F424791

General Info

Members Datasets Scaffolds Average Seq Length
368 236 366 311

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0020909|Ga0451577_0020909_2254_3312
Length 352
Sequence MNTHKNARLTFARRIELVTDILDRRLTPCAAAAAQGVAAATARKWLGRYLARGEAGLADRSSRPHRSPRSMPAATALAIVELRHRRLTQARIAASLGVSKSSVGRVLGRAGLSRLSDLQPVALVQRYEHEAPGDLLHIDTKKLGRIERPSHRVTGNRRDSVEGAGWEFLFVAIDDHARIGFTDMYPDERRDSAVQFLRNAHAYFAALGVRLKAVLTDNGSAFRSHAFRGACAELGLKQRFTRAYRPQTNGKAERFIQSALREWAYAFSYQHSTERTDTLEAWMHHYNWHRPHQGIGGATPISRLKTSRNNLLTLHRLAITVHQILGTPAWPQAAGEHDPLSGRARGGRSDHF

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.27
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0.27
Rhizoplane 0.54
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11301715 3300004798 Bacteria 1306
2 Ga0070676_10164500 3300005328 Bacteria 1430
3 Ga0070676_10231409 3300005328 Bacteria 1225
4 Ga0070670_100014797 3300005331 Bacteria 6694
5 Ga0070670_100462362 3300005331 Bacteria 1125
6 Ga0068869_100248924 3300005334 Bacteria 1419
7 Ga0070666_10236940 3300005335 Bacteria 1290
8 Ga0070666_10280837 3300005335 Bacteria 1184
9 Ga0070680_100068513 3300005336 Bacteria 2913
10 Ga0070682_100105587 3300005337 Bacteria 1868
11 Ga0068868_100192711 3300005338 Bacteria 1695
12 Ga0068868_100202797 3300005338 Bacteria 1654
13 Ga0070660_100224594 3300005339 Bacteria 1527
14 Ga0070689_100346105 3300005340 Bacteria 1246
15 Ga0070689_100348554 3300005340 Bacteria 1241
16 Ga0070689_100416010 3300005340 Bacteria 1138
17 Ga0070691_10062412 3300005341 Bacteria 1794
18 Ga0070687_100016670 3300005343 Bacteria 3358
19 Ga0070687_100045115 3300005343 Bacteria 2249
20 Ga0070661_100133711 3300005344 Bacteria 1865
21 Ga0070692_10010991 3300005345 Bacteria 4144
22 Ga0070668_100255610 3300005347 Bacteria 1455
23 Ga0070675_100175189 3300005354 Bacteria 1852
24 Ga0070675_100181824 3300005354 Bacteria 1818
25 Ga0070675_100322051 3300005354 Bacteria 1366
26 Ga0070674_100043487 3300005356 Bacteria 3056
27 Ga0070674_100157503 3300005356 Bacteria 1720
28 Ga0070674_100266979 3300005356 Bacteria 1351
29 Ga0070673_100116746 3300005364 Bacteria 2220
30 Ga0070673_100331899 3300005364 Bacteria 1346
31 Ga0070688_100040684 3300005365 Bacteria 2850
32 Ga0070659_100329000 3300005366 Bacteria 1278
33 Ga0070667_100077909 3300005367 Bacteria 2831
34 Ga0070667_100330671 3300005367 Bacteria 1377
35 Ga0070667_100396390 3300005367 Unclassified 1256
36 Ga0070703_10043645 3300005406 Bacteria 1407
37 Ga0070714_100424553 3300005435 Bacteria 1260
38 Ga0070701_10050249 3300005438 Bacteria 2158
39 Ga0070701_10238673 3300005438 Bacteria 1092
40 Ga0070705_100020389 3300005440 Bacteria 3507
41 Ga0070705_100212714 3300005440 Bacteria 1334
42 Ga0070700_100244693 3300005441 Bacteria 1283
43 Ga0070694_100224126 3300005444 Bacteria 1411
44 Ga0070678_100172165 3300005456 Bacteria 1764
45 Ga0070678_100335657 3300005456 Bacteria 1295
46 Ga0070662_100380282 3300005457 Unclassified 1162
47 Ga0070681_10485524 3300005458 Bacteria 1148
48 Ga0068867_100089455 3300005459 Bacteria 2335
49 Ga0068867_100214006 3300005459 Bacteria 1549
50 Ga0070706_100009411 3300005467 Bacteria 9097
51 Ga0070707_100109293 3300005468 Bacteria 2682
52 Ga0070707_100233137 3300005468 Bacteria 1791
53 Ga0070698_100147633 3300005471 Bacteria 2300
54 Ga0070698_100350233 3300005471 Bacteria 1408
55 Ga0070684_100035752 3300005535 Bacteria 4253
56 Ga0068853_100358489 3300005539 Bacteria 1358
57 Ga0068853_100404121 3300005539 Unclassified 1279
58 Ga0070672_100039515 3300005543 Bacteria 3615
59 Ga0070672_100359319 3300005543 Bacteria 1243
60 Ga0070686_100004370 3300005544 Bacteria 7791
61 Ga0070686_100296608 3300005544 Unclassified 1197
62 Ga0070695_100033766 3300005545 Bacteria 3202
63 Ga0070696_100055821 3300005546 Bacteria 2754
64 Ga0070693_100046472 3300005547 Bacteria 2465
65 Ga0070665_100145360 3300005548 Bacteria 2374
66 Ga0070665_100345961 3300005548 Bacteria 1492
67 Ga0070704_100060720 3300005549 Bacteria 2702
68 Ga0070664_100129189 3300005564 Bacteria 2219
69 Ga0068857_100126846 3300005577 Bacteria 2300
70 Ga0068854_100142975 3300005578 Bacteria 1838
71 Ga0068854_100166925 3300005578 Bacteria 1709
72 Ga0068856_100162764 3300005614 Bacteria 2242
73 Ga0070702_100006015 3300005615 Bacteria 5712
74 Ga0070702_100233620 3300005615 Bacteria 1237
75 Ga0068852_100254733 3300005616 Bacteria 1683
76 Ga0068852_100432542 3300005616 Bacteria 1300
77 Ga0068859_100014804 3300005617 Bacteria 7835
78 Ga0068859_100325339 3300005617 Bacteria 1631
79 Ga0068864_100045844 3300005618 Bacteria 3750
80 Ga0068864_100360970 3300005618 Bacteria 1373
81 Ga0068864_100469350 3300005618 Bacteria 1206
82 Ga0068864_100502706 3300005618 Bacteria 1166
83 Ga0068866_10002185 3300005718 Bacteria 8144
84 Ga0068866_10084091 3300005718 Bacteria 1716
85 Ga0068861_100282409 3300005719 Bacteria 1430
86 Ga0068870_10001447 3300005840 Bacteria 9603
87 Ga0068870_10255080 3300005840 Bacteria 1089
88 Ga0068858_100374158 3300005842 Bacteria 1366
89 Ga0068860_100016669 3300005843 Bacteria 7165
90 Ga0068860_100129722 3300005843 Bacteria 2418
91 Ga0068862_100011795 3300005844 Bacteria 7216
92 Ga0068862_100373783 3300005844 Bacteria 1328
93 Ga0081455_10048706 3300005937 Bacteria 3659
94 Ga0081455_10104979 3300005937 Bacteria 2259
95 Ga0075364_10071312 3300006051 Bacteria 2288
96 Ga0075366_10069432 3300006195 Bacteria 2097
97 Ga0075366_10080253 3300006195 Bacteria 1948
98 Ga0075366_10105939 3300006195 Bacteria 1690
99 Ga0075366_10195465 3300006195 Bacteria 1230
100 Ga0097621_100002326 3300006237 Bacteria 13027
101 Ga0097621_100176665 3300006237 Bacteria 1843
102 Ga0075370_10154947 3300006353 Bacteria 1343
103 Ga0075370_10206533 3300006353 Bacteria 1159
104 Ga0068871_100068711 3300006358 Bacteria 2909
105 Ga0068871_100321845 3300006358 Bacteria 1362
106 Ga0068871_100346738 3300006358 Bacteria 1313
