F425083

General Info

Members Datasets Scaffolds Average Seq Length
369 246 365 149

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10010885|Ga0265330_100108854
Length 155
Sequence MTGTVKLHRILKGKTARVYRALLEADALAKWLPPYGFTCTVHHTEPKVGGTFRMSFRNFTTGNGHSFGGEYIALVPNEKVAYTDRFDDPKMKGTMTTTITLRALPPNLGGGTELTVVQEGIPDMIPVEMCYMGWQESLEQLAKLVDPEIPDAGPA

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
3 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
85 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
86 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
87 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
246 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 1.08
Rhizoplane 5.15
Rhizosphere 83.74
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10013535 3300002239 Bacteria 1238
2 rootH2_10020112 3300003320 Bacteria 13144
3 JGI25404J52841_10001487 3300003659 Bacteria 4136
4 Ga0065704_10545568 3300005289 Bacteria 638
5 Ga0065712_10433219 3300005290 Bacteria 701
6 Ga0065715_10145014 3300005293 Bacteria 1800
7 Ga0065707_10220158 3300005295 Bacteria 1228
8 Ga0070658_10326918 3300005327 Bacteria 1310
9 Ga0070676_10346597 3300005328 Bacteria 1020
10 Ga0070683_100423309 3300005329 Bacteria 1270
11 Ga0070670_100196971 3300005331 Bacteria 1750
12 Ga0068869_100662185 3300005334 Bacteria 887
13 Ga0070666_10061406 3300005335 Bacteria 2544
14 Ga0070682_100330880 3300005337 Bacteria 1129
15 Ga0068868_100050944 3300005338 Bacteria 3254
16 Ga0068868_100261348 3300005338 Bacteria 1460
17 Ga0070689_100004010 3300005340 Bacteria 9898
18 Ga0070687_100174396 3300005343 Bacteria 1282
19 Ga0070661_100081666 3300005344 Bacteria 2387
20 Ga0070661_100170269 3300005344 Bacteria 1654
21 Ga0070661_101286538 3300005344 Bacteria 613
22 Ga0070668_100527103 3300005347 Bacteria 1026
23 Ga0070668_100555274 3300005347 Bacteria 1000
24 Ga0070675_100065416 3300005354 Bacteria 3006
25 Ga0070671_100107724 3300005355 Bacteria 2340
26 Ga0070674_100282409 3300005356 Bacteria 1316
27 Ga0070674_101123606 3300005356 Bacteria 695
28 Ga0070688_100004559 3300005365 Bacteria 7225
29 Ga0070667_100190339 3300005367 Bacteria 1817
30 Ga0070700_100251983 3300005441 Bacteria 1267
31 Ga0070694_100414375 3300005444 Bacteria 1057
32 Ga0070663_100124185 3300005455 Bacteria 1953
33 Ga0070663_100169489 3300005455 Bacteria 1686
34 Ga0070663_100422418 3300005455 Bacteria 1094
35 Ga0070678_100107740 3300005456 Bacteria 2174
36 Ga0070678_100375890 3300005456 Bacteria 1228
37 Ga0070678_100836400 3300005456 Bacteria 838
38 Ga0070678_101195862 3300005456 Bacteria 705
39 Ga0070662_100020160 3300005457 Bacteria 4537
40 Ga0070662_100189761 3300005457 Bacteria 1624
41 Ga0070662_100299907 3300005457 Bacteria 1305
42 Ga0068867_100027232 3300005459 Bacteria 4107
43 Ga0068867_100946340 3300005459 Bacteria 778
44 Ga0070685_10009078 3300005466 Bacteria 5131
45 Ga0068853_100000034 3300005539 Bacteria 113508
46 Ga0068853_100167346 3300005539 Bacteria 1987
47 Ga0070672_100584522 3300005543 Bacteria 972
48 Ga0070693_100005434 3300005547 Bacteria 6121
49 Ga0070693_100064164 3300005547 Bacteria 2143
50 Ga0070693_100252396 3300005547 Bacteria 1170
51 Ga0070665_100018384 3300005548 Bacteria 7005
52 Ga0070665_100053445 3300005548 Bacteria 4051
53 Ga0070665_100126740 3300005548 Bacteria 2555
54 Ga0070665_100229038 3300005548 Bacteria 1858
55 Ga0070665_101211356 3300005548 Bacteria 766
56 Ga0070665_101678256 3300005548 Bacteria 643
57 Ga0070704_100249059 3300005549 Bacteria 1458
58 Ga0068855_100228607 3300005563 Bacteria 2084
59 Ga0070664_100766166 3300005564 Bacteria 901
60 Ga0068857_100038300 3300005577 Bacteria 4246
61 Ga0068854_100120925 3300005578 Bacteria 1988
62 Ga0068854_100170131 3300005578 Bacteria 1695
63 Ga0070702_100573865 3300005615 Bacteria 841
64 Ga0068852_100073262 3300005616 Bacteria 3012
65 Ga0068852_100165347 3300005616 Bacteria 2070
66 Ga0068852_100556533 3300005616 Bacteria 1148
67 Ga0068859_100052584 3300005617 Bacteria 4095
68 Ga0068859_100083142 3300005617 Bacteria 3244
69 Ga0068859_101932413 3300005617 Bacteria 651
70 Ga0068864_100004086 3300005618 Bacteria 11984
71 Ga0068864_100699559 3300005618 Bacteria 990
72 Ga0068861_100767919 3300005719 Bacteria 902
73 Ga0068851_10037646 3300005834 Bacteria 2425
74 Ga0068870_10002423 3300005840 Bacteria 7762
75 Ga0068863_100052652 3300005841 Bacteria 3857
76 Ga0068863_101368662 3300005841 Bacteria 715
77 Ga0068860_100047311 3300005843 Bacteria 4100
78 Ga0068860_100140293 3300005843 Bacteria 2323
79 Ga0081455_10190721 3300005937 Bacteria 1544
80 Ga0081540_1001267 3300005983 Bacteria 22006
81 Ga0081540_1027282 3300005983 Bacteria 3240
82 Ga0081540_1039365 3300005983 Bacteria 2479
83 Ga0081539_10000498 3300005985 Bacteria 82216
84 Ga0081539_10031508 3300005985 Bacteria 3266
85 Ga0081539_10051395 3300005985 Bacteria 2323
86 Ga0075365_10071550 3300006038 Bacteria 2335
87 Ga0075365_10216053 3300006038 Bacteria 1345
88 Ga0075368_10311539 3300006042 Bacteria 680
89 Ga0075363_100425426 3300006048 Bacteria 782
90 Ga0075362_10010466 3300006177 Unclassified 3622
91 Ga0075362_10042450 3300006177 Bacteria 2010
92 Ga0075362_10056095 3300006177 Bacteria 1773
93 Ga0075362_10057423 3300006177 Bacteria 1754
