F424674

General Info

Members Datasets Scaffolds Average Seq Length
368 171 736 222

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11085898|Ga0111539_110858981
Length 244
Sequence MSEECSYAQMSGQEAAMMMVRKSKGLGERHHRILAFLQQYQYDNKYPPSIREIGEKTGITSTSVVNYYLDQLEKKGLIERDRKISRGVRLAGMNGSPDTLRIPILGPIAAGSPIPELDPNISYLMDSEAHAVDIARSLLPSKEKGEDLYALEVQGESMIDAMINDGDIVVLKPASDARNGEMVAVWLPRDNEATLKYFFKEKDRYRLQPANPTMKPIFVKKSEPLEIKGKVVMVIRRMEKLLAA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
55 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 4.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 23.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_11085898 3300009094 Bacteria 930
2 SwRhRL2b_contig_3953429 2162886007 Bacteria 4650
3 JGI25406J46586_10000367 3300003203 Bacteria 20597
4 Ga0058863_11733036 3300004799 Bacteria 811
5 Ga0058861_12012606 3300004800 Bacteria 903
6 Ga0065704_10078404 3300005289 Bacteria 4440
7 Ga0065704_10080676 3300005289 Bacteria 3901
8 Ga0065704_10118107 3300005289 Bacteria 1822
9 Ga0065704_10212242 3300005289 Bacteria 1104
10 Ga0065715_10326860 3300005293 Bacteria 991
11 Ga0065707_10000587 3300005295 Bacteria 19505
12 Ga0065707_10000749 3300005295 Bacteria 13105
13 Ga0065707_10005541 3300005295 Bacteria 2818
14 Ga0065707_10102892 3300005295 Bacteria 2779
15 Ga0065707_10116910 3300005295 Bacteria 2225
16 Ga0070670_100595423 3300005331 Bacteria 989
17 Ga0070660_100099204 3300005339 Bacteria 2306
18 Ga0070689_100048257 3300005340 Bacteria 3284
19 Ga0070689_100138038 3300005340 Bacteria 1959
20 Ga0070689_100792492 3300005340 Unclassified 833
21 Ga0070668_100434300 3300005347 Bacteria 1126
22 Ga0070659_100395218 3300005366 Bacteria 1166
23 Ga0070709_10424641 3300005434 Bacteria 997
24 Ga0070714_100033754 3300005435 Bacteria 4280
25 Ga0070714_100056060 3300005435 Bacteria 3370
26 Ga0070705_100036498 3300005440 Bacteria 2764
27 Ga0070700_100006001 3300005441 Bacteria 6463
28 Ga0070694_100036395 3300005444 Bacteria 3260
29 Ga0070694_100250850 3300005444 Bacteria 1339
30 Ga0070708_100422286 3300005445 Bacteria 1257
31 Ga0070706_100101197 3300005467 Bacteria 2678
32 Ga0070706_100392680 3300005467 Bacteria 1291
33 Ga0070707_100430202 3300005468 Unclassified 1280
34 Ga0070707_100582049 3300005468 Bacteria 1082
35 Ga0070698_100008324 3300005471 Bacteria 11209
36 Ga0070698_100066266 3300005471 Unclassified 3635
37 Ga0070698_100081230 3300005471 Bacteria 3236
38 Ga0070698_100111353 3300005471 Unclassified 2702
39 Ga0070698_100114582 3300005471 Bacteria 2660
40 Ga0070698_100508406 3300005471 Bacteria 1143
41 Ga0070699_100003541 3300005518 Bacteria 13803
42 Ga0070699_100041597 3300005518 Bacteria 3978
43 Ga0070699_100051848 3300005518 Bacteria 3553
44 Ga0070684_100382692 3300005535 Bacteria 1296
45 Ga0070697_100305225 3300005536 Unclassified 1369
46 Ga0070697_100582289 3300005536 Unclassified 983
47 Ga0070696_100031077 3300005546 Bacteria 3658
48 Ga0070696_100391694 3300005546 Bacteria 1085
49 Ga0070704_100003031 3300005549 Bacteria 9555
50 Ga0068855_100127078 3300005563 Bacteria 2914
51 Ga0068857_101001065 3300005577 Unclassified 804
52 Ga0068859_100051346 3300005617 Bacteria 4145
53 Ga0068859_100111412 3300005617 Bacteria 2799
54 Ga0068859_100506665 3300005617 Bacteria 1302
55 Ga0068859_101138722 3300005617 Unclassified 859
56 Ga0068864_100355142 3300005618 Unclassified 1384
57 Ga0068858_100159615 3300005842 Unclassified 2123
58 Ga0068860_100273951 3300005843 Bacteria 1648
59 Ga0068862_100004463 3300005844 Bacteria 11802
60 Ga0068862_100104400 3300005844 Unclassified 2482
61 Ga0068862_100241976 3300005844 Bacteria 1641
62 Ga0081539_10001957 3300005985 Bacteria 31406
63 Ga0075427_10000211 3300006194 Bacteria 5976
64 Ga0075428_100004514 3300006844 Bacteria 15372
65 Ga0075428_100109229 3300006844 Bacteria 3014
66 Ga0075428_100115826 3300006844 Unclassified 2919