107 Ga0075428_100448503 3300006844 Bacteria 1382
108 Ga0068865_100003374 3300006881 Bacteria 9564
109 Ga0068865_100150412 3300006881 Bacteria 1765
110 Ga0068865_100449719 3300006881 Bacteria 1065
111 Ga0097620_100014802 3300006931 Bacteria 7835
112 Ga0097620_100325340 3300006931 Bacteria 1631
113 Ga0075435_100193790 3300007076 Bacteria 1721
114 Ga0105250_10065713 3300009092 Bacteria 1462
115 Ga0105240_10614105 3300009093 Bacteria 1196
116 Ga0105245_10012806 3300009098 Bacteria 7308
117 Ga0105245_10163158 3300009098 Bacteria 2116
118 Ga0105245_10461449 3300009098 Bacteria 1280
119 Ga0105247_10116644 3300009101 Bacteria 1725
120 Ga0105243_10003679 3300009148 Bacteria 12325
121 Ga0105243_10061631 3300009148 Bacteria 3001
122 Ga0105241_10299220 3300009174 Bacteria 1380
123 Ga0105242_10164324 3300009176 Bacteria 1946
124 Ga0105242_10314834 3300009176 Bacteria 1433
125 Ga0105248_10268611 3300009177 Bacteria 1920
126 Ga0105237_10655420 3300009545 Bacteria 1056
127 Ga0105238_10150827 3300009551 Bacteria 2300
128 Ga0105238_10347819 3300009551 Bacteria 1471
129 Ga0105249_10092424 3300009553 Bacteria 2832
130 Ga0105249_10559141 3300009553 Bacteria 1195
131 Ga0105239_10392352 3300010375 Bacteria 1570
132 Ga0105246_10169698 3300011119 Bacteria 1670
133 Ga0105246_10231922 3300011119 Bacteria 1454
134 Ga0157373_10338308 3300013100 Bacteria 1072
135 Ga0157370_10409857 3300013104 Bacteria 1247
136 Ga0157369_10405958 3300013105 Bacteria 1413
137 Ga0157374_10261387 3300013296 Bacteria 1705
138 Ga0157378_10463177 3300013297 Bacteria 1260
139 Ga0163162_10205050 3300013306 Bacteria 2101
140 Ga0163162_10291363 3300013306 Bacteria 1764
141 Ga0163162_10396622 3300013306 Bacteria 1512
142 Ga0157375_10444963 3300013308 Bacteria 1461
143 Ga0157375_10468593 3300013308 Bacteria 1425
144 Ga0163163_10075365 3300014325 Bacteria 3367
145 Ga0163163_10659960 3300014325 Bacteria 1109
146 Ga0157380_10070534 3300014326 Bacteria 2824
147 Ga0157379_10055947 3300014968 Bacteria 3526
148 Ga0157379_10225849 3300014968 Bacteria 1697
149 Ga0157376_10175177 3300014969 Bacteria 1956
150 Ga0157376_10191041 3300014969 Bacteria 1878
151 Ga0157376_10234756 3300014969 Bacteria 1705
152 Ga0157376_10378938 3300014969 Bacteria 1362
153 Ga0163161_10032178 3300017792 Bacteria 3743
154 Ga0163161_10279185 3300017792 Bacteria 1310
155 Ga0163161_10305294 3300017792 Bacteria 1254
156 Ga0209565_1025674 3300025263 Bacteria 1189
157 Ga0207697_10059654 3300025315 Bacteria 1585
158 Ga0207653_10053969 3300025885 Bacteria 1343
159 Ga0207653_10086473 3300025885 Bacteria 1093
160 Ga0207642_10022866 3300025899 Bacteria 2487
161 Ga0207642_10177306 3300025899 Bacteria 1158
162 Ga0207680_10333450 3300025903 Bacteria 1063
163 Ga0207645_10072823 3300025907 Bacteria 2200
164 Ga0207645_10111104 3300025907 Bacteria 1774
165 Ga0207643_10014772 3300025908 Bacteria 4246
166 Ga0207684_10056822 3300025910 Bacteria 3320
167 Ga0207684_10416736 3300025910 Bacteria 1154
168 Ga0207707_10402843 3300025912 Bacteria 1174
169 Ga0207695_10466554 3300025913 Bacteria 1145
170 Ga0207660_10418558 3300025917 Bacteria 1080
171 Ga0207662_10033839 3300025918 Bacteria 2981
172 Ga0207662_10056998 3300025918 Bacteria 2334
173 Ga0207657_10135738 3300025919 Bacteria 2013
174 Ga0207649_10363379 3300025920 Bacteria 1075
175 Ga0207646_10092334 3300025922 Bacteria 2709
176 Ga0207646_10249559 3300025922 Bacteria 1603
177 Ga0207646_10249864 3300025922 Bacteria 1602
178 Ga0207681_10457718 3300025923 Bacteria 1039
179 Ga0207694_10182814 3300025924 Bacteria 1701
180 Ga0207650_10007161 3300025925 Bacteria 7601
181 Ga0207650_10085837 3300025925 Bacteria 2395
182 Ga0207650_10259013 3300025925 Bacteria 1410
183 Ga0207659_10186296 3300025926 Bacteria 1648
184 Ga0207659_10306016 3300025926 Bacteria 1307
185 Ga0207659_10353238 3300025926 Bacteria 1220
186 Ga0207687_10021893 3300025927 Bacteria 4249
187 Ga0207687_10372734 3300025927 Bacteria 1168
188 Ga0207644_10325557 3300025931 Bacteria 1243
189 Ga0207690_10366436 3300025932 Bacteria 1142
190 Ga0207686_10192078 3300025934 Bacteria 1456
191 Ga0207686_10224963 3300025934 Unclassified 1357
192 Ga0207709_10039074 3300025935 Bacteria 2832
193 Ga0207709_10184949 3300025935 Bacteria 1475
194 Ga0207670_10040827 3300025936 Bacteria 3047
195 Ga0207669_10154606 3300025937 Bacteria 1611
196 Ga0207669_10212554 3300025937 Bacteria 1413
197 Ga0207669_10391673 3300025937 Bacteria 1085
198 Ga0207704_10386436 3300025938 Bacteria 1100
199 Ga0207704_10411087 3300025938 Bacteria 1070
200 Ga0207691_10012046 3300025940 Bacteria 8295
201 Ga0207691_10138813 3300025940 Bacteria 2143
202 Ga0207691_10250591 3300025940 Bacteria 1528
203 Ga0207691_10415340 3300025940 Bacteria 1147
204 Ga0207711_10143942 3300025941 Bacteria 2146
205 Ga0207689_10212529 3300025942 Bacteria 1598
206 Ga0207679_10153540 3300025945 Bacteria 1877
207 Ga0207679_10512007 3300025945 Bacteria 1072
208 Ga0207667_10573831 3300025949 Bacteria 1139
209 Ga0207651_10071243 3300025960 Bacteria 2463
210 Ga0207651_10180908 3300025960 Bacteria 1672
211 Ga0207712_10475010 3300025961 Bacteria 1065
212 Ga0207640_10146585 3300025981 Bacteria 1728
213 Ga0207640_10177029 3300025981 Bacteria 1595
214 Ga0207677_10457880 3300026023 Bacteria 1094
215 Ga0207703_10548051 3300026035 Bacteria 1090
216 Ga0207639_10121004 3300026041 Bacteria 2151
217 Ga0207639_10236011 3300026041 Bacteria 1588
218 Ga0207639_10538039 3300026041 Unclassified 1071
219 Ga0207708_10061961 3300026075 Bacteria 2857
220 Ga0207708_10383808 3300026075 Bacteria 1159
221 Ga0207641_10035592 3300026088 Bacteria 4149
222 Ga0207648_10136418 3300026089 Bacteria 2161
223 Ga0207648_10158742 3300026089 Bacteria 1997
224 Ga0207676_10120775 3300026095 Bacteria 2209
225 Ga0207676_10240591 3300026095 Bacteria 1623
226 Ga0207674_10081349 3300026116 Bacteria 3241