94 Ga0075367_10626440 3300006178 Bacteria 684
95 Ga0097621_100000101 3300006237 Bacteria 48184
96 Ga0097621_100026705 3300006237 Bacteria 4532
97 Ga0075370_10030827 3300006353 Bacteria 2993
98 Ga0075370_10645041 3300006353 Bacteria 642
99 Ga0068871_100000858 3300006358 Bacteria 20274
100 Ga0068871_100007801 3300006358 Bacteria 7663
101 Ga0075428_100002222 3300006844 Bacteria 21034
102 Ga0075428_100286427 3300006844 Bacteria 1772
103 Ga0075428_100412604 3300006844 Bacteria 1447
104 Ga0075430_100086972 3300006846 Bacteria 2616
105 Ga0075430_100771509 3300006846 Bacteria 792
106 Ga0075431_100668513 3300006847 Bacteria 1018
107 Ga0075429_100051264 3300006880 Bacteria 3591
108 Ga0075429_100107536 3300006880 Bacteria 2437
109 Ga0068865_101092097 3300006881 Bacteria 702
110 Ga0097620_100052587 3300006931 Bacteria 4095
111 Ga0097620_100083145 3300006931 Bacteria 3244
112 Ga0097620_101932415 3300006931 Bacteria 651
113 Ga0075435_101862807 3300007076 Bacteria 528
114 Ga0105244_10005844 3300009036 Bacteria 8083
115 Ga0105240_10138735 3300009093 Bacteria 2909
116 Ga0111539_10000539 3300009094 Bacteria 48163
117 Ga0111539_10007106 3300009094 Bacteria 14350
118 Ga0111539_10700669 3300009094 Bacteria 1179
119 Ga0105245_10139799 3300009098 Bacteria 2279
120 Ga0105245_11333555 3300009098 Bacteria 767
121 Ga0105245_11395805 3300009098 Bacteria 750
122 Ga0114129_10081935 3300009147 Bacteria 4485
123 Ga0114129_10225146 3300009147 Bacteria 2528
124 Ga0105243_10557970 3300009148 Bacteria 1095
125 Ga0105243_10711218 3300009148 Bacteria 980
126 Ga0105243_11039871 3300009148 Bacteria 824
127 Ga0105242_10244769 3300009176 Bacteria 1614
128 Ga0105242_11722635 3300009176 Bacteria 663
129 Ga0105248_10650373 3300009177 Bacteria 1189
130 Ga0105248_11861945 3300009177 Bacteria 683
131 Ga0105238_10016401 3300009551 Bacteria 7498
132 Ga0105238_11255422 3300009551 Bacteria 766
133 Ga0105249_10567197 3300009553 Bacteria 1187
134 Ga0099796_10176617 3300010159 Unclassified 855
135 Ga0105239_10053965 3300010375 Bacteria 4407
136 Ga0105239_10351758 3300010375 Bacteria 1664
137 Ga0105239_10917448 3300010375 Bacteria 1005
138 Ga0105239_13169391 3300010375 Bacteria 536
139 Ga0105246_10582566 3300011119 Bacteria 964
140 Ga0105246_11249070 3300011119 Bacteria 686
141 Ga0157323_1001504 3300012495 Bacteria 1178
142 Ga0157342_1014642 3300012507 Bacteria 851
143 Ga0157327_1000466 3300012512 Bacteria 2165
144 Ga0157326_1051399 3300012513 Bacteria 606
145 Ga0157373_11561584 3300013100 Bacteria 505
146 Ga0157369_10977203 3300013105 Bacteria 867
147 Ga0157374_10060337 3300013296 Bacteria 3549
148 Ga0157378_10048364 3300013297 Bacteria 3782
149 Ga0157378_10051180 3300013297 Bacteria 3675
150 Ga0163162_11011381 3300013306 Bacteria 940
151 Ga0157375_10508688 3300013308 Bacteria 1368
152 Ga0157375_10548541 3300013308 Bacteria 1318
153 Ga0157375_11610173 3300013308 Bacteria 768
154 Ga0163163_10000002 3300014325 Bacteria 609846
155 Ga0157380_10194355 3300014326 Bacteria 1794
156 Ga0157380_10385833 3300014326 Bacteria 1324
157 Ga0157377_10127512 3300014745 Bacteria 1550
158 Ga0157377_11543806 3300014745 Bacteria 530
159 Ga0157379_10001000 3300014968 Bacteria 22965
160 Ga0157376_10182097 3300014969 Bacteria 1921
161 Ga0163161_10341626 3300017792 Bacteria 1188
162 Ga0207666_1025496 3300025271 Bacteria 887
163 Ga0209758_1004245 3300025297 Bacteria 12126
164 Ga0209256_1067869 3300025299 Bacteria 810
165 Ga0207697_10001907 3300025315 Bacteria 11108
166 Ga0207656_10006854 3300025321 Bacteria 4124
167 Ga0207655_1006589 3300025728 Bacteria 7659
168 Ga0207682_10000850 3300025893 Bacteria 14174
169 Ga0207688_10000680 3300025901 Bacteria 16796
170 Ga0207680_10043301 3300025903 Bacteria 2639
171 Ga0207647_10082261 3300025904 Bacteria 1929
172 Ga0207645_10005271 3300025907 Bacteria 9415
173 Ga0207643_10000188 3300025908 Bacteria 42556
174 Ga0207705_10295855 3300025909 Bacteria 1241
175 Ga0207695_10564527 3300025913 Bacteria 1019
176 Ga0207671_10123634 3300025914 Bacteria 1980
177 Ga0207663_10763101 3300025916 Bacteria 769
178 Ga0207660_10803322 3300025917 Bacteria 768
179 Ga0207649_10113498 3300025920 Bacteria 1815
180 Ga0207681_10127011 3300025923 Bacteria 1879
181 Ga0207681_10984798 3300025923 Bacteria 707
182 Ga0207694_10381467 3300025924 Bacteria 1170
183 Ga0207694_10854658 3300025924 Bacteria 769
184 Ga0207650_10000694 3300025925 Bacteria 26312
185 Ga0207650_10175721 3300025925 Bacteria 1704
186 Ga0207659_10035434 3300025926 Bacteria 3449
187 Ga0207644_10189452 3300025931 Bacteria 1616
188 Ga0207644_10363242 3300025931 Bacteria 1178
189 Ga0207690_10560940 3300025932 Bacteria 929
190 Ga0207706_10029888 3300025933 Bacteria 4864
191 Ga0207706_10035571 3300025933 Bacteria 4427
192 Ga0207706_10405273 3300025933 Bacteria 1182
193 Ga0207709_10190503 3300025935 Bacteria 1456
194 Ga0207669_10204336 3300025937 Bacteria 1437
195 Ga0207704_10953496 3300025938 Bacteria 724
196 Ga0207704_11541438 3300025938 Bacteria 570
197 Ga0207711_10122894 3300025941 Bacteria 2319
198 Ga0207689_10512628 3300025942 Bacteria 1005
199 Ga0207689_10651263 3300025942 Bacteria 887
200 Ga0207667_11036624 3300025949 Bacteria 806
201 Ga0207712_10291173 3300025961 Bacteria 1336
