008863	231
244	3300006844	Ga0075428_100015098	Ga0075428_1000150985	231
245	3300006847	Ga0075431_100020301	Ga0075431_1000203012	231
246	3300006881	Ga0068865_100026166	Ga0068865_1000261664	231
247	3300009098	Ga0105245_10044872	Ga0105245_100448723	231
248	3300009147	Ga0114129_10044831	Ga0114129_100448315	231
249	3300009148	Ga0105243_10359504	Ga0105243_103595042	231
250	3300009176	Ga0105242_10215551	Ga0105242_102155512	231
251	3300009553	Ga0105249_10036049	Ga0105249_100360494	231
252	3300009553	Ga0105249_10409833	Ga0105249_104098332	231
253	3300010159	Ga0099796_10002826	Ga0099796_100028263	231
254	3300021358	Ga0213873_10012985	Ga0213873_100129852	231
255	3300025898	Ga0207692_10010092	Ga0207692_100100924	231
256	3300025899	Ga0207642_10042238	Ga0207642_100422382	231
257	3300025906	Ga0207699_10003209	Ga0207699_100032097	231
258	3300025915	Ga0207693_10000419	Ga0207693_1000041910	231
259	3300025916	Ga0207663_10017417	Ga0207663_100174172	231
260	3300025927	Ga0207687_10041967	Ga0207687_100419673	231
261	3300025932	Ga0207690_10170303	Ga0207690_101703032	231
262	3300025937	Ga0207669_10013798	Ga0207669_100137984	231
263	3300025938	Ga0207704_10011745	Ga0207704_100117454	231
264	3300025961	Ga0207712_10036810	Ga0207712_100368103	231
265	3300025981	Ga0207640_10559716	Ga0207640_105597162	231
266	3300026023	Ga0207677_10121165	Ga0207677_101211653	231
267	3300026075	Ga0207708_10136031	Ga0207708_101360313	231
268	3300026121	Ga0207683_10043704	Ga0207683_100437042	231
269	3300028380	Ga0268265_10170678	Ga0268265_101706782	231
270	3300028381	Ga0268264_10051549	Ga0268264_100515493	231
271	3300028794	Ga0307515_10065868	Ga0307515_100658685	231
272	3300030521	Ga0307511_10199002	Ga0307511_101990022	231
273	3300031456	Ga0307513_10348663	Ga0307513_103486632	231
274	3300031730	Ga0307516_10521439	Ga0307516_105214391	231
275	3300033179	Ga0307507_10257062	Ga0307507_102570622	231
276	3300037418	Ga0395900_0044247	Ga0395900_0044247_3622_4383	231
277	3300037466	Ga0395898_0790260	Ga0395898_0790260_85_843	231
278	3300037471	Ga0395905_0556805	Ga0395905_0556805_70_831	231
279	3300039453	Ga0436362_0259081	Ga0436362_0259081_1901_2656	231
280	3300048903	Ga0496100_0236891	Ga0496100_0236891_555_1313	231
281	3300048905	Ga0496102_0409159	Ga0496102_0409159_86_844	231
282	3300048909	Ga0496106_0130277	Ga0496106_0130277_830_1588	231
283	3300048912	Ga0496109_0113018	Ga0496109_0113018_144_902	231
284	3300048915	Ga0496112_0002366	Ga0496112_0002366_11900_12658	231
285	3300050490	nmdc:mga03n38_10281_c1	nmdc:mga03n38_10281_c1_378_1136	231
286	3300050491	nmdc:mga00v17_16182_c1	nmdc:mga00v17_16182_c1_3004_3762	231
287	3300050491	nmdc:mga00v17_403_c1	nmdc:mga00v17_403_c1_13505_14263	231
288	3300050492	nmdc:mga0yw44_82850_c1	nmdc:mga0yw44_82850_c1_977_1735	231
289	3300050507	nmdc:mga05p37_71452_c1	nmdc:mga05p37_71452_c1_104_862	231
290	3300050510	nmdc:mga06r32_728697_c1	nmdc:mga06r32_728697_c1_173_931	231
291	3300050516	nmdc:mga0sz30_2003_c1	nmdc:mga0sz30_2003_c1_3074_3832	231
292	3300053142	Ga0500577_0001678	Ga0500577_0001678_4713_5471	231
293	3300045049	Ga0466959_0026167	Ga0466959_0026167_1037_1786	232
294	iso_pu_bacteria	2751185897	2753764968	232
295	3300046452	Ga0495617_000027	Ga0495617_000027_154535_155314	233
296	3300050515	nmdc:mga0a205_333404_c1	nmdc:mga0a205_333404_c1_141_914	233
297	3300035086	Ga0373934_0063931	Ga0373934_0063931_493_1239	234
298	3300035119	Ga0373956_0024327	Ga0373956_0024327_952_1698	234
299	3300035120	Ga0373957_0084225	Ga0373957_0084225_457_1203	234
300	3300035170	Ga0373943_0046122	Ga0373943_0046122_853_1599	234
301	3300035692	Ga0373935_0121266	Ga0373935_0121266_412_1158	234
302	3300035724	Ga0373933_0001397	Ga0373933_0001397_6257_7003	234
303	3300035724	Ga0373933_0041758	Ga0373933_0041758_1397_2143	234
304	3300035725	Ga0373947_0008433	Ga0373947_0008433_801_1547	234
305	3300036401	Ga0373937_0000020	Ga0373937_0000020_110782_111528	234
306	3300036401	Ga0373937_0006679	Ga0373937_0006679_7962_8708	234
307	3300042156	Ga0439446_0007871	Ga0439446_0007871_850_1596	234