227 Ga0207675_100221457 3300026118 Bacteria 1823
228 Ga0207675_100424744 3300026118 Bacteria 1313
229 Ga0207675_100444314 3300026118 Bacteria 1284
230 Ga0207683_10083755 3300026121 Bacteria 2834
231 Ga0207683_10242490 3300026121 Bacteria 1644
232 Ga0207683_10282210 3300026121 Bacteria 1518
233 Ga0207683_10422514 3300026121 Bacteria 1228
234 Ga0207698_10429180 3300026142 Bacteria 1270
235 Ga0209281_1000084 3300027111 Bacteria 254215
236 Ga0209998_10018943 3300027717 Bacteria 1464
237 Ga0209813_10060836 3300027866 Bacteria 1205
238 Ga0268266_10425230 3300028379 Bacteria 1259
239 Ga0268266_10557239 3300028379 Bacteria 1098
240 Ga0268265_10381651 3300028380 Bacteria 1296
241 Ga0268265_10594674 3300028380 Bacteria 1056
242 Ga0268264_10135451 3300028381 Bacteria 2189
243 Ga0268264_10304492 3300028381 Bacteria 1501
244 Ga0307517_10187726 3300028786 Bacteria 1319
245 Ga0307515_10279938 3300028794 Bacteria 1376
246 Ga0307515_10358641 3300028794 Bacteria 1100
247 Ga0307509_10065400 3300031507 Bacteria 3819
248 Ga0307509_10108933 3300031507 Bacteria 2782
249 Ga0307408_100165332 3300031548 Bacteria 1761
250 Ga0307405_10216437 3300031731 Unclassified 1402
251 Ga0307406_10186362 3300031901 Unclassified 1515
252 Ga0307412_10119595 3300031911 Bacteria 1894
253 Ga0307412_10338048 3300031911 Unclassified 1204
254 Ga0307409_100286194 3300031995 Unclassified 1526
255 Ga0307409_100503053 3300031995 Bacteria 1180
256 Ga0307416_100487323 3300032002 Bacteria 1294
257 Ga0307416_100732035 3300032002 Unclassified 1080
258 Ga0307414_10294304 3300032004 Bacteria 1370
259 Ga0307415_100396063 3300032126 Unclassified 1177
260 Ga0307510_10219287 3300033180 Bacteria 1415
261 Ga0307510_10248219 3300033180 Bacteria 1269
262 Ga0373949_0005471 3300035090 Bacteria 2831
263 Ga0373951_0042872 3300035091 Bacteria 1095
264 Ga0373932_0004130 3300035112 Bacteria 3450
265 Ga0373941_0043430 3300035115 Bacteria 1399
266 Ga0373960_0000035 3300035121 Bacteria 17442
267 Ga0373942_0051655 3300035207 Bacteria 1154
268 Ga0373961_0002554 3300035241 Bacteria 4689
269 Ga0373927_0051876 3300035695 Bacteria 2653
270 Ga0373947_0094795 3300035725 Bacteria 1867
271 Ga0395905_0362638 3300037471 Bacteria 1342
272 Ga0436365_0934025 3300039437 Bacteria 1122
273 Ga0436360_0342383 3300039438 Bacteria 1550
274 Ga0436361_0121237 3300039447 Bacteria 1404
275 Ga0436361_0933768 3300039447 Bacteria 1967
276 Ga0439439_0011046 3300041406 Bacteria 2167
277 Ga0451789_1011062 3300041443 Bacteria 1185
278 Ga0439441_005503 3300042001 Bacteria 1972
279 Ga0439443_004068 3300042003 Bacteria 1883
280 Ga0439435_0016537 3300042436 Bacteria 1851
281 Ga0439444_0005373 3300042437 Bacteria 1898
282 Ga0439460_0053965 3300042461 Bacteria 1211
283 Ga0451577_0020909 3300042876 Bacteria 5999
284 Ga0453683_0117586 3300044673 Bacteria 1673
285 Ga0453684_0686887 3300044712 Bacteria 1113
286 Ga0466967_0557702 3300045976 Bacteria 1128
287 Ga0495638_0030377 3300046460 Bacteria 3479
288 Ga0495580_0271995 3300046472 Bacteria 1157
289 Ga0495580_0297423 3300046472 Bacteria 1099
290 Ga0495632_0164952 3300046519 Bacteria 1019
291 Ga0495644_0038245 3300046523 Bacteria 1810
292 Ga0495598_0004394 3300046537 Bacteria 3048
293 Ga0495598_0028500 3300046537 Unclassified 1549
294 Ga0495621_0044102 3300046539 Bacteria 1575
295 Ga0495621_0097734 3300046539 Bacteria 1114
296 Ga0495656_0013290 3300046615 Bacteria 3059
297 Ga0495659_0056577 3300046664 Bacteria 1440
298 Ga0495647_0112283 3300046681 Bacteria 1138
299 Ga0495589_0025065 3300046794 Bacteria 3028
300 Ga0495686_0027806 3300047472 Bacteria 3688
301 Ga0495686_0172962 3300047472 Bacteria 1255
302 Ga0496108_0403839 3300048911 Bacteria 1193
303 Ga0496126_0441137 3300048929 Bacteria 1049
304 Ga0495682_0015356 3300049460 Bacteria 2902
305 Ga0501031_0223325 3300049568 Bacteria 1226
306 Ga0501031_0280727 3300049568 Bacteria 1080
307 Ga0501032_0013729 3300049569 Bacteria 5749
308 Ga0501032_0014754 3300049569 Bacteria 5530
309 Ga0501032_0181793 3300049569 Bacteria 1376
310 Ga0501032_0213657 3300049569 Bacteria 1257
311 Ga0501032_0219531 3300049569 Bacteria 1237
312 Ga0501033_0046822 3300049570 Bacteria 3215
313 Ga0501033_0199973 3300049570 Bacteria 1427
314 Ga0501034_0512668 3300049571 Bacteria 1112
315 Ga0501036_0099408 3300049572 Bacteria 2460
316 Ga0501038_0066237 3300049574 Bacteria 3076
317 Ga0501038_0078979 3300049574 Bacteria 2775
318 Ga0501038_0157177 3300049574 Bacteria 1850
319 Ga0501038_0374491 3300049574 Bacteria 1105
320 Ga0501039_0065422 3300049575 Bacteria 2820
321 Ga0501039_0329779 3300049575 Bacteria 1199
322 Ga0501040_0174556 3300049576 Bacteria 1523
323 Ga0501041_0234919 3300049577 Bacteria 1151
324 Ga0501043_0363808 3300049579 Bacteria 1097
325 Ga0501046_0001218 3300049580 Bacteria 24929
326 Ga0501046_0031856 3300049580 Bacteria 4272
327 Ga0501046_0355177 3300049580 Bacteria 1063
328 Ga0501047_0214061 3300049581 Bacteria 1784
329 Ga0501047_0381751 3300049581 Bacteria 1243
330 Ga0501047_0454222 3300049581 Bacteria 1110
331 Ga0501048_0175332 3300049582 Bacteria 1519
332 Ga0501048_0234806 3300049582 Bacteria 1301
333 Ga0501048_0299916 3300049582 Bacteria 1143
334 Ga0501067_0134832 3300049583 Bacteria 1374
335 Ga0501068_0277059 3300049584 Bacteria 1071
336 Ga0501069_0187810 3300049585 Bacteria 1195
337 Ga0501071_0119692 3300049587 Bacteria 1951
338 Ga0501072_0222010 3300049588 Bacteria 1506
339 Ga0501072_0257765 3300049588 Bacteria 1388
340 Ga0501074_0338248 3300049590 Bacteria 1068
341 Ga0501075_0243353 3300049591 Bacteria 1371
342 Ga0501076_0204834 3300049592 Bacteria 1611
343 Ga0501249_001220 3300049679 Bacteria 5395
344 Ga0501249_012443 3300049679 Unclassified 1799
345 Ga0501225_0001295 3300049705 Bacteria 7755
346 Ga0501080_0336622 3300049742 Bacteria 1364
347 Ga0501081_0273193 3300049743 Bacteria 1236