202 Ga0207668_10131250 3300025972 Bacteria 1913
203 Ga0207668_12016225 3300025972 Bacteria 520
204 Ga0207640_10089242 3300025981 Bacteria 2130
205 Ga0207658_10530801 3300025986 Bacteria 1051
206 Ga0207677_10067833 3300026023 Bacteria 2500
207 Ga0207703_10124371 3300026035 Bacteria 2218
208 Ga0207639_10000052 3300026041 Bacteria 113608
209 Ga0207639_10167786 3300026041 Bacteria 1856
210 Ga0207639_10424992 3300026041 Bacteria 1202
211 Ga0207639_11349763 3300026041 Bacteria 669
212 Ga0207678_10006127 3300026067 Bacteria 10696
213 Ga0207678_10062936 3300026067 Bacteria 3188
214 Ga0207678_10068877 3300026067 Bacteria 3035
215 Ga0207678_10212678 3300026067 Bacteria 1654
216 Ga0207641_10431544 3300026088 Bacteria 1270
217 Ga0207648_10037613 3300026089 Bacteria 4264
218 Ga0207648_10052124 3300026089 Bacteria 3577
219 Ga0207648_10999517 3300026089 Bacteria 783
220 Ga0207676_10001767 3300026095 Bacteria 15841
221 Ga0207676_11251509 3300026095 Bacteria 736
222 Ga0207674_10016255 3300026116 Bacteria 8151
223 Ga0207674_10495254 3300026116 Bacteria 1181
224 Ga0207675_100045804 3300026118 Bacteria 4086
225 Ga0207675_100169682 3300026118 Bacteria 2085
226 Ga0207683_10017447 3300026121 Bacteria 6118
227 Ga0207683_10073937 3300026121 Bacteria 3015
228 Ga0207683_10101179 3300026121 Bacteria 2573
229 Ga0207683_10175911 3300026121 Bacteria 1940
230 Ga0207683_10407095 3300026121 Bacteria 1252
231 Ga0207683_11817259 3300026121 Bacteria 558
232 Ga0207698_10371493 3300026142 Bacteria 1358
233 Ga0207698_10406437 3300026142 Bacteria 1303
234 Ga0209969_1001688 3300027360 Bacteria 3049
235 Ga0209967_1002622 3300027364 Bacteria 2341
236 Ga0209996_1006049 3300027395 Bacteria 1557
237 Ga0209984_1006551 3300027424 Bacteria 1430
238 Ga0209995_1013326 3300027471 Bacteria 1346
239 Ga0209999_1000493 3300027543 Bacteria 6141
240 Ga0209982_1016522 3300027552 Bacteria 1122
241 Ga0209970_1010110 3300027614 Bacteria 1541
242 Ga0209974_10019306 3300027876 Bacteria 2259
243 Ga0207428_10001945 3300027907 Bacteria 20943
244 Ga0207428_10034259 3300027907 Bacteria 4163
245 Ga0268266_10038447 3300028379 Bacteria 4074
246 Ga0268266_10101326 3300028379 Bacteria 2538
247 Ga0268266_10478686 3300028379 Bacteria 1186
248 Ga0268266_10724862 3300028379 Bacteria 959
249 Ga0268266_11216616 3300028379 Bacteria 728
250 Ga0268265_10624288 3300028380 Bacteria 1033
251 Ga0265330_10010885 3300031235 Bacteria 4275
252 Ga0265329_10055666 3300031242 Bacteria 1255
253 Ga0265331_10007972 3300031250 Bacteria 6062
254 Ga0307513_10223049 3300031456 Bacteria 1704
255 Ga0307513_10457040 3300031456 Bacteria 1000
256 Ga0307513_10565106 3300031456 Bacteria 849
257 Ga0307408_101185383 3300031548 Bacteria 712
258 Ga0265314_10010057 3300031711 Bacteria 7929
259 Ga0307409_100595985 3300031995 Bacteria 1091
260 Ga0307411_10521169 3300032005 Bacteria 1009
261 Ga0307415_101745446 3300032126 Bacteria 601
262 Ga0307510_10001749 3300033180 Bacteria 24217
263 Ga0373941_0269446 3300035115 Bacteria 670
264 Ga0373924_0016698 3300035410 Bacteria 2806
265 Ga0373935_0042936 3300035692 Bacteria 2844
266 Ga0373933_0319956 3300035724 Bacteria 1006
267 Ga0373947_0100675 3300035725 Bacteria 1816
268 Ga0373925_0427796 3300037068 Bacteria 1082
269 Ga0395900_0681701 3300037418 Bacteria 962
270 Ga0395898_0863191 3300037466 Bacteria 844
271 Ga0395905_0000460 3300037471 Bacteria 56900
272 Ga0395905_0028433 3300037471 Bacteria 5271
273 Ga0395905_0268311 3300037471 Bacteria 1592
274 Ga0395905_1273922 3300037471 Bacteria 639
275 Ga0395901_0144227 3300038443 Bacteria 2503
276 Ga0395901_0273060 3300038443 Bacteria 1758
277 Ga0451789_1127833 3300041443 Bacteria 2106
278 Ga0451793_0380560 3300041452 Bacteria 953
279 Ga0451798_1147957 3300041458 Bacteria 675
280 Ga0451800_0323512 3300041459 Bacteria 1088
281 Ga0451800_0609384 3300041459 Bacteria 1138
282 Ga0451802_1020348 3300041460 Bacteria 810
283 Ga0451804_0529121 3300041463 Bacteria 1283
284 Ga0451807_0177193 3300041486 Bacteria 2088
285 Ga0451853_0003857 3300041512 Bacteria 3950
286 Ga0451853_2899766 3300041512 Bacteria 610
287 Ga0453683_0000198 3300044673 Bacteria 81903
288 Ga0453683_0385566 3300044673 Bacteria 902
289 Ga0453684_0052233 3300044712 Bacteria 5347
290 Ga0453684_0500778 3300044712 Bacteria 1345
291 Ga0451576_0013981 3300045051 Bacteria 8950
292 Ga0495638_0195609 3300046460 Bacteria 1145
293 Ga0495650_0138079 3300046471 Bacteria 884
294 Ga0495582_0534862 3300046473 Bacteria 678
295 Ga0495639_0052121 3300046475 Bacteria 1862
296 Ga0495584_0051636 3300046491 Bacteria 2070
297 Ga0495610_0004927 3300046512 Bacteria 9681
298 Ga0495620_0197558 3300046515 Bacteria 774
299 Ga0495630_0978497 3300046517 Bacteria 643
300 Ga0495643_0153835 3300046522 Bacteria 1137
301 Ga0495633_0089644 3300046558 Bacteria 1430
302 Ga0495668_0068306 3300046616 Bacteria 1955
303 Ga0495647_0244929 3300046681 Bacteria 797
304 Ga0495647_0313833 3300046681 Bacteria 709
305 Ga0495658_0048189 3300046683 Bacteria 2402
306 Ga0495670_0421586 3300046691 Bacteria 722
307 Ga0495672_0281885 3300047320 Bacteria 794
308 Ga0495685_185158 3300047447 Bacteria 670
309 Ga0496101_0034501 3300048904 Bacteria 3574
310 Ga0496102_0081363 3300048905 Bacteria 2986
311 Ga0496102_0589957 3300048905 Bacteria 1034
