F424435

General Info

Members Datasets Scaffolds Average Seq Length
367 204 365 214

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0003696|Ga0453684_0003696_26512_27279
Length 255
Sequence VIFAQGQGAEEEHGGVAGLRRTRDYEGNAEIEQKVRFQGGRMKFFIDTADVKEIKAAHELGLVDGVTTNPSLIAKSGRKFKDVIKEIVAIVDGPISAEVISLDAPGMIKEAKELAKIHKNIVVKVPMTPEGLKATKALTAMKIKTNVTLIFTPMQALLAAKAGATYVSPFVGRLDDISQDGMGIIEEIRTIFDNYGYTSEIIVASIRNPVHVLNSALIGADIATIPYSVMLQLSKHPLTDAGIKKFLEDWEKVPK

Samples

Sample ID Description Type Environment
1 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
111 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
135 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
136 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
172 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
185 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
186 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.09
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 0.82
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_10017081 3300004798 Bacteria 779
2 Ga0065707_10088710 3300005295 Bacteria 4574
3 Ga0070690_100004270 3300005330 Bacteria 7919
4 Ga0070690_100561217 3300005330 Bacteria 862
5 Ga0068869_100279904 3300005334 Bacteria 1341
6 Ga0070666_10001474 3300005335 Bacteria 14280
7 Ga0068868_100858683 3300005338 Bacteria 822
8 Ga0070689_100047345 3300005340 Bacteria 3316
9 Ga0070689_100304126 3300005340 Bacteria 1328
10 Ga0070689_100768378 3300005340 Bacteria 845
11 Ga0070687_100099286 3300005343 Bacteria 1627
12 Ga0070687_100147192 3300005343 Bacteria 1378
13 Ga0070692_10258281 3300005345 Bacteria 1046
14 Ga0070692_10314304 3300005345 Bacteria 961
15 Ga0070669_100013188 3300005353 Bacteria 5875
16 Ga0070701_10076279 3300005438 Bacteria 1804
17 Ga0070711_100012534 3300005439 Bacteria 5299
18 Ga0070700_100311528 3300005441 Bacteria 1153
19 Ga0070708_100004596 3300005445 Bacteria 10865
20 Ga0070708_100006969 3300005445 Bacteria 9019
21 Ga0070678_100101828 3300005456 Bacteria 2227
22 Ga0070685_10101342 3300005466 Bacteria 1759
23 Ga0070685_10202561 3300005466 Bacteria 1291
24 Ga0070706_100000079 3300005467 Bacteria 111752
25 Ga0070706_100001127 3300005467 Bacteria 28901
26 Ga0070706_100003680 3300005467 Bacteria 15004
27 Ga0070706_100015210 3300005467 Bacteria 7105
28 Ga0070707_100026149 3300005468 Bacteria 5539
29 Ga0070707_100178062 3300005468 Bacteria 2073
30 Ga0070698_100001339 3300005471 Bacteria 27414
31 Ga0070699_100019915 3300005518 Bacteria 5783
32 Ga0070679_100161522 3300005530 Bacteria 2215
33 Ga0070679_100191130 3300005530 Bacteria 2016
34 Ga0070697_100003825 3300005536 Bacteria 11562
35 Ga0070686_100045006 3300005544 Bacteria 2778
36 Ga0070695_100337056 3300005545 Bacteria 1126
37 Ga0070696_100466510 3300005546 Bacteria 999
38 Ga0070665_100009284 3300005548 Bacteria 9956
39 Ga0070704_100918404 3300005549 Bacteria 788
40 Ga0070704_100933009 3300005549 Bacteria 782
41 Ga0068855_100068461 3300005563 Bacteria 4133
42 Ga0068855_100513270 3300005563 Bacteria 1301
43 Ga0068857_100210540 3300005577 Bacteria 1774
44 Ga0070702_100459847 3300005615 Bacteria 925
45 Ga0068852_100214485 3300005616 Bacteria 1828
46 Ga0068859_100013107 3300005617 Bacteria 8330
47 Ga0068859_100059119 3300005617 Bacteria 3862
48 Ga0068859_100092890 3300005617 Bacteria 3069
49 Ga0068859_100404294 3300005617 Bacteria 1461
50 Ga0068864_100290898 3300005618 Bacteria 1527
51 Ga0068861_100364104 3300005719 Bacteria 1272
52 Ga0068870_10444800 3300005840 Bacteria 853
53 Ga0068858_100750268 3300005842 Bacteria 951
54 Ga0068860_100063200 3300005843 Bacteria 3517