348 Ga0501279_014422 3300049775 Bacteria 1088
349 Ga0501035_0009633 3300049822 Bacteria 8984
350 Ga0501044_0127383 3300049823 Bacteria 2542
351 Ga0501044_0286591 3300049823 Bacteria 1579
352 nmdc:mga03683_128843_c1 3300050489 Bacteria 1131
353 nmdc:mga00v17_175617_c1 3300050491 Bacteria 1382
354 nmdc:mga00v17_230143_c1 3300050491 Bacteria 1201
355 nmdc:mga0k408_218594_c1 3300050493 Bacteria 1138
356 nmdc:mga04h51_72797_c1 3300050495 Bacteria 1204
357 nmdc:mga07m45_108480_c1 3300050496 Bacteria 1598
358 nmdc:mga07m45_124933_c1 3300050496 Bacteria 1143
359 nmdc:mga09592_305428_c1 3300050508 Bacteria 1379
360 nmdc:mga0rr50_352672_c1 3300050513 Bacteria 1238
361 Ga0495601_0177876 3300053077 Bacteria 1391
362 Ga0500651_0201190 3300053093 Bacteria 1175
363 Ga0500604_0032747 3300053151 Bacteria 1533
364 Ga0501084_0343166 3300054114 Bacteria 1261
365 Ga0501084_0376746 3300054114 Bacteria 1199
366 Ga0530510_0217252 3300061734 Bacteria 1420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100502706 Ga0068864_1005027061 248
2 3300026095 Ga0207676_10120775 Ga0207676_101207752 248
3 3300005356 Ga0070674_100157503 Ga0070674_1001575032 265
4 3300025940 Ga0207691_10012046 Ga0207691_100120464 265
5 3300041406 Ga0439439_0011046 Ga0439439_0011046_1161_1964 266
6 3300042003 Ga0439443_004068 Ga0439443_004068_712_1524 270
7 3300042437 Ga0439444_0005373 Ga0439444_0005373_909_1721 270
8 3300042461 Ga0439460_0053965 Ga0439460_0053965_43_855 270
9 3300005331 Ga0070670_100014797 Ga0070670_1000147974 272
10 3300005367 Ga0070667_100077909 Ga0070667_1000779093 272
11 3300005543 Ga0070672_100039515 Ga0070672_1000395152 272
12 3300025925 Ga0207650_10007161 Ga0207650_100071614 272
13 3300025960 Ga0207651_10071243 Ga0207651_100712432 272
14 3300028381 Ga0268264_10304492 Ga0268264_103044922 272
15 3300009545 Ga0105237_10655420 Ga0105237_106554201 281
16 3300026041 Ga0207639_10121004 Ga0207639_101210041 281
17 3300031731 Ga0307405_10216437 Ga0307405_102164372 289
18 3300031901 Ga0307406_10186362 Ga0307406_101863621 289
19 3300031911 Ga0307412_10338048 Ga0307412_103380481 289
20 3300031995 Ga0307409_100286194 Ga0307409_1002861942 289
21 3300032002 Ga0307416_100732035 Ga0307416_1007320351 289
22 3300032126 Ga0307415_100396063 Ga0307415_1003960632 289
23 3300049679 Ga0501249_012443 Ga0501249_012443_674_1597 289
24 3300049574 Ga0501038_0066237 Ga0501038_0066237_1905_2786 290
25 3300049580 Ga0501046_0031856 Ga0501046_0031856_2574_3497 290
26 3300025923 Ga0207681_10457718 Ga0207681_104577181 292
27 3300046794 Ga0495589_0025065 Ga0495589_0025065_1305_2240 292
28 3300046472 Ga0495580_0271995 Ga0495580_0271995_17_907 296
29 3300049575 Ga0501039_0065422 Ga0501039_0065422_501_1394 296
30 3300049822 Ga0501035_0009633 Ga0501035_0009633_135_1028 296
31 iso_pu_bacteria 2786546940 2788434705 296
32 3300049568 Ga0501031_0223325 Ga0501031_0223325_285_1181 297
33 3300049568 Ga0501031_0280727 Ga0501031_0280727_104_1000 297
34 3300049569 Ga0501032_0013729 Ga0501032_0013729_2196_3092 297
35 3300049569 Ga0501032_0014754 Ga0501032_0014754_2436_3332 297
36 3300049569 Ga0501032_0181793 Ga0501032_0181793_285_1181 297
37 3300049569 Ga0501032_0219531 Ga0501032_0219531_95_991 297
38 3300049570 Ga0501033_0046822 Ga0501033_0046822_2213_3109 297
39 3300049570 Ga0501033_0199973 Ga0501033_0199973_432_1328 297
40 3300049572 Ga0501036_0099408 Ga0501036_0099408_608_1504 297
41 3300049574 Ga0501038_0078979 Ga0501038_0078979_1741_2637 297
42 3300049574 Ga0501038_0157177 Ga0501038_0157177_592_1488 297
43 3300049581 Ga0501047_0454222 Ga0501047_0454222_157_1053 297
44 3300049582 Ga0501048_0175332 Ga0501048_0175332_489_1385 297
45 3300049583 Ga0501067_0134832 Ga0501067_0134832_222_1118 297
46 3300049584 Ga0501068_0277059 Ga0501068_0277059_162_1058 297
47 3300049587 Ga0501071_0119692 Ga0501071_0119692_818_1714 297
48 3300049588 Ga0501072_0257765 Ga0501072_0257765_451_1347 297
49 3300049590 Ga0501074_0338248 Ga0501074_0338248_152_1048 297
50 3300049823 Ga0501044_0127383 Ga0501044_0127383_919_1815 297
51 3300049823 Ga0501044_0286591 Ga0501044_0286591_161_1057 297
52 3300005354 Ga0070675_100322051 Ga0070675_1003220511 298
53 3300006844 Ga0075428_100448503 Ga0075428_1004485031 298
54 3300025926 Ga0207659_10353238 Ga0207659_103532381 298
55 3300035207 Ga0373942_0051655 Ga0373942_0051655_43_942 298
56 3300014325 Ga0163163_10659960 Ga0163163_106599601 299
57 3300048929 Ga0496126_0441137 Ga0496126_0441137_79_978 299
58 3300005468 Ga0070707_100109293 Ga0070707_1001092932 300
59 3300005843 Ga0068860_100129722 Ga0068860_1001297221 300
60 3300025263 Ga0209565_1025674 Ga0209565_10256741 300
61 3300027111 Ga0209281_1000084 Ga0209281_1000084109 300
62 3300039447 Ga0436361_0121237 Ga0436361_0121237_360_1262 300
63 3300041443 Ga0451789_1011062 Ga0451789_1011062_255_1157 300
64 3300046519 Ga0495632_0164952 Ga0495632_0164952_16_918 300
65 3300050493 nmdc:mga0k408_218594_c1 nmdc:mga0k408_218594_c1_32_934 300
66 3300050496 nmdc:mga07m45_124933_c1 nmdc:mga07m45_124933_c1_226_1128 300
67 3300039447 Ga0436361_0933768 Ga0436361_0933768_487_1395 302
68 3300009098 Ga0105245_10163158 Ga0105245_101631582 304
69 3300013306 Ga0163162_10291363 Ga0163162_102913632 304
70 3300014968 Ga0157379_10225849 Ga0157379_102258492 304
71 3300031995 Ga0307409_100503053 Ga0307409_1005030531 304
72 3300032004 Ga0307414_10294304 Ga0307414_102943041 304
73 3300046681 Ga0495647_0112283 Ga0495647_0112283_155_1105 305
74 3300026121 Ga0207683_10422514 Ga0207683_104225142 306
75 3300049585 Ga0501069_0187810 Ga0501069_0187810_218_1165 306
76 3300049775 Ga0501279_014422 Ga0501279_014422_36_968 310
77 iso_pu_bacteria 2945945610 2945949388 310
78 3300005340 Ga0070689_100346105 Ga0070689_1003461051 312
79 3300005354 Ga0070675_100181824 Ga0070675_1001818243 312
80 3300005364 Ga0070673_100116746 Ga0070673_1001167463 312