312 Ga0496103_0094207 3300048906 Bacteria 1892
313 Ga0496104_0004292 3300048907 Bacteria 12392
314 Ga0496105_0187466 3300048908 Bacteria 1692
315 Ga0496107_0079878 3300048910 Bacteria 2385
316 Ga0496108_0005708 3300048911 Bacteria 10075
317 Ga0496109_0008725 3300048912 Bacteria 8630
318 Ga0496110_0032484 3300048913 Bacteria 4508
319 Ga0496110_0211300 3300048913 Bacteria 1764
320 Ga0496124_0130120 3300048927 Bacteria 2000
321 Ga0496125_0173137 3300048928 Bacteria 1448
322 Ga0496126_0032530 3300048929 Bacteria 4912
323 Ga0501033_0039995 3300049570 Bacteria 3501
324 Ga0501036_0468407 3300049572 Bacteria 1049
325 Ga0501036_0606556 3300049572 Bacteria 908
326 Ga0501037_0162123 3300049573 Bacteria 1594
327 Ga0501037_0175234 3300049573 Bacteria 1523
328 Ga0501038_0010676 3300049574 Bacteria 8399
329 Ga0501043_0160421 3300049579 Bacteria 1757
330 Ga0501047_0004929 3300049581 Bacteria 12538
331 Ga0501047_0056507 3300049581 Bacteria 3795
332 Ga0501047_0868459 3300049581 Bacteria 716
333 Ga0501047_1085773 3300049581 Bacteria 614
334 Ga0501067_0075288 3300049583 Bacteria 1870
335 Ga0501067_0481947 3300049583 Bacteria 693
336 Ga0501068_0131989 3300049584 Bacteria 1562
337 Ga0501071_0419390 3300049587 Bacteria 1023
338 Ga0501073_0003966 3300049589 Bacteria 11100
339 Ga0501073_0057507 3300049589 Bacteria 2719
340 Ga0501080_0069634 3300049742 Bacteria 3272
341 Ga0501269_000005 3300049766 Bacteria 77832
342 Ga0501035_0027745 3300049822 Bacteria 5174
343 Ga0501035_0044595 3300049822 Bacteria 3993
344 Ga0501035_0061369 3300049822 Bacteria 3346
345 Ga0501044_0082336 3300049823 Bacteria 3257
346 Ga0501044_0146030 3300049823 Bacteria 2351
347 nmdc:mga03683_44173_c1 3300050489 Bacteria 1841
348 nmdc:mga03683_54903_c1 3300050489 Bacteria 1672
349 nmdc:mga03n38_117212_c1 3300050490 Bacteria 1304
350 nmdc:mga0yw44_242232_c1 3300050492 Bacteria 1199
351 nmdc:mga0k408_37320_c1 3300050493 Bacteria 2790
352 nmdc:mga06z11_581311_c1 3300050494 Bacteria 681
353 nmdc:mga07m45_141197_c1 3300050496 Bacteria 1395
354 nmdc:mga07m45_50100_c1 3300050496 Bacteria 2353
355 nmdc:mga05p37_176367_c1 3300050507 Bacteria 2603
356 nmdc:mga05p37_28812_c1 3300050507 Bacteria 6773
357 nmdc:mga09592_8204_c1 3300050508 Bacteria 8490
358 nmdc:mga08y16_1491_c1 3300050511 Bacteria 23546
359 nmdc:mga08y16_77060_c1 3300050511 Bacteria 3476
360 nmdc:mga0sz30_256553_c1 3300050516 Bacteria 778
361 Ga0500594_0061661 3300053118 Bacteria 1083
362 Ga0500595_001985 3300053119 Bacteria 10497
363 Ga0500652_043974 3300053131 Bacteria 1807
364 Ga0500568_0068798 3300053139 Bacteria 1359
365 Ga0500619_071246 3300053154 Bacteria 1157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237101 2513692436 145
2 iso_pu_bacteria 2874604998 2874605103 145
3 iso_pu_bacteria 2922361189 2922365268 145
4 iso_pu_bacteria 8006964411 8006965646 145
5 3300005327 Ga0070658_10326918 Ga0070658_103269182 146
6 3300005841 Ga0068863_101368662 Ga0068863_1013686621 146
7 3300025909 Ga0207705_10295855 Ga0207705_102958551 146
8 3300026041 Ga0207639_11349763 Ga0207639_113497631 146
9 3300031456 Ga0307513_10457040 Ga0307513_104570402 146
10 3300048913 Ga0496110_0211300 Ga0496110_0211300_707_1147 146
11 3300005456 Ga0070678_100836400 Ga0070678_1008364002 147
12 3300005548 Ga0070665_101211356 Ga0070665_1012113561 147
13 3300006038 Ga0075365_10216053 Ga0075365_102160532 147
14 3300009148 Ga0105243_10711218 Ga0105243_107112182 147
15 3300027360 Ga0209969_1001688 Ga0209969_10016882 147
16 3300027364 Ga0209967_1002622 Ga0209967_10026222 147
17 3300027395 Ga0209996_1006049 Ga0209996_10060492 147
18 3300027424 Ga0209984_1006551 Ga0209984_10065512 147
19 3300027471 Ga0209995_1013326 Ga0209995_10133261 147
20 3300027543 Ga0209999_1000493 Ga0209999_10004935 147
21 3300027552 Ga0209982_1016522 Ga0209982_10165221 147
22 3300027614 Ga0209970_1010110 Ga0209970_10101103 147
23 3300027876 Ga0209974_10019306 Ga0209974_100193061 147
24 3300028379 Ga0268266_10724862 Ga0268266_107248622 147
25 3300031235 Ga0265330_10010885 Ga0265330_100108854 147
26 3300031242 Ga0265329_10055666 Ga0265329_100556662 147
27 3300031250 Ga0265331_10007972 Ga0265331_100079723 147
28 3300031711 Ga0265314_10010057 Ga0265314_100100573 147
29 3300035692 Ga0373935_0042936 Ga0373935_0042936_267_710 147
30 3300035724 Ga0373933_0319956 Ga0373933_0319956_36_482 147
31 3300037068 Ga0373925_0427796 Ga0373925_0427796_197_640 147
32 3300041443 Ga0451789_1127833 Ga0451789_1127833_641_1084 147
33 3300041459 Ga0451800_0609384 Ga0451800_0609384_148_591 147
34 3300041463 Ga0451804_0529121 Ga0451804_0529121_429_872 147
35 3300041486 Ga0451807_0177193 Ga0451807_0177193_1413_1856 147
36 3300047447 Ga0495685_185158 Ga0495685_185158_27_473 147
37 3300049823 Ga0501044_0146030 Ga0501044_0146030_1155_1598 147
38 3300002239 JGI24034J26672_10013535 JGI24034J26672_100135351 148
39 3300003320 rootH2_10020112 rootH2_100201126 148
40 3300003659 JGI25404J52841_10001487 JGI25404J52841_100014873 148
41 3300005289 Ga0065704_10545568 Ga0065704_105455681 148
42 3300005290 Ga0065712_10433219 Ga0065712_104332191 148
43 3300005293 Ga0065715_10145014 Ga0065715_101450143 148
44 3300005295 Ga0065707_10220158 Ga0065707_102201582 148