308	3300042876	Ga0451577_0426152	Ga0451577_0426152_32_778	234
309	3300045051	Ga0451576_0711287	Ga0451576_0711287_279_1025	234
310	3300046462	Ga0495651_0041084	Ga0495651_0041084_939_1685	234
311	3300046472	Ga0495580_0127535	Ga0495580_0127535_812_1558	234
312	3300046477	Ga0495664_0366394	Ga0495664_0366394_88_834	234
313	3300046529	Ga0495652_0060648	Ga0495652_0060648_91_837	234
314	3300046536	Ga0495587_0000093	Ga0495587_0000093_59820_60566	234
315	3300048088	Ga0495602_0000037	Ga0495602_0000037_59841_60587	234
316	3300048088	Ga0495602_0093194	Ga0495602_0093194_850_1596	234
317	3300048917	Ga0496114_0031787	Ga0496114_0031787_46_825	234
318	3300053078	Ga0495612_0044207	Ga0495612_0044207_732_1478	234
319	3300005468	Ga0070707_100101597	Ga0070707_1001015973	235
320	3300005471	Ga0070698_100000587	Ga0070698_10000058730	235
321	3300005536	Ga0070697_100293498	Ga0070697_1002934982	235
322	3300005937	Ga0081455_10002011	Ga0081455_1000201115	235
323	3300005937	Ga0081455_10151174	Ga0081455_101511743	235
324	3300006038	Ga0075365_10257263	Ga0075365_102572632	235
325	3300006042	Ga0075368_10025573	Ga0075368_100255734	235
326	3300006177	Ga0075362_10029001	Ga0075362_100290013	235
327	3300006186	Ga0075369_10002056	Ga0075369_100020565	235
328	3300006195	Ga0075366_10101498	Ga0075366_101014982	235
329	3300007265	Ga0099794_10077647	Ga0099794_100776473	235
330	3300007265	Ga0099794_10159411	Ga0099794_101594112	235
331	3300021384	Ga0213876_10001894	Ga0213876_1000189410	235
332	3300025922	Ga0207646_10291168	Ga0207646_102911682	235
333	3300026075	Ga0207708_10427312	Ga0207708_104273122	235
334	3300031241	Ga0265325_10108193	Ga0265325_101081932	235
335	3300031344	Ga0265316_10346901	Ga0265316_103469011	235
336	3300038443	Ga0395901_0399687	Ga0395901_0399687_109_885	235
337	3300039062	Ga0400483_171132	Ga0400483_171132_3022_3789	235
338	3300039062	Ga0400483_271930	Ga0400483_271930_853_1650	235
339	3300039437	Ga0436365_0473069	Ga0436365_0473069_11605_12375	235
340	3300041411	Ga0439466_0047842	Ga0439466_0047842_266_1033	235
341	3300042438	Ga0439459_0018424	Ga0439459_0018424_402_1169	235
342	3300048929	Ga0496126_0153899	Ga0496126_0153899_408_1175	235
343	3300050489	nmdc:mga03683_49281_c1	nmdc:mga03683_49281_c1_831_1598	235
344	3300050493	nmdc:mga0k408_140574_c1	nmdc:mga0k408_140574_c1_366_1133	235
345	3300050493	nmdc:mga0k408_207056_c1	nmdc:mga0k408_207056_c1_232_999	235
346	3300050494	nmdc:mga06z11_103803_c1	nmdc:mga06z11_103803_c1_759_1526	235
347	3300050511	nmdc:mga08y16_478471_c1	nmdc:mga08y16_478471_c1_242_1012	235
348	3300050516	nmdc:mga0sz30_922_c1	nmdc:mga0sz30_922_c1_4389_5156	235
349	3300053093	Ga0500651_0036271	Ga0500651_0036271_1145_1912	235
350	3300053096	Ga0500641_0004206	Ga0500641_0004206_3406_4173	235
351	3300053139	Ga0500568_0008733	Ga0500568_0008733_1187_1957	235
352	3300001904	JGI24736J21556_1000005	JGI24736J21556_100000526	236
353	3300001979	JGI24740J21852_10019618	JGI24740J21852_100196182	236
354	3300001990	JGI24737J22298_10004882	JGI24737J22298_100048823	236
355	3300002067	JGI24735J21928_10005707	JGI24735J21928_100057074	236
356	3300005339	Ga0070660_100298930	Ga0070660_1002989301	236
357	3300005344	Ga0070661_100150109	Ga0070661_1001501092	236
358	3300005539	Ga0068853_100002727	Ga0068853_1000027276	236
359	3300005614	Ga0068856_100623564	Ga0068856_1006235642	236
360	3300005616	Ga0068852_100051163	Ga0068852_1000511633	236
361	3300005834	Ga0068851_10100382	Ga0068851_101003821	236
362	3300009545	Ga0105237_10282222	Ga0105237_102822222	236
363	3300013104	Ga0157370_10009037	Ga0157370_100090375	236
364	3300025321	Ga0207656_10098410	Ga0207656_100984102	236
365	3300025911	Ga0207654_10049458	Ga0207654_100494582	236
366	3300025924	Ga0207694_10100167	Ga0207694_101001672	236
367	3300026041	Ga0207639_10004659	Ga0207639_100046595	236
368	3300026078	Ga0207702_10540586	Ga0207702_105405861	236
369	3300026116	Ga0207674_10035931	Ga0207674_100359312	236
370	3300026142	Ga0207698_10156689	Ga0207698_101566892	236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