67 Ga0075428_100899859 3300006844 Unclassified 939
68 Ga0075428_100904992 3300006844 Bacteria 936
69 Ga0075430_100086383 3300006846 Unclassified 2626
70 Ga0075430_100116954 3300006846 Bacteria 2222
71 Ga0075431_100020380 3300006847 Bacteria 6774
72 Ga0075433_10027597 3300006852 Unclassified 4817
73 Ga0075434_100981715 3300006871 Unclassified 859
74 Ga0075429_100014633 3300006880 Bacteria 6800
75 Ga0075429_100019273 3300006880 Bacteria 5908
76 Ga0075429_100067745 3300006880 Bacteria 3107
77 Ga0075429_100144832 3300006880 Bacteria 2080
78 Ga0097620_100051343 3300006931 Bacteria 4145
79 Ga0097620_100111417 3300006931 Bacteria 2799
80 Ga0097620_100506720 3300006931 Bacteria 1302
81 Ga0097620_101138513 3300006931 Unclassified 859
82 Ga0105240_10218175 3300009093 Bacteria 2224
83 Ga0111539_10028982 3300009094 Bacteria 6751
84 Ga0111539_10267863 3300009094 Unclassified 1989
85 Ga0114129_10004898 3300009147 Bacteria 18897
86 Ga0114129_10027581 3300009147 Bacteria 8041
87 Ga0114129_10065359 3300009147 Bacteria 5077
88 Ga0114129_10175965 3300009147 Unclassified 2915
89 Ga0114129_10268932 3300009147 Bacteria 2281
90 Ga0105243_10199930 3300009148 Bacteria 1752
91 Ga0105243_10311831 3300009148 Bacteria 1430
92 Ga0105243_10600615 3300009148 Unclassified 1059
93 Ga0105241_10710898 3300009174 Unclassified 918
94 Ga0105249_10004910 3300009553 Bacteria 11539
95 Ga0105249_10380811 3300009553 Bacteria 1437
96 Ga0105249_11074708 3300009553 Bacteria 874
97 Ga0157370_10076931 3300013104 Unclassified 3143
98 Ga0157369_10039195 3300013105 Bacteria 5178
99 Ga0157375_10340473 3300013308 Unclassified 1665
100 Ga0157380_10103353 3300014326 Unclassified 2377
101 Ga0197907_10319441 3300020069 Bacteria 1094
102 Ga0206355_1045419 3300020076 Bacteria 928
103 Ga0206351_10533837 3300020077 Bacteria 980
104 Ga0206352_10364698 3300020078 Bacteria 1589
105 Ga0206354_11370417 3300020081 Bacteria 1260
106 Ga0206353_10084153 3300020082 Bacteria 848
107 Ga0154015_1495843 3300020610 Bacteria 878
108 Ga0213873_10008600 3300021358 Bacteria 2091
109 Ga0213873_10010122 3300021358 Unclassified 1980
110 Ga0213872_10151792 3300021361 Bacteria 1012
111 Ga0213874_10080805 3300021377 Bacteria 1053
112 Ga0213876_10044572 3300021384 Bacteria 2344
113 Ga0213876_10058172 3300021384 Unclassified 2040
114 Ga0213875_10081424 3300021388 Unclassified 1510
115 Ga0213875_10107266 3300021388 Bacteria 1304
116 Ga0213871_10009472 3300021441 Bacteria 2183
117 Ga0213871_10014063 3300021441 Unclassified 1892
118 Ga0213871_10112404 3300021441 Unclassified 806
119 Ga0224712_10190165 3300022467 Bacteria 929
120 Ga0207688_10471910 3300025901 Bacteria 784
121 Ga0207693_10204004 3300025915 Bacteria 1555
122 Ga0207660_10237407 3300025917 Unclassified 1435
123 Ga0207662_10272070 3300025918 Bacteria 1118
124 Ga0207652_10591021 3300025921 Bacteria 996
125 Ga0207646_10374166 3300025922 Unclassified 1287
126 Ga0207646_10501299 3300025922 Bacteria 1094
127 Ga0207646_10776440 3300025922 Unclassified 854
128 Ga0207709_10090100 3300025935 Bacteria 2002
129 Ga0207709_10400620 3300025935 Bacteria 1049
130 Ga0207709_10676221 3300025935 Bacteria 824
131 Ga0207670_10057484 3300025936 Bacteria 2638
132 Ga0207670_10240716 3300025936 Bacteria 1394
133 Ga0207670_10371143 3300025936 Unclassified 1137
134 Ga0207667_10528804 3300025949 Bacteria 1194
135 Ga0207712_10016212 3300025961 Bacteria 4819
136 Ga0207712_10848767 3300025961 Bacteria 805
137 Ga0207703_10169570 3300026035 Bacteria 1919
138 Ga0207639_10157730 3300026041 Unclassified 1909
139 Ga0207708_10019469 3300026075 Bacteria 5116
140 Ga0207648_10444262 3300026089 Unclassified 1180
141 Ga0207674_10073966 3300026116 Bacteria 3420
142 Ga0207674_11127854 3300026116 Unclassified 754
143 Ga0207675_100039801 3300026118 Unclassified 4387
144 Ga0268265_10019052 3300028380 Bacteria 4765
145 Ga0268265_10048916 3300028380 Bacteria 3177
146 Ga0268265_10364118 3300028380 Bacteria 1325