45 3300005328 Ga0070676_10346597 Ga0070676_103465972 148
46 3300005329 Ga0070683_100423309 Ga0070683_1004233091 148
47 3300005331 Ga0070670_100196971 Ga0070670_1001969712 148
48 3300005334 Ga0068869_100662185 Ga0068869_1006621851 148
49 3300005335 Ga0070666_10061406 Ga0070666_100614064 148
50 3300005337 Ga0070682_100330880 Ga0070682_1003308801 148
51 3300005338 Ga0068868_100050944 Ga0068868_1000509446 148
52 3300005338 Ga0068868_100261348 Ga0068868_1002613483 148
53 3300005340 Ga0070689_100004010 Ga0070689_10000401015 148
54 3300005343 Ga0070687_100174396 Ga0070687_1001743962 148
55 3300005344 Ga0070661_100081666 Ga0070661_1000816661 148
56 3300005344 Ga0070661_100170269 Ga0070661_1001702693 148
57 3300005344 Ga0070661_101286538 Ga0070661_1012865381 148
58 3300005347 Ga0070668_100527103 Ga0070668_1005271031 148
59 3300005347 Ga0070668_100555274 Ga0070668_1005552741 148
60 3300005354 Ga0070675_100065416 Ga0070675_1000654163 148
61 3300005355 Ga0070671_100107724 Ga0070671_1001077241 148
62 3300005356 Ga0070674_100282409 Ga0070674_1002824093 148
63 3300005356 Ga0070674_101123606 Ga0070674_1011236061 148
64 3300005365 Ga0070688_100004559 Ga0070688_1000045598 148
65 3300005367 Ga0070667_100190339 Ga0070667_1001903392 148
66 3300005441 Ga0070700_100251983 Ga0070700_1002519832 148
67 3300005444 Ga0070694_100414375 Ga0070694_1004143752 148
68 3300005455 Ga0070663_100124185 Ga0070663_1001241852 148
69 3300005455 Ga0070663_100169489 Ga0070663_1001694891 148
70 3300005455 Ga0070663_100422418 Ga0070663_1004224181 148
71 3300005456 Ga0070678_100107740 Ga0070678_1001077401 148
72 3300005456 Ga0070678_100375890 Ga0070678_1003758901 148
73 3300005456 Ga0070678_101195862 Ga0070678_1011958621 148
74 3300005457 Ga0070662_100020160 Ga0070662_1000201604 148
75 3300005457 Ga0070662_100189761 Ga0070662_1001897611 148
76 3300005457 Ga0070662_100299907 Ga0070662_1002999072 148
77 3300005459 Ga0068867_100027232 Ga0068867_1000272324 148
78 3300005459 Ga0068867_100946340 Ga0068867_1009463402 148
79 3300005466 Ga0070685_10009078 Ga0070685_100090784 148
80 3300005539 Ga0068853_100000034 Ga0068853_10000003439 148
81 3300005539 Ga0068853_100167346 Ga0068853_1001673462 148
82 3300005543 Ga0070672_100584522 Ga0070672_1005845222 148
83 3300005547 Ga0070693_100005434 Ga0070693_1000054345 148
84 3300005547 Ga0070693_100064164 Ga0070693_1000641641 148
85 3300005547 Ga0070693_100252396 Ga0070693_1002523962 148
86 3300005548 Ga0070665_100018384 Ga0070665_1000183841 148
87 3300005548 Ga0070665_100053445 Ga0070665_1000534453 148
88 3300005548 Ga0070665_100126740 Ga0070665_1001267403 148
89 3300005548 Ga0070665_100229038 Ga0070665_1002290382 148
90 3300005548 Ga0070665_101678256 Ga0070665_1016782561 148
91 3300005549 Ga0070704_100249059 Ga0070704_1002490592 148
92 3300005563 Ga0068855_100228607 Ga0068855_1002286072 148
93 3300005564 Ga0070664_100766166 Ga0070664_1007661661 148
94 3300005577 Ga0068857_100038300 Ga0068857_1000383003 148
95 3300005578 Ga0068854_100120925 Ga0068854_1001209251 148
96 3300005578 Ga0068854_100170131 Ga0068854_1001701313 148
97 3300005615 Ga0070702_100573865 Ga0070702_1005738652 148
98 3300005616 Ga0068852_100073262 Ga0068852_1000732624 148
99 3300005616 Ga0068852_100165347 Ga0068852_1001653471 148
100 3300005616 Ga0068852_100556533 Ga0068852_1005565332 148
101 3300005617 Ga0068859_100052584 Ga0068859_1000525844 148
102 3300005617 Ga0068859_100083142 Ga0068859_1000831423 148
103 3300005617 Ga0068859_101932413 Ga0068859_1019324131 148
104 3300005618 Ga0068864_100004086 Ga0068864_10000408612 148
105 3300005618 Ga0068864_100699559 Ga0068864_1006995591 148
106 3300005719 Ga0068861_100767919 Ga0068861_1007679192 148
107 3300005834 Ga0068851_10037646 Ga0068851_100376465 148
108 3300005840 Ga0068870_10002423 Ga0068870_1000242312 148
109 3300005841 Ga0068863_100052652 Ga0068863_1000526528 148
110 3300005843 Ga0068860_100047311 Ga0068860_1000473113 148
111 3300005843 Ga0068860_100140293 Ga0068860_1001402932 148
112 3300005937 Ga0081455_10190721 Ga0081455_101907213 148
113 3300005983 Ga0081540_1001267 Ga0081540_100126716 148
114 3300005983 Ga0081540_1027282 Ga0081540_10272823 148
115 3300005983 Ga0081540_1039365 Ga0081540_10393652 148
116 3300005985 Ga0081539_10000498 Ga0081539_1000049866 148
117 3300005985 Ga0081539_10031508 Ga0081539_100315082 148
118 3300005985 Ga0081539_10051395 Ga0081539_100513952 148
119 3300006038 Ga0075365_10071550 Ga0075365_100715502 148
120 3300006042 Ga0075368_10311539 Ga0075368_103115392 148
121 3300006048 Ga0075363_100425426 Ga0075363_1004254261 148
122 3300006177 Ga0075362_10010466 Ga0075362_100104662 148
123 3300006177 Ga0075362_10042450 Ga0075362_100424503 148
124 3300006177 Ga0075362_10056095 Ga0075362_100560952 148
125 3300006177 Ga0075362_10057423 Ga0075362_100574232 148
126 3300006178 Ga0075367_10626440 Ga0075367_106264402 148
127 3300006237 Ga0097621_100000101 Ga0097621_10000010148 148
128 3300006237 Ga0097621_100026705 Ga0097621_1000267056 148
129 3300006353 Ga0075370_10030827 Ga0075370_100308273 148
130 3300006353 Ga0075370_10645041 Ga0075370_106450411 148
131 3300006358 Ga0068871_100000858 Ga0068871_10000085829 148
132 3300006358 Ga0068871_100007801 Ga0068871_1000078017 148