81 3300005548 Ga0070665_100145360 Ga0070665_1001453603 312
82 3300005616 Ga0068852_100254733 Ga0068852_1002547332 312
83 3300005618 Ga0068864_100045844 Ga0068864_1000458442 312
84 3300005840 Ga0068870_10255080 Ga0068870_102550801 312
85 3300006358 Ga0068871_100346738 Ga0068871_1003467382 312
86 3300006881 Ga0068865_100449719 Ga0068865_1004497191 312
87 3300009177 Ga0105248_10268611 Ga0105248_102686112 312
88 3300014325 Ga0163163_10075365 Ga0163163_100753652 312
89 3300014969 Ga0157376_10234756 Ga0157376_102347562 312
90 3300017792 Ga0163161_10032178 Ga0163161_100321784 312
91 3300025315 Ga0207697_10059654 Ga0207697_100596543 312
92 3300025907 Ga0207645_10072823 Ga0207645_100728232 312
93 3300025925 Ga0207650_10085837 Ga0207650_100858371 312
94 3300025926 Ga0207659_10186296 Ga0207659_101862961 312
95 3300025940 Ga0207691_10138813 Ga0207691_101388132 312
96 3300025941 Ga0207711_10143942 Ga0207711_101439424 312
97 3300026095 Ga0207676_10240591 Ga0207676_102405912 312
98 3300048911 Ga0496108_0403839 Ga0496108_0403839_207_1181 312
99 3300049571 Ga0501034_0512668 Ga0501034_0512668_35_973 312
100 3300049579 Ga0501043_0363808 Ga0501043_0363808_88_1026 312
101 3300049580 Ga0501046_0355177 Ga0501046_0355177_77_1015 312
102 3300049581 Ga0501047_0214061 Ga0501047_0214061_443_1381 312
103 3300049582 Ga0501048_0299916 Ga0501048_0299916_162_1100 312
104 3300005328 Ga0070676_10231409 Ga0070676_102314091 314
105 3300005334 Ga0068869_100248924 Ga0068869_1002489242 314
106 3300005338 Ga0068868_100192711 Ga0068868_1001927112 314
107 3300005354 Ga0070675_100175189 Ga0070675_1001751892 314
108 3300005456 Ga0070678_100335657 Ga0070678_1003356571 314
109 3300005459 Ga0068867_100214006 Ga0068867_1002140061 314
110 3300005718 Ga0068866_10084091 Ga0068866_100840912 314
111 3300006051 Ga0075364_10071312 Ga0075364_100713122 314
112 3300006195 Ga0075366_10069432 Ga0075366_100694322 314
113 3300006237 Ga0097621_100176665 Ga0097621_1001766652 314
114 3300006353 Ga0075370_10206533 Ga0075370_102065331 314
115 3300006358 Ga0068871_100321845 Ga0068871_1003218452 314
116 3300006881 Ga0068865_100150412 Ga0068865_1001504122 314
117 3300009148 Ga0105243_10061631 Ga0105243_100616312 314
118 3300009176 Ga0105242_10164324 Ga0105242_101643242 314
119 3300011119 Ga0105246_10169698 Ga0105246_101696982 314
120 3300013296 Ga0157374_10261387 Ga0157374_102613872 314
121 3300014969 Ga0157376_10175177 Ga0157376_101751772 314
122 3300025899 Ga0207642_10177306 Ga0207642_101773061 314
123 3300025926 Ga0207659_10306016 Ga0207659_103060161 314
124 3300025927 Ga0207687_10372734 Ga0207687_103727341 314
125 3300025935 Ga0207709_10184949 Ga0207709_101849491 314
126 3300025937 Ga0207669_10154606 Ga0207669_101546062 314
127 3300025938 Ga0207704_10411087 Ga0207704_104110871 314
128 3300025940 Ga0207691_10415340 Ga0207691_104153401 314
129 3300025942 Ga0207689_10212529 Ga0207689_102125292 314
130 3300026089 Ga0207648_10158742 Ga0207648_101587422 314
131 3300026121 Ga0207683_10282210 Ga0207683_102822102 314
132 3300035090 Ga0373949_0005471 Ga0373949_0005471_1296_2243 314
133 3300035091 Ga0373951_0042872 Ga0373951_0042872_83_1030 314
134 3300035112 Ga0373932_0004130 Ga0373932_0004130_556_1503 314
135 3300035115 Ga0373941_0043430 Ga0373941_0043430_65_1012 314
136 3300035121 Ga0373960_0000035 Ga0373960_0000035_2606_3553 314
137 3300035241 Ga0373961_0002554 Ga0373961_0002554_3346_4293 314
138 3300044673 Ga0453683_0117586 Ga0453683_0117586_383_1330 314
139 3300049580 Ga0501046_0001218 Ga0501046_0001218_7519_8466 314
140 3300050489 nmdc:mga03683_128843_c1 nmdc:mga03683_128843_c1_108_1055 314
141 3300050491 nmdc:mga00v17_175617_c1 nmdc:mga00v17_175617_c1_90_1037 314
142 3300054114 Ga0501084_0343166 Ga0501084_0343166_194_1141 314
143 3300005331 Ga0070670_100462362 Ga0070670_1004623621 315
144 3300005344 Ga0070661_100133711 Ga0070661_1001337112 315
145 3300005366 Ga0070659_100329000 Ga0070659_1003290002 315
146 3300005471 Ga0070698_100147633 Ga0070698_1001476333 315
147 3300005577 Ga0068857_100126846 Ga0068857_1001268463 315
148 3300005937 Ga0081455_10048706 Ga0081455_100487062 315
149 3300009098 Ga0105245_10461449 Ga0105245_104614492 315
150 3300025920 Ga0207649_10363379 Ga0207649_103633791 315
151 3300025925 Ga0207650_10259013 Ga0207650_102590131 315
152 3300025932 Ga0207690_10366436 Ga0207690_103664361 315
153 3300025945 Ga0207679_10153540 Ga0207679_101535402 315
154 3300025945 Ga0207679_10512007 Ga0207679_105120071 315
155 3300026116 Ga0207674_10081349 Ga0207674_100813492 315
156 3300028379 Ga0268266_10425230 Ga0268266_104252302 315
157 3300042001 Ga0439441_005503 Ga0439441_005503_491_1438 315
158 3300042436 Ga0439435_0016537 Ga0439435_0016537_301_1248 315
159 3300046523 Ga0495644_0038245 Ga0495644_0038245_750_1697 315
160 3300046537 Ga0495598_0004394 Ga0495598_0004394_241_1188 315
161 3300046615 Ga0495656_0013290 Ga0495656_0013290_1149_2096 315
162 3300046664 Ga0495659_0056577 Ga0495659_0056577_358_1305 315
163 3300050508 nmdc:mga09592_305428_c1 nmdc:mga09592_305428_c1_291_1238 315
164 3300004798 Ga0058859_11301715 Ga0058859_113017151 316
165 3300005328 Ga0070676_10164500 Ga0070676_101645002 316
166 3300005335 Ga0070666_10236940 Ga0070666_102369401 316
167 3300005335 Ga0070666_10280837 Ga0070666_102808371 316
168 3300005336 Ga0070680_100068513 Ga0070680_1000685133 316
169 3300005337 Ga0070682_100105587 Ga0070682_1001055871 316
170 3300005338 Ga0068868_100202797 Ga0068868_1002027972 316
171 3300005339 Ga0070660_100224594 Ga0070660_1002245942 316
172 3300005340 Ga0070689_100348554 Ga0070689_1003485541 316
173 3300005340 Ga0070689_100416010 Ga0070689_1004160101 316
174 3300005341 Ga0070691_10062412 Ga0070691_100624122 316
175 3300005343 Ga0070687_100016670 Ga0070687_1000166704 316
176 3300005343 Ga0070687_100045115 Ga0070687_1000451152 316