147 Ga0265326_10004261 3300028558 Bacteria 4597
148 Ga0265334_10041235 3300028573 Bacteria 1805
149 Ga0265318_10049699 3300028577 Bacteria 1577
150 Ga0265323_10017919 3300028653 Bacteria 2746
151 Ga0265323_10062702 3300028653 Bacteria 1289
152 Ga0265323_10131993 3300028653 Unclassified 808
153 Ga0265338_10000069 3300028800 Bacteria 186219
154 Ga0265338_10013149 3300028800 Bacteria 9373
155 Ga0265330_10115168 3300031235 Bacteria 1146
156 Ga0265330_10182271 3300031235 Bacteria 889
157 Ga0265332_10006999 3300031238 Bacteria 5109
158 Ga0265332_10235085 3300031238 Bacteria 759
159 Ga0265325_10000045 3300031241 Bacteria 87524
160 Ga0265340_10011178 3300031247 Bacteria 4781
161 Ga0265340_10061323 3300031247 Unclassified 1799
162 Ga0265339_10288541 3300031249 Bacteria 785
163 Ga0265331_10008419 3300031250 Bacteria 5868
164 Ga0265331_10186175 3300031250 Bacteria 937
165 Ga0265316_10019795 3300031344 Bacteria 5747
166 Ga0265316_10026669 3300031344 Bacteria 4800
167 Ga0265316_10042435 3300031344 Bacteria 3635
168 Ga0265316_10050359 3300031344 Bacteria 3275
169 Ga0265316_10084079 3300031344 Unclassified 2437
170 Ga0265316_10173178 3300031344 Bacteria 1609
171 Ga0265316_10229756 3300031344 Bacteria 1366
172 Ga0265313_10000015 3300031595 Bacteria 154649
173 Ga0316575_10001274 3300031665 Bacteria 8022
174 Ga0316579_10000974 3300031691 Bacteria 10021
175 Ga0316579_10016143 3300031691 Unclassified 3256
176 Ga0316579_10021400 3300031691 Unclassified 2882
177 Ga0265314_10191330 3300031711 Bacteria 1217
178 Ga0265342_10060390 3300031712 Unclassified 2235
179 Ga0265342_10106254 3300031712 Bacteria 1593
180 Ga0265342_10139233 3300031712 Bacteria 1355
181 Ga0316576_10030596 3300031727 Unclassified 3813
182 Ga0316576_10034927 3300031727 Bacteria 3586
183 Ga0316576_10041934 3300031727 Unclassified 3297
184 Ga0316576_10062364 3300031727 Unclassified 2734
185 Ga0316576_10559320 3300031727 Unclassified 838
186 Ga0316578_10112521 3300031728 Bacteria 1635
187 Ga0307405_10219134 3300031731 Bacteria 1395
188 Ga0316577_10001763 3300031733 Bacteria 10422
189 Ga0316577_10046484 3300031733 Unclassified 2424
190 Ga0316577_10065460 3300031733 Unclassified 2029
191 Ga0316577_10222772 3300031733 Bacteria 1066
192 Ga0316577_10242257 3300031733 Bacteria 1020
193 Ga0307413_10014248 3300031824 Bacteria 4030
194 Ga0307410_10105210 3300031852 Unclassified 2031
195 Ga0307410_10212337 3300031852 Unclassified 1484
196 Ga0307406_10460988 3300031901 Bacteria 1022
197 Ga0307407_10004321 3300031903 Bacteria 6006
198 Ga0307416_100297057 3300032002 Unclassified 1603
199 Ga0307416_100949096 3300032002 Bacteria 962
200 Ga0307416_101042159 3300032002 Unclassified 922
201 Ga0307415_100433651 3300032126 Bacteria 1131
202 Ga0316585_10003076 3300032137 Bacteria 4551
203 Ga0316593_10032427 3300032168 Bacteria 1706
204 Ga0316593_10224671 3300032168 Unclassified 698
205 Ga0373943_0088791 3300035170 Unclassified 1598
206 Ga0316574_0027619 3300035398 Unclassified 3419
207 Ga0316574_0479224 3300035398 Bacteria 777
208 Ga0316582_0017960 3300036647 Unclassified 4105
209 Ga0316582_0065214 3300036647 Unclassified 2344
210 Ga0316582_0072046 3300036647 Bacteria 2239
211 Ga0316582_0124583 3300036647 Bacteria 1727
212 Ga0316582_0184982 3300036647 Bacteria 1418
213 Ga0316582_0408334 3300036647 Bacteria 936
214 Ga0316584_0000779 3300036712 Bacteria 17864
215 Ga0316584_0006112 3300036712 Bacteria 8139
216 Ga0316584_0037031 3300036712 Bacteria 3622
217 Ga0316584_0050089 3300036712 Unclassified 3122
218 Ga0316584_0110954 3300036712 Bacteria 2053
219 Ga0395900_0661586 3300037418 Bacteria 980
220 Ga0395898_0305968 3300037466 Bacteria 1516
221 Ga0395905_0053247 3300037471 Bacteria 3788
222 Ga0316581_0000127 3300037588 Bacteria 11242
223 Ga0316581_0006465 3300037588 Unclassified 3104
224 Ga0436364_0210230 3300037853 Bacteria 6509
225 Ga0436364_0405588 3300037853 Bacteria 1879