18

211

0.98 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

24

263

0.93 PF08659

KR

KR domain

19

200

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4jro-assembly1.cif.gz_C	crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+	0.9491	4	230
4cqm-assembly1.cif.gz_K	crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp	0.9458	29	234
5vt6-assembly1.cif.gz_A	crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with nadp	0.9421	24	230
4cqm-assembly2.cif.gz_B	crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp	0.9421	29	234
1iy8-assembly1.cif.gz_B	crystal structure of levodione reductase	0.9407	28	234

ID	Description	Score	Start	End	Superfamily
af_Q0JDU3_1_168_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9705	67	230	3.40.50.720
af_F4J128_251_373_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9626	80	176	3.40.50.720
4hsyA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9507	26	232	3.40.50.720
af_Q2FVE2_1_206_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9506	47	234	3.40.50.720
af_Q942W0_6_280_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9488	40	233	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A2V8TJW3-F1-model_v4	3-oxoacyl-ACP reductase	0.985	27	230	GO:0016491
AF-A0A2V2R5E8-F1-model_v4	deleted	0.9833	29	230
AF-A0A348XLB3-F1-model_v4	Lipoyl-binding domain-containing protein	0.9813	26	230	GO:0016491 GO:0016746
AF-A0A6N9GWI2-F1-model_v4	SDR family oxidoreductase	0.9789	32	231	GO:0016491
AF-A0A3Q8UC80-F1-model_v4	3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100)	0.978	29	230	GO:0004316 GO:0006633 GO:0051287

Feature Viewer

pLDDT	pTM	Quality
89.18	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F425477

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

18

211

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

24

263

0.93

PF08659

KR

KR domain

19

200

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map