55 Ga0068860_101020105 3300005843 Bacteria 846
56 Ga0068862_101347857 3300005844 Bacteria 716
57 Ga0081455_10034226 3300005937 Bacteria 4554
58 Ga0070717_10038919 3300006028 Bacteria 3866
59 Ga0097621_100534928 3300006237 Bacteria 1065
60 Ga0075428_100001167 3300006844 Bacteria 28143
61 Ga0075428_100073312 3300006844 Bacteria 3739
62 Ga0075428_100131084 3300006844 Bacteria 2727
63 Ga0075428_100520782 3300006844 Bacteria 1272
64 Ga0075430_100059984 3300006846 Bacteria 3197
65 Ga0075431_100049316 3300006847 Bacteria 4341
66 Ga0075431_100149676 3300006847 Bacteria 2404
67 Ga0075433_10066704 3300006852 Bacteria 3158
68 Ga0075434_100004036 3300006871 Bacteria 13163
69 Ga0075434_100777167 3300006871 Bacteria 974
70 Ga0075429_100050796 3300006880 Bacteria 3608
71 Ga0075429_100587330 3300006880 Bacteria 976
72 Ga0075436_100149012 3300006914 Bacteria 1645
73 Ga0075436_100340202 3300006914 Bacteria 1080
74 Ga0097620_100013106 3300006931 Bacteria 8330
75 Ga0097620_100059119 3300006931 Bacteria 3862
76 Ga0097620_100092888 3300006931 Bacteria 3069
77 Ga0097620_100404302 3300006931 Bacteria 1461
78 Ga0075435_100173104 3300007076 Bacteria 1822
79 Ga0075435_100205064 3300007076 Unclassified 1671
80 Ga0075435_100567027 3300007076 Bacteria 984
81 Ga0099794_10000186 3300007265 Bacteria 22688
82 Ga0105240_10010025 3300009093 Bacteria 13345
83 Ga0111539_10033817 3300009094 Bacteria 6204
84 Ga0111539_11213465 3300009094 Bacteria 876
85 Ga0105245_10000825 3300009098 Bacteria 28254
86 Ga0114129_10703560 3300009147 Bacteria 1298
87 Ga0114129_11248931 3300009147 Bacteria 923
88 Ga0105241_10099941 3300009174 Bacteria 2305
89 Ga0105241_10575667 3300009174 Bacteria 1014
90 Ga0105248_10059733 3300009177 Bacteria 4283
91 Ga0105248_10236803 3300009177 Bacteria 2055
92 Ga0105249_10083800 3300009553 Bacteria 2968
93 Ga0105249_10477849 3300009553 Bacteria 1289
94 Ga0105249_11005336 3300009553 Bacteria 903
95 Ga0157371_10413789 3300013102 Bacteria 988
96 Ga0157374_10014880 3300013296 Bacteria 6817
97 Ga0157374_10608904 3300013296 Bacteria 1103
98 Ga0157374_10823067 3300013296 Bacteria 945
99 Ga0157380_10092977 3300014326 Bacteria 2493
100 Ga0157377_10125460 3300014745 Bacteria 1561
101 Ga0157379_10218121 3300014968 Unclassified 1728
102 Ga0157379_10302309 3300014968 Bacteria 1458
103 Ga0157376_10031611 3300014969 Bacteria 4242
104 Ga0207680_10001239 3300025903 Bacteria 12063
105 Ga0207705_10306734 3300025909 Bacteria 1218
106 Ga0207684_10000068 3300025910 Bacteria 191048
107 Ga0207684_10036083 3300025910 Bacteria 4197
108 Ga0207684_10065013 3300025910 Bacteria 3097
109 Ga0207695_10036520 3300025913 Bacteria 5311
110 Ga0207693_10187317 3300025915 Bacteria 1629
111 Ga0207663_10042346 3300025916 Bacteria 2781
112 Ga0207662_10035959 3300025918 Bacteria 2894
113 Ga0207662_10377176 3300025918 Bacteria 957
114 Ga0207652_10405345 3300025921 Bacteria 1230
115 Ga0207646_10405877 3300025922 Bacteria 1230
116 Ga0207646_10452886 3300025922 Bacteria 1158
117 Ga0207646_10769587 3300025922 Bacteria 858
118 Ga0207681_10080838 3300025923 Bacteria 2293
119 Ga0207687_10000150 3300025927 Bacteria 46698
120 Ga0207687_10543342 3300025927 Bacteria 974
121 Ga0207687_10910294 3300025927 Bacteria 753
122 Ga0207706_10230260 3300025933 Bacteria 1621
123 Ga0207670_10004880 3300025936 Bacteria 7292
124 Ga0207670_10011973 3300025936 Bacteria 5055
125 Ga0207670_10029901 3300025936 Bacteria 3474
126 Ga0207670_10155981 3300025936 Bacteria 1699
127 Ga0207711_10311299 3300025941 Unclassified 1454
128 Ga0207689_10169088 3300025942 Bacteria 1801