226 Ga0436364_0839262 3300037853 Unclassified 3896
227 Ga0436364_1033040 3300037853 Bacteria 11169
228 Ga0436364_1228117 3300037853 Unclassified 2797
229 Ga0395901_0020889 3300038443 Bacteria 6706
230 Ga0400490_59142 3300038726 Bacteria 3298
231 Ga0436365_0203343 3300039437 Bacteria 8113
232 Ga0436365_0325548 3300039437 Unclassified 2149
233 Ga0436365_1436036 3300039437 Bacteria 1916
234 Ga0436360_0615331 3300039438 Bacteria 6865
235 Ga0436360_0681091 3300039438 Unclassified 1045
236 Ga0436360_0704494 3300039438 Bacteria 1519
237 Ga0436360_0758888 3300039438 Unclassified 3587
238 Ga0436360_0804217 3300039438 Bacteria 1200
239 Ga0436360_0823884 3300039438 Bacteria 6867
240 Ga0436360_1162810 3300039438 Bacteria 1690
241 Ga0436361_0018889 3300039447 Bacteria 1977
242 Ga0436361_0217953 3300039447 Bacteria 931
243 Ga0436361_0231048 3300039447 Bacteria 803
244 Ga0436361_0412421 3300039447 Bacteria 1101
245 Ga0436361_0541961 3300039447 Bacteria 1123
246 Ga0436361_0720551 3300039447 Bacteria 4828
247 Ga0436361_0821487 3300039447 Bacteria 4284
248 Ga0436361_0870426 3300039447 Bacteria 6917
249 Ga0436361_0976385 3300039447 Unclassified 1697
250 Ga0436361_1047903 3300039447 Unclassified 836
251 Ga0436361_1071742 3300039447 Bacteria 1123
252 Ga0436363_0881878 3300039450 Bacteria 1939
253 Ga0436363_1446865 3300039450 Bacteria 35348
254 Ga0436362_0068264 3300039453 Bacteria 4594
255 Ga0436362_0205798 3300039453 Unclassified 3549
256 Ga0436362_0227767 3300039453 Bacteria 9727
257 Ga0436362_0543152 3300039453 Unclassified 1799
258 Ga0436362_0563719 3300039453 Bacteria 1293
259 Ga0436362_0789957 3300039453 Unclassified 2092
260 Ga0436362_0819299 3300039453 Bacteria 8298
261 Ga0436362_0896623 3300039453 Bacteria 1226
262 Ga0436362_1294551 3300039453 Bacteria 1269
263 Ga0450923_023851 3300042125 Bacteria 1210
264 Ga0439459_0077177 3300042438 Bacteria 780
265 Ga0451577_0003656 3300042876 Bacteria 16862
266 Ga0451577_0016422 3300042876 Bacteria 6858
267 Ga0451577_0150666 3300042876 Bacteria 2093
268 Ga0451577_0594381 3300042876 Unclassified 1004
269 Ga0453683_0002238 3300044673 Bacteria 15295
270 Ga0453683_0012515 3300044673 Bacteria 5560
271 Ga0453683_0051332 3300044673 Bacteria 2583
272 Ga0453683_0051956 3300044673 Bacteria 2566
273 Ga0453683_0128207 3300044673 Unclassified 1598
274 Ga0453683_0165046 3300044673 Bacteria 1402
275 Ga0453683_0335452 3300044673 Unclassified 970
276 Ga0453684_0002905 3300044712 Bacteria 40159
277 Ga0453684_0004574 3300044712 Bacteria 28877
278 Ga0453684_0007412 3300044712 Bacteria 20193
279 Ga0453684_0009456 3300044712 Bacteria 17047
280 Ga0453684_0021631 3300044712 Bacteria 9594
281 Ga0453684_0029446 3300044712 Bacteria 7794
282 Ga0453684_0046265 3300044712 Bacteria 5789
283 Ga0453684_0061035 3300044712 Bacteria 4843
284 Ga0453684_0061849 3300044712 Bacteria 4803
285 Ga0453684_0067052 3300044712 Bacteria 4566
286 Ga0453684_0095126 3300044712 Unclassified 3662
287 Ga0453684_0115374 3300044712 Bacteria 3254
288 Ga0453684_0164105 3300044712 Bacteria 2624
289 Ga0453684_0202293 3300044712 Bacteria 2314
290 Ga0453684_0221230 3300044712 Bacteria 2193
291 Ga0453684_0222348 3300044712 Unclassified 2186
292 Ga0453684_0310187 3300044712 Bacteria 1790
293 Ga0453684_0363076 3300044712 Bacteria 1630
294 Ga0453684_0467208 3300044712 Bacteria 1402
295 Ga0453684_0561854 3300044712 Unclassified 1255
296 Ga0453684_0643080 3300044712 Unclassified 1158
297 Ga0453684_0815837 3300044712 Bacteria 1005
298 Ga0453684_0944219 3300044712 Unclassified 921
299 Ga0453684_1022372 3300044712 Bacteria 878
300 Ga0466957_0331761 3300044842 Bacteria 1028
301 Ga0451576_0011013 3300045051 Bacteria 10326
302 Ga0451576_0011617 3300045051 Bacteria 9977
303 Ga0451576_0043649 3300045051 Bacteria 4730
304 Ga0451576_0066447 3300045051 Unclassified 3754
305 Ga0451576_0115427 3300045051 Bacteria 2795