133 3300006844 Ga0075428_100002222 Ga0075428_10000222215 148
134 3300006844 Ga0075428_100286427 Ga0075428_1002864273 148
135 3300006844 Ga0075428_100412604 Ga0075428_1004126041 148
136 3300006846 Ga0075430_100086972 Ga0075430_1000869723 148
137 3300006846 Ga0075430_100771509 Ga0075430_1007715092 148
138 3300006847 Ga0075431_100668513 Ga0075431_1006685132 148
139 3300006880 Ga0075429_100051264 Ga0075429_1000512643 148
140 3300006880 Ga0075429_100107536 Ga0075429_1001075362 148
141 3300006881 Ga0068865_101092097 Ga0068865_1010920971 148
142 3300006931 Ga0097620_100052587 Ga0097620_1000525874 148
143 3300006931 Ga0097620_100083145 Ga0097620_1000831453 148
144 3300006931 Ga0097620_101932415 Ga0097620_1019324151 148
145 3300007076 Ga0075435_101862807 Ga0075435_1018628071 148
146 3300009036 Ga0105244_10005844 Ga0105244_100058444 148
147 3300009093 Ga0105240_10138735 Ga0105240_101387355 148
148 3300009094 Ga0111539_10000539 Ga0111539_1000053918 148
149 3300009094 Ga0111539_10007106 Ga0111539_1000710614 148
150 3300009094 Ga0111539_10700669 Ga0111539_107006692 148
151 3300009098 Ga0105245_10139799 Ga0105245_101397995 148
152 3300009098 Ga0105245_11333555 Ga0105245_113335552 148
153 3300009098 Ga0105245_11395805 Ga0105245_113958051 148
154 3300009147 Ga0114129_10081935 Ga0114129_100819353 148
155 3300009147 Ga0114129_10225146 Ga0114129_102251462 148
156 3300009148 Ga0105243_10557970 Ga0105243_105579701 148
157 3300009148 Ga0105243_11039871 Ga0105243_110398712 148
158 3300009176 Ga0105242_10244769 Ga0105242_102447692 148
159 3300009176 Ga0105242_11722635 Ga0105242_117226352 148
160 3300009177 Ga0105248_10650373 Ga0105248_106503731 148
161 3300009177 Ga0105248_11861945 Ga0105248_118619451 148
162 3300009551 Ga0105238_10016401 Ga0105238_100164017 148
163 3300009551 Ga0105238_11255422 Ga0105238_112554222 148
164 3300009553 Ga0105249_10567197 Ga0105249_105671971 148
165 3300010159 Ga0099796_10176617 Ga0099796_101766172 148
166 3300010375 Ga0105239_10053965 Ga0105239_100539653 148
167 3300010375 Ga0105239_10351758 Ga0105239_103517582 148
168 3300010375 Ga0105239_10917448 Ga0105239_109174481 148
169 3300010375 Ga0105239_13169391 Ga0105239_131693911 148
170 3300011119 Ga0105246_10582566 Ga0105246_105825661 148
171 3300011119 Ga0105246_11249070 Ga0105246_112490701 148
172 3300012495 Ga0157323_1001504 Ga0157323_10015042 148
173 3300012507 Ga0157342_1014642 Ga0157342_10146421 148
174 3300012512 Ga0157327_1000466 Ga0157327_10004662 148
175 3300012513 Ga0157326_1051399 Ga0157326_10513991 148
176 3300013100 Ga0157373_11561584 Ga0157373_115615841 148
177 3300013105 Ga0157369_10977203 Ga0157369_109772031 148
178 3300013296 Ga0157374_10060337 Ga0157374_100603373 148
179 3300013297 Ga0157378_10048364 Ga0157378_100483642 148
180 3300013297 Ga0157378_10051180 Ga0157378_100511802 148
181 3300013306 Ga0163162_11011381 Ga0163162_110113812 148
182 3300013308 Ga0157375_10508688 Ga0157375_105086882 148
183 3300013308 Ga0157375_10548541 Ga0157375_105485411 148
184 3300013308 Ga0157375_11610173 Ga0157375_116101731 148
185 3300014325 Ga0163163_10000002 Ga0163163_10000002501 148
186 3300014326 Ga0157380_10194355 Ga0157380_101943552 148
187 3300014326 Ga0157380_10385833 Ga0157380_103858332 148
188 3300014745 Ga0157377_10127512 Ga0157377_101275123 148
189 3300014745 Ga0157377_11543806 Ga0157377_115438061 148
190 3300014968 Ga0157379_10001000 Ga0157379_1000100016 148
191 3300014969 Ga0157376_10182097 Ga0157376_101820972 148
192 3300017792 Ga0163161_10341626 Ga0163161_103416263 148
193 3300025271 Ga0207666_1025496 Ga0207666_10254962 148
194 3300025297 Ga0209758_1004245 Ga0209758_10042456 148
195 3300025299 Ga0209256_1067869 Ga0209256_10678691 148
196 3300025315 Ga0207697_10001907 Ga0207697_1000190712 148
197 3300025321 Ga0207656_10006854 Ga0207656_100068542 148
198 3300025728 Ga0207655_1006589 Ga0207655_10065894 148
199 3300025893 Ga0207682_10000850 Ga0207682_100008507 148
200 3300025901 Ga0207688_10000680 Ga0207688_1000068017 148
201 3300025903 Ga0207680_10043301 Ga0207680_100433015 148
202 3300025904 Ga0207647_10082261 Ga0207647_100822612 148
203 3300025907 Ga0207645_10005271 Ga0207645_100052718 148
204 3300025908 Ga0207643_10000188 Ga0207643_1000018839 148
205 3300025913 Ga0207695_10564527 Ga0207695_105645272 148
206 3300025914 Ga0207671_10123634 Ga0207671_101236342 148
207 3300025916 Ga0207663_10763101 Ga0207663_107631011 148
208 3300025917 Ga0207660_10803322 Ga0207660_108033221 148
209 3300025920 Ga0207649_10113498 Ga0207649_101134983 148
210 3300025923 Ga0207681_10127011 Ga0207681_101270111 148
211 3300025923 Ga0207681_10984798 Ga0207681_109847981 148
212 3300025924 Ga0207694_10381467 Ga0207694_103814672 148
213 3300025924 Ga0207694_10854658 Ga0207694_108546582 148
214 3300025925 Ga0207650_10000694 Ga0207650_100006941 148
215 3300025925 Ga0207650_10175721 Ga0207650_101757211 148
216 3300025926 Ga0207659_10035434 Ga0207659_100354344 148
217 3300025931 Ga0207644_10189452 Ga0207644_101894522 148
218 3300025931 Ga0207644_10363242 Ga0207644_103632422 148
219 3300025932 Ga0207690_10560940 Ga0207690_105609402 148
220 3300025933 Ga0207706_10029888 Ga0207706_100298889 148
221 3300025933 Ga0207706_10035571 Ga0207706_100355714 148