177 3300005345 Ga0070692_10010991 Ga0070692_100109916 316
178 3300005347 Ga0070668_100255610 Ga0070668_1002556101 316
179 3300005356 Ga0070674_100043487 Ga0070674_1000434875 316
180 3300005356 Ga0070674_100266979 Ga0070674_1002669792 316
181 3300005364 Ga0070673_100331899 Ga0070673_1003318991 316
182 3300005365 Ga0070688_100040684 Ga0070688_1000406844 316
183 3300005367 Ga0070667_100330671 Ga0070667_1003306712 316
184 3300005367 Ga0070667_100396390 Ga0070667_1003963902 316
185 3300005406 Ga0070703_10043645 Ga0070703_100436451 316
186 3300005435 Ga0070714_100424553 Ga0070714_1004245531 316
187 3300005438 Ga0070701_10050249 Ga0070701_100502491 316
188 3300005438 Ga0070701_10238673 Ga0070701_102386731 316
189 3300005440 Ga0070705_100020389 Ga0070705_1000203895 316
190 3300005440 Ga0070705_100212714 Ga0070705_1002127142 316
191 3300005441 Ga0070700_100244693 Ga0070700_1002446932 316
192 3300005444 Ga0070694_100224126 Ga0070694_1002241261 316
193 3300005456 Ga0070678_100172165 Ga0070678_1001721652 316
194 3300005457 Ga0070662_100380282 Ga0070662_1003802821 316
195 3300005458 Ga0070681_10485524 Ga0070681_104855241 316
196 3300005459 Ga0068867_100089455 Ga0068867_1000894552 316
197 3300005467 Ga0070706_100009411 Ga0070706_1000094117 316
198 3300005468 Ga0070707_100233137 Ga0070707_1002331372 316
199 3300005471 Ga0070698_100350233 Ga0070698_1003502332 316
200 3300005535 Ga0070684_100035752 Ga0070684_1000357523 316
201 3300005539 Ga0068853_100358489 Ga0068853_1003584891 316
202 3300005539 Ga0068853_100404121 Ga0068853_1004041212 316
203 3300005543 Ga0070672_100359319 Ga0070672_1003593192 316
204 3300005544 Ga0070686_100004370 Ga0070686_1000043704 316
205 3300005544 Ga0070686_100296608 Ga0070686_1002966082 316
206 3300005545 Ga0070695_100033766 Ga0070695_1000337662 316
207 3300005546 Ga0070696_100055821 Ga0070696_1000558213 316
208 3300005547 Ga0070693_100046472 Ga0070693_1000464721 316
209 3300005548 Ga0070665_100345961 Ga0070665_1003459611 316
210 3300005549 Ga0070704_100060720 Ga0070704_1000607201 316
211 3300005564 Ga0070664_100129189 Ga0070664_1001291892 316
212 3300005578 Ga0068854_100142975 Ga0068854_1001429752 316
213 3300005578 Ga0068854_100166925 Ga0068854_1001669252 316
214 3300005614 Ga0068856_100162764 Ga0068856_1001627641 316
215 3300005615 Ga0070702_100006015 Ga0070702_1000060154 316
216 3300005615 Ga0070702_100233620 Ga0070702_1002336201 316
217 3300005616 Ga0068852_100432542 Ga0068852_1004325421 316
218 3300005617 Ga0068859_100014804 Ga0068859_1000148043 316
219 3300005617 Ga0068859_100325339 Ga0068859_1003253392 316
220 3300005618 Ga0068864_100360970 Ga0068864_1003609702 316
221 3300005618 Ga0068864_100469350 Ga0068864_1004693501 316
222 3300005718 Ga0068866_10002185 Ga0068866_1000218515 316
223 3300005719 Ga0068861_100282409 Ga0068861_1002824092 316
224 3300005840 Ga0068870_10001447 Ga0068870_100014473 316
225 3300005842 Ga0068858_100374158 Ga0068858_1003741582 316
226 3300005843 Ga0068860_100016669 Ga0068860_1000166693 316
227 3300005844 Ga0068862_100011795 Ga0068862_1000117958 316
228 3300005844 Ga0068862_100373783 Ga0068862_1003737832 316
229 3300005937 Ga0081455_10104979 Ga0081455_101049792 316
230 3300006195 Ga0075366_10080253 Ga0075366_100802532 316
231 3300006195 Ga0075366_10105939 Ga0075366_101059392 316
232 3300006195 Ga0075366_10195465 Ga0075366_101954651 316
233 3300006237 Ga0097621_100002326 Ga0097621_10000232611 316
234 3300006353 Ga0075370_10154947 Ga0075370_101549472 316
235 3300006358 Ga0068871_100068711 Ga0068871_1000687113 316
236 3300006881 Ga0068865_100003374 Ga0068865_1000033743 316
237 3300006931 Ga0097620_100014802 Ga0097620_1000148026 316
238 3300006931 Ga0097620_100325340 Ga0097620_1003253402 316
239 3300007076 Ga0075435_100193790 Ga0075435_1001937901 316
240 3300009092 Ga0105250_10065713 Ga0105250_100657132 316
241 3300009093 Ga0105240_10614105 Ga0105240_106141051 316
242 3300009098 Ga0105245_10012806 Ga0105245_100128061 316
243 3300009101 Ga0105247_10116644 Ga0105247_101166442 316
244 3300009148 Ga0105243_10003679 Ga0105243_100036795 316
245 3300009174 Ga0105241_10299220 Ga0105241_102992202 316
246 3300009176 Ga0105242_10314834 Ga0105242_103148342 316
247 3300009551 Ga0105238_10150827 Ga0105238_101508273 316
248 3300009551 Ga0105238_10347819 Ga0105238_103478192 316
249 3300009553 Ga0105249_10092424 Ga0105249_100924243 316
250 3300009553 Ga0105249_10559141 Ga0105249_105591411 316
251 3300010375 Ga0105239_10392352 Ga0105239_103923522 316
252 3300011119 Ga0105246_10231922 Ga0105246_102319221 316
253 3300013100 Ga0157373_10338308 Ga0157373_103383081 316
254 3300013104 Ga0157370_10409857 Ga0157370_104098572 316
255 3300013105 Ga0157369_10405958 Ga0157369_104059581 316
256 3300013297 Ga0157378_10463177 Ga0157378_104631771 316
257 3300013306 Ga0163162_10205050 Ga0163162_102050503 316
258 3300013306 Ga0163162_10396622 Ga0163162_103966222 316
259 3300013308 Ga0157375_10444963 Ga0157375_104449632 316
260 3300013308 Ga0157375_10468593 Ga0157375_104685931 316
261 3300014326 Ga0157380_10070534 Ga0157380_100705342 316
262 3300014968 Ga0157379_10055947 Ga0157379_100559474 316
263 3300014969 Ga0157376_10191041 Ga0157376_101910412 316
264 3300014969 Ga0157376_10378938 Ga0157376_103789382 316
265 3300017792 Ga0163161_10279185 Ga0163161_102791851 316
266 3300017792 Ga0163161_10305294 Ga0163161_103052942 316
267 3300025885 Ga0207653_10053969 Ga0207653_100539691 316
268 3300025885 Ga0207653_10086473 Ga0207653_100864731 316
269 3300025899 Ga0207642_10022866 Ga0207642_100228661 316
270 3300025903 Ga0207680_10333450 Ga0207680_103334501 316
271 3300025907 Ga0207645_10111104 Ga0207645_101111042 316
272 3300025908 Ga0207643_10014772 Ga0207643_100147724 316
273 3300025910 Ga0207684_10056822 Ga0207684_100568223 316
274 3300025910 Ga0207684_10416736 Ga0207684_104167361 316