306 Ga0451576_0158506 3300045051 Bacteria 2361
307 Ga0451576_0189907 3300045051 Bacteria 2145
308 Ga0451576_0500233 3300045051 Bacteria 1277
309 Ga0451576_0591682 3300045051 Bacteria 1166
310 Ga0466967_1822810 3300045976 Bacteria 605
311 Ga0495642_0266450 3300046528 Bacteria 750
312 Ga0495633_0189439 3300046558 Bacteria 946
313 Ga0495647_0202551 3300046681 Bacteria 871
314 Ga0495589_0272867 3300046794 Bacteria 787
315 Ga0496106_0181921 3300048909 Bacteria 1669
316 Ga0496111_0541706 3300048914 Bacteria 855
317 Ga0501031_0534284 3300049568 Bacteria 756
318 Ga0501039_0106043 3300049575 Bacteria 2195
319 Ga0501040_0352816 3300049576 Bacteria 1054
320 Ga0501041_0357150 3300049577 Bacteria 924
321 Ga0501048_0232658 3300049582 Bacteria 1308
322 Ga0501071_0222390 3300049587 Bacteria 1421
323 Ga0501071_0251006 3300049587 Bacteria 1335
324 Ga0501072_0362868 3300049588 Bacteria 1150
325 Ga0501075_0104326 3300049591 Bacteria 2154
326 Ga0501075_0212113 3300049591 Bacteria 1477
327 Ga0501075_0490653 3300049591 Unclassified 937
328 Ga0501076_0013865 3300049592 Bacteria 6052
329 Ga0501076_0121220 3300049592 Bacteria 2118
330 Ga0501076_0124538 3300049592 Bacteria 2088
331 Ga0501076_0384784 3300049592 Bacteria 1153
332 Ga0501076_0658829 3300049592 Unclassified 864
333 Ga0501077_0203685 3300049593 Bacteria 1257
334 Ga0501207_031854 3300049654 Bacteria 889
335 Ga0501079_0023971 3300049741 Bacteria 4681
336 Ga0501080_0142877 3300049742 Bacteria 2213
337 Ga0501080_0345122 3300049742 Bacteria 1345
338 Ga0501081_0144011 3300049743 Bacteria 1709
339 Ga0501083_0169164 3300049744 Bacteria 1429
340 nmdc:mga05p37_103467_c1 3300050507 Bacteria 3505
341 nmdc:mga05p37_18425_c1 3300050507 Bacteria 8434
342 nmdc:mga05p37_219371_c1 3300050507 Bacteria 2296
343 nmdc:mga05p37_22072_c1 3300050507 Bacteria 7715
344 nmdc:mga05p37_50766_c1 3300050507 Bacteria 5102
345 nmdc:mga05p37_568072_c1 3300050507 Unclassified 1287
346 nmdc:mga05p37_76852_c1 3300050507 Bacteria 4110
347 nmdc:mga09592_104301_c1 3300050508 Bacteria 2430
348 nmdc:mga09592_1856_c1 3300050508 Bacteria 17016
349 nmdc:mga09592_323077_c1 3300050508 Bacteria 1337
350 nmdc:mga09592_767872_c1 3300050508 Bacteria 817
351 nmdc:mga0qj67_302045_c1 3300050509 Unclassified 1297
352 nmdc:mga06r32_218867_c1 3300050510 Bacteria 1892
353 nmdc:mga06r32_219458_c1 3300050510 Bacteria 1890
354 nmdc:mga06r32_451323_c1 3300050510 Bacteria 1265
355 nmdc:mga0a205_208400_c1 3300050515 Bacteria 1844
356 nmdc:mga0a205_466606_c1 3300050515 Bacteria 1122
357 nmdc:mga0a205_79942_c2 3300050515 Bacteria 2452
358 Ga0495619_0134423 3300053085 Bacteria 1701
359 Ga0587073_0067204 3300059492 Bacteria 857
360 Ga0587082_031725 3300059504 Unclassified 925
361 Ga0587086_025732 3300059507 Bacteria 835
362 Ga0587114_054427 3300059655 Bacteria 686
363 Ga0587071_056161 3300060344 Bacteria 826
364 Ga0501082_0463812 3300060353 Bacteria 1107
365 Ga0466962_0241867 3300061719 Unclassified 886
366 Ga0530510_0127566 3300061734 Bacteria 1871
367 Ga0530510_0387628 3300061734 Bacteria 1052
368 Ga0530510_0543283 3300061734 Bacteria 882
369 Ga0111539_11085898
370 SwRhRL2b_contig_3953429
371 JGI25406J46586_10000367
372 Ga0058863_11733036
373 Ga0058861_12012606
374 Ga0065704_10078404
375 Ga0065704_10080676
376 Ga0065704_10118107
377 Ga0065704_10212242
378 Ga0065715_10326860
379 Ga0065707_10000587
380 Ga0065707_10000749
381 Ga0065707_10005541
382 Ga0065707_10102892
383 Ga0065707_10116910
384 Ga0070670_100595423
385 Ga0070660_100099204
386 Ga0070689_100048257
387 Ga0070689_100138038
388 Ga0070689_100792492
389 Ga0070668_100434300
390 Ga0070659_100395218
391 Ga0070709_10424641
392 Ga0070714_100033754
393 Ga0070714_100056060
394 Ga0070705_100036498
395 Ga0070700_100006001
396 Ga0070694_100036395
397 Ga0070694_100250850
398 Ga0070708_100422286
399 Ga0070706_100101197
400 Ga0070706_100392680
401 Ga0070707_100430202
402 Ga0070707_100582049