222 3300025933 Ga0207706_10405273 Ga0207706_104052732 148
223 3300025935 Ga0207709_10190503 Ga0207709_101905032 148
224 3300025937 Ga0207669_10204336 Ga0207669_102043362 148
225 3300025938 Ga0207704_10953496 Ga0207704_109534962 148
226 3300025938 Ga0207704_11541438 Ga0207704_115414381 148
227 3300025941 Ga0207711_10122894 Ga0207711_101228944 148
228 3300025942 Ga0207689_10512628 Ga0207689_105126281 148
229 3300025942 Ga0207689_10651263 Ga0207689_106512632 148
230 3300025949 Ga0207667_11036624 Ga0207667_110366241 148
231 3300025961 Ga0207712_10291173 Ga0207712_102911732 148
232 3300025972 Ga0207668_10131250 Ga0207668_101312504 148
233 3300025972 Ga0207668_12016225 Ga0207668_120162251 148
234 3300025981 Ga0207640_10089242 Ga0207640_100892422 148
235 3300025986 Ga0207658_10530801 Ga0207658_105308011 148
236 3300026023 Ga0207677_10067833 Ga0207677_100678333 148
237 3300026035 Ga0207703_10124371 Ga0207703_101243711 148
238 3300026041 Ga0207639_10000052 Ga0207639_1000005250 148
239 3300026041 Ga0207639_10167786 Ga0207639_101677864 148
240 3300026041 Ga0207639_10424992 Ga0207639_104249922 148
241 3300026067 Ga0207678_10006127 Ga0207678_1000612715 148
242 3300026067 Ga0207678_10062936 Ga0207678_100629362 148
243 3300026067 Ga0207678_10068877 Ga0207678_100688773 148
244 3300026067 Ga0207678_10212678 Ga0207678_102126782 148
245 3300026088 Ga0207641_10431544 Ga0207641_104315443 148
246 3300026089 Ga0207648_10037613 Ga0207648_100376131 148
247 3300026089 Ga0207648_10052124 Ga0207648_100521244 148
248 3300026089 Ga0207648_10999517 Ga0207648_109995172 148
249 3300026095 Ga0207676_10001767 Ga0207676_1000176712 148
250 3300026095 Ga0207676_11251509 Ga0207676_112515092 148
251 3300026116 Ga0207674_10016255 Ga0207674_100162559 148
252 3300026116 Ga0207674_10495254 Ga0207674_104952541 148
253 3300026118 Ga0207675_100045804 Ga0207675_1000458042 148
254 3300026118 Ga0207675_100169682 Ga0207675_1001696822 148
255 3300026121 Ga0207683_10017447 Ga0207683_100174474 148
256 3300026121 Ga0207683_10073937 Ga0207683_100739374 148
257 3300026121 Ga0207683_10101179 Ga0207683_101011792 148
258 3300026121 Ga0207683_10175911 Ga0207683_101759111 148
259 3300026121 Ga0207683_10407095 Ga0207683_104070952 148
260 3300026121 Ga0207683_11817259 Ga0207683_118172591 148
261 3300026142 Ga0207698_10371493 Ga0207698_103714931 148
262 3300026142 Ga0207698_10406437 Ga0207698_104064372 148
263 3300027907 Ga0207428_10001945 Ga0207428_1000194519 148
264 3300027907 Ga0207428_10034259 Ga0207428_100342594 148
265 3300028379 Ga0268266_10038447 Ga0268266_100384473 148
266 3300028379 Ga0268266_10101326 Ga0268266_101013262 148
267 3300028379 Ga0268266_10478686 Ga0268266_104786861 148
268 3300028379 Ga0268266_11216616 Ga0268266_112166161 148
269 3300028380 Ga0268265_10624288 Ga0268265_106242881 148
270 3300031456 Ga0307513_10223049 Ga0307513_102230494 148
271 3300031456 Ga0307513_10565106 Ga0307513_105651062 148
272 3300031548 Ga0307408_101185383 Ga0307408_1011853831 148
273 3300031995 Ga0307409_100595985 Ga0307409_1005959852 148
274 3300032005 Ga0307411_10521169 Ga0307411_105211692 148
275 3300032126 Ga0307415_101745446 Ga0307415_1017454461 148
276 3300033180 Ga0307510_10001749 Ga0307510_1000174910 148
277 3300035115 Ga0373941_0269446 Ga0373941_0269446_209_658 148
278 3300035410 Ga0373924_0016698 Ga0373924_0016698_253_699 148
279 3300035725 Ga0373947_0100675 Ga0373947_0100675_13_459 148
280 3300037418 Ga0395900_0681701 Ga0395900_0681701_369_818 148
281 3300037466 Ga0395898_0863191 Ga0395898_0863191_335_784 148
282 3300037471 Ga0395905_0000460 Ga0395905_0000460_36116_36562 148
283 3300037471 Ga0395905_0028433 Ga0395905_0028433_3218_3670 148
284 3300037471 Ga0395905_0268311 Ga0395905_0268311_427_879 148
285 3300037471 Ga0395905_1273922 Ga0395905_1273922_68_526 148
286 3300038443 Ga0395901_0144227 Ga0395901_0144227_764_1216 148
287 3300038443 Ga0395901_0273060 Ga0395901_0273060_939_1388 148
288 3300041452 Ga0451793_0380560 Ga0451793_0380560_274_720 148
289 3300041458 Ga0451798_1147957 Ga0451798_1147957_61_510 148
290 3300041459 Ga0451800_0323512 Ga0451800_0323512_311_757 148
291 3300041460 Ga0451802_1020348 Ga0451802_1020348_190_651 148
292 3300041512 Ga0451853_0003857 Ga0451853_0003857_1513_1959 148
293 3300041512 Ga0451853_2899766 Ga0451853_2899766_109_558 148
294 3300044673 Ga0453683_0000198 Ga0453683_0000198_22380_22838 148
295 3300044673 Ga0453683_0385566 Ga0453683_0385566_237_695 148
296 3300044712 Ga0453684_0052233 Ga0453684_0052233_1517_1963 148
297 3300044712 Ga0453684_0500778 Ga0453684_0500778_194_640 148
298 3300045051 Ga0451576_0013981 Ga0451576_0013981_1276_1734 148
299 3300046460 Ga0495638_0195609 Ga0495638_0195609_652_1101 148
300 3300046471 Ga0495650_0138079 Ga0495650_0138079_131_652 148
301 3300046473 Ga0495582_0534862 Ga0495582_0534862_35_484 148
302 3300046475 Ga0495639_0052121 Ga0495639_0052121_1267_1716 148
303 3300046491 Ga0495584_0051636 Ga0495584_0051636_1168_1617 148
304 3300046512 Ga0495610_0004927 Ga0495610_0004927_7428_7874 148
305 3300046515 Ga0495620_0197558 Ga0495620_0197558_99_545 148
306 3300046517 Ga0495630_0978497 Ga0495630_0978497_119_565 148
307 3300046522 Ga0495643_0153835 Ga0495643_0153835_638_1084 148