275 3300025912 Ga0207707_10402843 Ga0207707_104028431 316
276 3300025913 Ga0207695_10466554 Ga0207695_104665541 316
277 3300025917 Ga0207660_10418558 Ga0207660_104185581 316
278 3300025918 Ga0207662_10033839 Ga0207662_100338392 316
279 3300025918 Ga0207662_10056998 Ga0207662_100569981 316
280 3300025919 Ga0207657_10135738 Ga0207657_101357382 316
281 3300025922 Ga0207646_10092334 Ga0207646_100923343 316
282 3300025922 Ga0207646_10249559 Ga0207646_102495592 316
283 3300025922 Ga0207646_10249864 Ga0207646_102498642 316
284 3300025924 Ga0207694_10182814 Ga0207694_101828143 316
285 3300025927 Ga0207687_10021893 Ga0207687_100218934 316
286 3300025931 Ga0207644_10325557 Ga0207644_103255571 316
287 3300025934 Ga0207686_10192078 Ga0207686_101920781 316
288 3300025934 Ga0207686_10224963 Ga0207686_102249631 316
289 3300025935 Ga0207709_10039074 Ga0207709_100390744 316
290 3300025936 Ga0207670_10040827 Ga0207670_100408271 316
291 3300025937 Ga0207669_10212554 Ga0207669_102125541 316
292 3300025937 Ga0207669_10391673 Ga0207669_103916731 316
293 3300025938 Ga0207704_10386436 Ga0207704_103864361 316
294 3300025940 Ga0207691_10250591 Ga0207691_102505912 316
295 3300025949 Ga0207667_10573831 Ga0207667_105738311 316
296 3300025960 Ga0207651_10180908 Ga0207651_101809082 316
297 3300025961 Ga0207712_10475010 Ga0207712_104750101 316
298 3300025981 Ga0207640_10146585 Ga0207640_101465853 316
299 3300025981 Ga0207640_10177029 Ga0207640_101770291 316
300 3300026023 Ga0207677_10457880 Ga0207677_104578801 316
301 3300026035 Ga0207703_10548051 Ga0207703_105480511 316
302 3300026041 Ga0207639_10236011 Ga0207639_102360111 316
303 3300026041 Ga0207639_10538039 Ga0207639_105380391 316
304 3300026075 Ga0207708_10061961 Ga0207708_100619611 316
305 3300026075 Ga0207708_10383808 Ga0207708_103838081 316
306 3300026088 Ga0207641_10035592 Ga0207641_100355921 316
307 3300026089 Ga0207648_10136418 Ga0207648_101364182 316
308 3300026118 Ga0207675_100221457 Ga0207675_1002214573 316
309 3300026118 Ga0207675_100424744 Ga0207675_1004247442 316
310 3300026118 Ga0207675_100444314 Ga0207675_1004443141 316
311 3300026121 Ga0207683_10083755 Ga0207683_100837551 316
312 3300026121 Ga0207683_10242490 Ga0207683_102424902 316
313 3300026142 Ga0207698_10429180 Ga0207698_104291801 316
314 3300027717 Ga0209998_10018943 Ga0209998_100189431 316
315 3300027866 Ga0209813_10060836 Ga0209813_100608362 316
316 3300028379 Ga0268266_10557239 Ga0268266_105572391 316
317 3300028380 Ga0268265_10381651 Ga0268265_103816511 316
318 3300028380 Ga0268265_10594674 Ga0268265_105946741 316
319 3300028381 Ga0268264_10135451 Ga0268264_101354511 316
320 3300028786 Ga0307517_10187726 Ga0307517_101877261 316
321 3300028794 Ga0307515_10279938 Ga0307515_102799381 316
322 3300028794 Ga0307515_10358641 Ga0307515_103586411 316
323 3300031507 Ga0307509_10065400 Ga0307509_100654003 316
324 3300031507 Ga0307509_10108933 Ga0307509_101089331 316
325 3300031548 Ga0307408_100165332 Ga0307408_1001653321 316
326 3300031911 Ga0307412_10119595 Ga0307412_101195952 316
327 3300032002 Ga0307416_100487323 Ga0307416_1004873232 316
328 3300033180 Ga0307510_10219287 Ga0307510_102192872 316
329 3300033180 Ga0307510_10248219 Ga0307510_102482192 316
330 3300035695 Ga0373927_0051876 Ga0373927_0051876_318_1268 316
331 3300035725 Ga0373947_0094795 Ga0373947_0094795_91_1041 316
332 3300037471 Ga0395905_0362638 Ga0395905_0362638_53_1003 316
333 3300039437 Ga0436365_0934025 Ga0436365_0934025_86_1036 316
334 3300039438 Ga0436360_0342383 Ga0436360_0342383_366_1316 316
335 3300042876 Ga0451577_0020909 Ga0451577_0020909_2254_3312 316
336 3300044712 Ga0453684_0686887 Ga0453684_0686887_46_996 316
337 3300045976 Ga0466967_0557702 Ga0466967_0557702_160_1110 316
338 3300046460 Ga0495638_0030377 Ga0495638_0030377_1581_2531 316
339 3300046472 Ga0495580_0297423 Ga0495580_0297423_24_974 316
340 3300046537 Ga0495598_0028500 Ga0495598_0028500_467_1417 316
341 3300046539 Ga0495621_0044102 Ga0495621_0044102_379_1329 316
342 3300046539 Ga0495621_0097734 Ga0495621_0097734_80_1030 316
343 3300047472 Ga0495686_0027806 Ga0495686_0027806_1317_2267 316
344 3300047472 Ga0495686_0172962 Ga0495686_0172962_63_1013 316
345 3300049460 Ga0495682_0015356 Ga0495682_0015356_565_1515 316
346 3300049569 Ga0501032_0213657 Ga0501032_0213657_23_973 316
347 3300049574 Ga0501038_0374491 Ga0501038_0374491_65_1015 316
348 3300049575 Ga0501039_0329779 Ga0501039_0329779_84_1034 316
349 3300049576 Ga0501040_0174556 Ga0501040_0174556_211_1161 316
350 3300049577 Ga0501041_0234919 Ga0501041_0234919_20_970 316
351 3300049581 Ga0501047_0381751 Ga0501047_0381751_138_1088 316
352 3300049582 Ga0501048_0234806 Ga0501048_0234806_336_1286 316
353 3300049588 Ga0501072_0222010 Ga0501072_0222010_54_1004 316
354 3300049591 Ga0501075_0243353 Ga0501075_0243353_158_1108 316
355 3300049592 Ga0501076_0204834 Ga0501076_0204834_372_1322 316
356 3300049679 Ga0501249_001220 Ga0501249_001220_241_1191 316
357 3300049705 Ga0501225_0001295 Ga0501225_0001295_325_1275 316
358 3300049742 Ga0501080_0336622 Ga0501080_0336622_57_1007 316
359 3300049743 Ga0501081_0273193 Ga0501081_0273193_77_1027 316
360 3300050491 nmdc:mga00v17_230143_c1 nmdc:mga00v17_230143_c1_170_1120 316
361 3300050495 nmdc:mga04h51_72797_c1 nmdc:mga04h51_72797_c1_150_1100 316
362 3300050496 nmdc:mga07m45_108480_c1 nmdc:mga07m45_108480_c1_303_1253 316
363 3300050513 nmdc:mga0rr50_352672_c1 nmdc:mga0rr50_352672_c1_277_1227 316
364 3300053077 Ga0495601_0177876 Ga0495601_0177876_334_1290 316
365 3300053093 Ga0500651_0201190 Ga0500651_0201190_120_1070 316
366 3300053151 Ga0500604_0032747 Ga0500604_0032747_443_1393 316
367 3300054114 Ga0501084_0376746 Ga0501084_0376746_41_991 316
368 3300061734 Ga0530510_0217252 Ga0530510_0217252_41_991 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