403 Ga0070698_100008324
404 Ga0070698_100066266
405 Ga0070698_100081230
406 Ga0070698_100111353
407 Ga0070698_100114582
408 Ga0070698_100508406
409 Ga0070699_100003541
410 Ga0070699_100041597
411 Ga0070699_100051848
412 Ga0070684_100382692
413 Ga0070697_100305225
414 Ga0070697_100582289
415 Ga0070696_100031077
416 Ga0070696_100391694
417 Ga0070704_100003031
418 Ga0068855_100127078
419 Ga0068857_101001065
420 Ga0068859_100051346
421 Ga0068859_100111412
422 Ga0068859_100506665
423 Ga0068859_101138722
424 Ga0068864_100355142
425 Ga0068858_100159615
426 Ga0068860_100273951
427 Ga0068862_100004463
428 Ga0068862_100104400
429 Ga0068862_100241976
430 Ga0081539_10001957
431 Ga0075427_10000211
432 Ga0075428_100004514
433 Ga0075428_100109229
434 Ga0075428_100115826
435 Ga0075428_100899859
436 Ga0075428_100904992
437 Ga0075430_100086383
438 Ga0075430_100116954
439 Ga0075431_100020380
440 Ga0075433_10027597
441 Ga0075434_100981715
442 Ga0075429_100014633
443 Ga0075429_100019273
444 Ga0075429_100067745
445 Ga0075429_100144832
446 Ga0097620_100051343
447 Ga0097620_100111417
448 Ga0097620_100506720
449 Ga0097620_101138513
450 Ga0105240_10218175
451 Ga0111539_10028982
452 Ga0111539_10267863
453 Ga0114129_10004898
454 Ga0114129_10027581
455 Ga0114129_10065359
456 Ga0114129_10175965
457 Ga0114129_10268932
458 Ga0105243_10199930
459 Ga0105243_10311831
460 Ga0105243_10600615
461 Ga0105241_10710898
462 Ga0105249_10004910
463 Ga0105249_10380811
464 Ga0105249_11074708
465 Ga0157370_10076931
466 Ga0157369_10039195
467 Ga0157375_10340473
468 Ga0157380_10103353
469 Ga0197907_10319441
470 Ga0206355_1045419
471 Ga0206351_10533837
472 Ga0206352_10364698
473 Ga0206354_11370417
474 Ga0206353_10084153
475 Ga0154015_1495843
476 Ga0213873_10008600
477 Ga0213873_10010122
478 Ga0213872_10151792
479 Ga0213874_10080805
480 Ga0213876_10044572
481 Ga0213876_10058172
482 Ga0213875_10081424
483 Ga0213875_10107266
484 Ga0213871_10009472
485 Ga0213871_10014063
486 Ga0213871_10112404
487 Ga0224712_10190165
488 Ga0207688_10471910
489 Ga0207693_10204004
490 Ga0207660_10237407
491 Ga0207662_10272070
492 Ga0207652_10591021
493 Ga0207646_10374166
494 Ga0207646_10501299
495 Ga0207646_10776440
496 Ga0207709_10090100
497 Ga0207709_10400620
498 Ga0207709_10676221
499 Ga0207670_10057484
500 Ga0207670_10240716
501 Ga0207670_10371143
502 Ga0207667_10528804
503 Ga0207712_10016212
504 Ga0207712_10848767
505 Ga0207703_10169570
506 Ga0207639_10157730
507 Ga0207708_10019469
508 Ga0207648_10444262
509 Ga0207674_10073966
510 Ga0207674_11127854
511 Ga0207675_100039801
512 Ga0268265_10019052
513 Ga0268265_10048916
514 Ga0268265_10364118
515 Ga0265326_10004261
516 Ga0265334_10041235
517 Ga0265318_10049699
518 Ga0265323_10017919
519 Ga0265323_10062702
520 Ga0265323_10131993
521 Ga0265338_10000069
522 Ga0265338_10013149
523 Ga0265330_10115168
524 Ga0265330_10182271
525 Ga0265332_10006999
526 Ga0265332_10235085
527 Ga0265325_10000045
528 Ga0265340_10011178
529 Ga0265340_10061323
530 Ga0265339_10288541
531 Ga0265331_10008419
532 Ga0265331_10186175
533 Ga0265316_10019795
534 Ga0265316_10026669
535 Ga0265316_10042435
536 Ga0265316_10050359
537 Ga0265316_10084079
538 Ga0265316_10173178
539 Ga0265316_10229756
540 Ga0265313_10000015
541 Ga0316575_10001274
542 Ga0316579_10000974
543 Ga0316579_10016143
544 Ga0316579_10021400
545 Ga0265314_10191330
546 Ga0265342_10060390
547 Ga0265342_10106254
548 Ga0265342_10139233
549 Ga0316576_10030596
550 Ga0316576_10034927
551 Ga0316576_10041934
552 Ga0316576_10062364
553 Ga0316576_10559320
554 Ga0316578_10112521
555 Ga0307405_10219134
556 Ga0316577_10001763
557 Ga0316577_10046484
558 Ga0316577_10065460
559 Ga0316577_10222772
560 Ga0316577_10242257
561 Ga0307413_10014248
562 Ga0307410_10105210
563 Ga0307410_10212337
564 Ga0307406_10460988
565 Ga0307407_10004321
566 Ga0307416_100297057
567 Ga0307416_100949096
568 Ga0307416_101042159