308 3300046558 Ga0495633_0089644 Ga0495633_0089644_75_521 148
309 3300046616 Ga0495668_0068306 Ga0495668_0068306_1337_1789 148
310 3300046681 Ga0495647_0244929 Ga0495647_0244929_202_648 148
311 3300046681 Ga0495647_0313833 Ga0495647_0313833_94_543 148
312 3300046683 Ga0495658_0048189 Ga0495658_0048189_1778_2224 148
313 3300046691 Ga0495670_0421586 Ga0495670_0421586_26_472 148
314 3300047320 Ga0495672_0281885 Ga0495672_0281885_256_711 148
315 3300048904 Ga0496101_0034501 Ga0496101_0034501_3077_3523 148
316 3300048905 Ga0496102_0081363 Ga0496102_0081363_2526_2972 148
317 3300048905 Ga0496102_0589957 Ga0496102_0589957_68_517 148
318 3300048906 Ga0496103_0094207 Ga0496103_0094207_1171_1617 148
319 3300048907 Ga0496104_0004292 Ga0496104_0004292_8715_9161 148
320 3300048908 Ga0496105_0187466 Ga0496105_0187466_1094_1540 148
321 3300048910 Ga0496107_0079878 Ga0496107_0079878_933_1379 148
322 3300048911 Ga0496108_0005708 Ga0496108_0005708_6601_7047 148
323 3300048912 Ga0496109_0008725 Ga0496109_0008725_5029_5475 148
324 3300048913 Ga0496110_0032484 Ga0496110_0032484_623_1069 148
325 3300048927 Ga0496124_0130120 Ga0496124_0130120_848_1297 148
326 3300048928 Ga0496125_0173137 Ga0496125_0173137_78_527 148
327 3300048929 Ga0496126_0032530 Ga0496126_0032530_1911_2360 148
328 3300049570 Ga0501033_0039995 Ga0501033_0039995_996_1457 148
329 3300049572 Ga0501036_0468407 Ga0501036_0468407_290_745 148
330 3300049572 Ga0501036_0606556 Ga0501036_0606556_369_827 148
331 3300049573 Ga0501037_0162123 Ga0501037_0162123_857_1306 148
332 3300049573 Ga0501037_0175234 Ga0501037_0175234_506_961 148
333 3300049574 Ga0501038_0010676 Ga0501038_0010676_4131_4586 148
334 3300049579 Ga0501043_0160421 Ga0501043_0160421_572_1033 148
335 3300049581 Ga0501047_0004929 Ga0501047_0004929_2747_3208 148
336 3300049581 Ga0501047_0056507 Ga0501047_0056507_683_1138 148
337 3300049581 Ga0501047_0868459 Ga0501047_0868459_33_482 148
338 3300049581 Ga0501047_1085773 Ga0501047_1085773_134_592 148
339 3300049583 Ga0501067_0075288 Ga0501067_0075288_301_750 148
340 3300049583 Ga0501067_0481947 Ga0501067_0481947_79_534 148
341 3300049584 Ga0501068_0131989 Ga0501068_0131989_1026_1481 148
342 3300049587 Ga0501071_0419390 Ga0501071_0419390_65_514 148
343 3300049589 Ga0501073_0003966 Ga0501073_0003966_2092_2547 148
344 3300049589 Ga0501073_0057507 Ga0501073_0057507_1152_1601 148
345 3300049742 Ga0501080_0069634 Ga0501080_0069634_221_676 148
346 3300049766 Ga0501269_000005 Ga0501269_000005_39634_40080 148
347 3300049822 Ga0501035_0027745 Ga0501035_0027745_2483_2944 148
348 3300049822 Ga0501035_0044595 Ga0501035_0044595_3426_3872 148
349 3300049822 Ga0501035_0061369 Ga0501035_0061369_184_639 148
350 3300049823 Ga0501044_0082336 Ga0501044_0082336_2236_2694 148
351 3300050489 nmdc:mga03683_44173_c1 nmdc:mga03683_44173_c1_208_654 148
352 3300050489 nmdc:mga03683_54903_c1 nmdc:mga03683_54903_c1_845_1294 148
353 3300050490 nmdc:mga03n38_117212_c1 nmdc:mga03n38_117212_c1_480_929 148
354 3300050492 nmdc:mga0yw44_242232_c1 nmdc:mga0yw44_242232_c1_75_524 148
355 3300050493 nmdc:mga0k408_37320_c1 nmdc:mga0k408_37320_c1_556_1002 148
356 3300050494 nmdc:mga06z11_581311_c1 nmdc:mga06z11_581311_c1_75_557 148
357 3300050496 nmdc:mga07m45_141197_c1 nmdc:mga07m45_141197_c1_283_732 148
358 3300050496 nmdc:mga07m45_50100_c1 nmdc:mga07m45_50100_c1_1788_2234 148
359 3300050507 nmdc:mga05p37_176367_c1 nmdc:mga05p37_176367_c1_2092_2544 148
360 3300050507 nmdc:mga05p37_28812_c1 nmdc:mga05p37_28812_c1_2144_2590 148
361 3300050508 nmdc:mga09592_8204_c1 nmdc:mga09592_8204_c1_670_1122 148
362 3300050511 nmdc:mga08y16_1491_c1 nmdc:mga08y16_1491_c1_22883_23335 148
363 3300050511 nmdc:mga08y16_77060_c1 nmdc:mga08y16_77060_c1_2120_2566 148
364 3300050516 nmdc:mga0sz30_256553_c1 nmdc:mga0sz30_256553_c1_39_485 148
365 3300053118 Ga0500594_0061661 Ga0500594_0061661_622_1071 148
366 3300053119 Ga0500595_001985 Ga0500595_001985_2478_3011 148
367 3300053131 Ga0500652_043974 Ga0500652_043974_867_1313 148
368 3300053139 Ga0500568_0068798 Ga0500568_0068798_65_514 148
369 3300053154 Ga0500619_071246 Ga0500619_071246_578_1024 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

13

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9931 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9926 5 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9895 5 145
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9727 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9713 5 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9923 5 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9707 5 145 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8616 3 143 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8494 5 140 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8465 5 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0A1VD98-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 1.001 5 145
AF-A0A7U2MC15-F1-model_v4 ATPase 1 5 145
AF-A0A1P8JZT5-F1-model_v4 Polyketide cyclase 0.9992 5 147
AF-A0A2V6DE71-F1-model_v4 Polyketide cyclase 0.9981 5 143
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 0.9975 5 148

Feature Viewer

pLDDT pTM Quality
96.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map