234

300

0.98

PF13011

LZ_Tnp_IS481

leucine-zipper of insertion element IS481

1

90

0.95

PF13565

HTH_32

Homeodomain-like domain

41

107

0.92

PF00665

rve

Integrase core domain

129

246

0.83

PF13518

HTH_28

Helix-turn-helix domain

13

65

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.8634 74 111
7ue1-assembly1.cif.gz_B hiv-1 integrase catalytic core domain mutant (kgd) in complex with inhibitor grl-142 0.8503 133 304
8a1p-assembly1.cif.gz_D hiv-1 integrase catalytic core domain and c-terminal domain in complex with allosteric integrase inhibitor bi-d 0.85 130 304
5cz2-assembly2.cif.gz_D crystal structure of a two-domain fragment of mmtv integrase 0.8499 130 304
5cz2-assembly1.cif.gz_B crystal structure of a two-domain fragment of mmtv integrase 0.8488 130 304
ID Description Score Start End Superfamily
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9226 74 109 1.10.10.10
2x48C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9152 70 108 1.10.10.60
2w48D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8588 11 53 1.10.10.60
2cobA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8582 14 50 1.10.10.60
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8561 14 53 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X3I4W4-F1-model_v4 Transposase family protein 0.9204 187 307 GO:0003676
GO:0015074
AF-A0A0M4R4K7-F1-model_v4 Ethanolamine transporter 0.9051 185 306 GO:0003676
GO:0015074
GO:0016020
GO:0022857
AF-A0A6N3S3Y7-F1-model_v4 deleted 0.8993 169 316
AF-A0A2U0Y5A1-F1-model_v4 deleted 0.8975 173 316
AF-A0A6N3S505-F1-model_v4 deleted 0.8963 166 316

Feature Viewer

pLDDT pTM Quality
82 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map