569 Ga0307415_100433651
570 Ga0316585_10003076
571 Ga0316593_10032427
572 Ga0316593_10224671
573 Ga0373943_0088791
574 Ga0316574_0027619
575 Ga0316574_0479224
576 Ga0316582_0017960
577 Ga0316582_0065214
578 Ga0316582_0072046
579 Ga0316582_0124583
580 Ga0316582_0184982
581 Ga0316582_0408334
582 Ga0316584_0000779
583 Ga0316584_0006112
584 Ga0316584_0037031
585 Ga0316584_0050089
586 Ga0316584_0110954
587 Ga0395900_0661586
588 Ga0395898_0305968
589 Ga0395905_0053247
590 Ga0316581_0000127
591 Ga0316581_0006465
592 Ga0436364_0210230
593 Ga0436364_0405588
594 Ga0436364_0839262
595 Ga0436364_1033040
596 Ga0436364_1228117
597 Ga0395901_0020889
598 Ga0400490_59142
599 Ga0436365_0203343
600 Ga0436365_0325548
601 Ga0436365_1436036
602 Ga0436360_0615331
603 Ga0436360_0681091
604 Ga0436360_0704494
605 Ga0436360_0758888
606 Ga0436360_0804217
607 Ga0436360_0823884
608 Ga0436360_1162810
609 Ga0436361_0018889
610 Ga0436361_0217953
611 Ga0436361_0231048
612 Ga0436361_0412421
613 Ga0436361_0541961
614 Ga0436361_0720551
615 Ga0436361_0821487
616 Ga0436361_0870426
617 Ga0436361_0976385
618 Ga0436361_1047903
619 Ga0436361_1071742
620 Ga0436363_0881878
621 Ga0436363_1446865
622 Ga0436362_0068264
623 Ga0436362_0205798
624 Ga0436362_0227767
625 Ga0436362_0543152
626 Ga0436362_0563719
627 Ga0436362_0789957
628 Ga0436362_0819299
629 Ga0436362_0896623
630 Ga0436362_1294551
631 Ga0450923_023851
632 Ga0439459_0077177
633 Ga0451577_0003656
634 Ga0451577_0016422
635 Ga0451577_0150666
636 Ga0451577_0594381
637 Ga0453683_0002238
638 Ga0453683_0012515
639 Ga0453683_0051332
640 Ga0453683_0051956
641 Ga0453683_0128207
642 Ga0453683_0165046
643 Ga0453683_0335452
644 Ga0453684_0002905
645 Ga0453684_0004574
646 Ga0453684_0007412
647 Ga0453684_0009456
648 Ga0453684_0021631
649 Ga0453684_0029446
650 Ga0453684_0046265
651 Ga0453684_0061035
652 Ga0453684_0061849
653 Ga0453684_0067052
654 Ga0453684_0095126
655 Ga0453684_0115374
656 Ga0453684_0164105
657 Ga0453684_0202293
658 Ga0453684_0221230
659 Ga0453684_0222348
660 Ga0453684_0310187
661 Ga0453684_0363076
662 Ga0453684_0467208
663 Ga0453684_0561854
664 Ga0453684_0643080
665 Ga0453684_0815837
666 Ga0453684_0944219
667 Ga0453684_1022372
668 Ga0466957_0331761
669 Ga0451576_0011013
670 Ga0451576_0011617
671 Ga0451576_0043649
672 Ga0451576_0066447
673 Ga0451576_0115427
674 Ga0451576_0158506
675 Ga0451576_0189907
676 Ga0451576_0500233
677 Ga0451576_0591682
678 Ga0466967_1822810
679 Ga0495642_0266450
680 Ga0495633_0189439
681 Ga0495647_0202551
682 Ga0495589_0272867
683 Ga0496106_0181921
684 Ga0496111_0541706
685 Ga0501031_0534284
686 Ga0501039_0106043
687 Ga0501040_0352816
688 Ga0501041_0357150
689 Ga0501048_0232658
690 Ga0501071_0222390
691 Ga0501071_0251006
692 Ga0501072_0362868
693 Ga0501075_0104326
694 Ga0501075_0212113
695 Ga0501075_0490653
696 Ga0501076_0013865
697 Ga0501076_0121220
698 Ga0501076_0124538
699 Ga0501076_0384784
700 Ga0501076_0658829
701 Ga0501077_0203685
702 Ga0501207_031854
703 Ga0501079_0023971
704 Ga0501080_0142877
705 Ga0501080_0345122
706 Ga0501081_0144011
707 Ga0501083_0169164
708 nmdc:mga05p37_103467_c1
709 nmdc:mga05p37_18425_c1
710 nmdc:mga05p37_219371_c1
711 nmdc:mga05p37_22072_c1
712 nmdc:mga05p37_50766_c1
713 nmdc:mga05p37_568072_c1
714 nmdc:mga05p37_76852_c1
715 nmdc:mga09592_104301_c1
716 nmdc:mga09592_1856_c1
717 nmdc:mga09592_323077_c1
718 nmdc:mga09592_767872_c1
719 nmdc:mga0qj67_302045_c1
720 nmdc:mga06r32_218867_c1
721 nmdc:mga06r32_219458_c1
722 nmdc:mga06r32_451323_c1
723 nmdc:mga0a205_208400_c1
724 nmdc:mga0a205_466606_c1
725 nmdc:mga0a205_79942_c2
726 Ga0495619_0134423
727 Ga0587073_0067204
728 Ga0587082_031725
729 Ga0587086_025732
730 Ga0587114_054427
731 Ga0587071_056161
732 Ga0501082_0463812
733 Ga0466962_0241867
734 Ga0530510_0127566
735 Ga0530510_0387628
736 Ga0530510_0543283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01726

LexA_DNA_bind

LexA DNA binding domain

23

87

0.97

PF00717

Peptidase_S24

Peptidase S24-like

103

232

0.89

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

26

79

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v4j-assembly1.cif.gz_F the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration 0.9651 27 58
1jhf-assembly1.cif.gz_B lexa g85d mutant 0.9327 149 237
8gmt-assembly1.cif.gz_A structure of umud in complex with reca filament 0.9173 148 236
1ay9-assembly1.cif.gz_A wild-type umud' from e. coli 0.9166 148 239
1lea-assembly1.cif.gz_A solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy 0.9152 24 91
ID Description Score Start End Superfamily
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9659 26 58 1.10.10.370
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9543 26 59 1.10.10.370
1jhhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9497 25 90 1.10.10.10
3jspB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9425 25 90 1.10.10.10
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9412 26 90 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5SKC3-F1-model_v4 Repressor LexA 0.992 24 91 GO:0004252
GO:0006508
AF-A0A1G9AK63-F1-model_v4 LexA DNA binding domain-containing protein 0.9881 26 91 GO:0004252
GO:0006508
AF-A0A0E2HGY1-F1-model_v4 LexA repressor DNA-binding domain-containing protein 0.9838 26 92 GO:0004252
GO:0006508
AF-X1HPV3-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9811 146 239 GO:0003677
GO:0006281
GO:0006355
GO:0009432
GO:0016787
AF-U1X8K5-F1-model_v4 LexA DNA binding domain protein 0.9749 24 91 GO:0004252
GO:0006508

Map