129 Ga0207679_10877424 3300025945 Bacteria 820
130 Ga0207667_10282005 3300025949 Bacteria 1698
131 Ga0207712_10084766 3300025961 Bacteria 2316
132 Ga0207712_10307551 3300025961 Bacteria 1303
133 Ga0207703_10379433 3300026035 Unclassified 1307
134 Ga0207708_10143122 3300026075 Bacteria 1877
135 Ga0207708_10272493 3300026075 Bacteria 1369
136 Ga0207676_10206953 3300026095 Bacteria 1738
137 Ga0207675_100143797 3300026118 Bacteria 2267
138 Ga0207683_10001829 3300026121 Bacteria 18792
139 Ga0209588_1000023 3300027671 Bacteria 91412
140 Ga0268266_10027073 3300028379 Bacteria 4878
141 Ga0268266_10690685 3300028379 Bacteria 983
142 Ga0265318_10016584 3300028577 Bacteria 3042
143 Ga0265323_10036043 3300028653 Bacteria 1821
144 Ga0307515_10006859 3300028794 Bacteria 22653
145 Ga0307515_10375341 3300028794 Bacteria 1057
146 Ga0307511_10100537 3300030521 Bacteria 1902
147 Ga0265339_10018153 3300031249 Bacteria 4152
148 Ga0265331_10009141 3300031250 Bacteria 5592
149 Ga0265327_10023766 3300031251 Bacteria 3619
150 Ga0265327_10078616 3300031251 Bacteria 1634
151 Ga0265327_10090423 3300031251 Bacteria 1494
152 Ga0265316_10008029 3300031344 Bacteria 9850
153 Ga0265316_10178050 3300031344 Bacteria 1584
154 Ga0265316_10233538 3300031344 Bacteria 1354
155 Ga0265316_10286212 3300031344 Bacteria 1204
156 Ga0265316_10547778 3300031344 Unclassified 824
157 Ga0307513_10024259 3300031456 Bacteria 7058
158 Ga0307509_10001760 3300031507 Bacteria 35987
159 Ga0307509_10045639 3300031507 Bacteria 4723
160 Ga0307509_10067210 3300031507 Bacteria 3756
161 Ga0307509_10076060 3300031507 Bacteria 3485
162 Ga0307509_10544704 3300031507 Bacteria 839
163 Ga0307508_10237133 3300031616 Bacteria 1422
164 Ga0307508_10249977 3300031616 Bacteria 1369
165 Ga0316579_10003454 3300031691 Bacteria 6159
166 Ga0265342_10027509 3300031712 Bacteria 3552
167 Ga0316576_10086033 3300031727 Bacteria 2337
168 Ga0316576_10219345 3300031727 Unclassified 1431
169 Ga0316578_10037686 3300031728 Bacteria 2785
170 Ga0316578_10072390 3300031728 Bacteria 2041
171 Ga0316578_10082050 3300031728 Bacteria 1919
172 Ga0316577_10023622 3300031733 Bacteria 3413
173 Ga0316577_10061562 3300031733 Bacteria 2095
174 Ga0307406_10039967 3300031901 Bacteria 2913
175 Ga0307412_10233400 3300031911 Bacteria 1418
176 Ga0307415_100385086 3300032126 Bacteria 1192
177 Ga0316585_10115001 3300032137 Bacteria 884
178 Ga0316580_10085164 3300032139 Bacteria 967
179 Ga0307507_10214700 3300033179 Bacteria 1305
180 Ga0316586_1041917 3300033527 Bacteria 806
181 Ga0316587_1010501 3300033529 Bacteria 1482
182 Ga0316596_1013512 3300033541 Bacteria 2018
183 Ga0373928_0011534 3300035084 Bacteria 1750
184 Ga0373949_0002008 3300035090 Bacteria 5429
185 Ga0373951_0008060 3300035091 Bacteria 2388
186 Ga0373953_0059945 3300035117 Unclassified 1554
187 Ga0373954_0076329 3300035118 Bacteria 1597
188 Ga0373956_0106734 3300035119 Unclassified 1302
189 Ga0373956_0167938 3300035119 Bacteria 1035
190 Ga0373956_0207698 3300035119 Bacteria 929
191 Ga0373957_0067691 3300035120 Unclassified 1392
192 Ga0373955_0036502 3300035172 Bacteria 2608
193 Ga0373961_0000048 3300035241 Bacteria 71420
194 Ga0316574_0091841 3300035398 Bacteria 1936
195 Ga0316574_0221594 3300035398 Unclassified 1212
196 Ga0373947_0472989 3300035725 Unclassified 850
197 Ga0373937_0000895 3300036401 Bacteria 25507
198 Ga0373937_0290406 3300036401 Bacteria 1545
199 Ga0373937_0407093 3300036401 Bacteria 1291
200 Ga0373937_0663911 3300036401 Bacteria 988
201 Ga0316582_0005006 3300036647 Bacteria 6775
202 Ga0316582_0042532 3300036647 Bacteria 2846
203 Ga0316584_0001136 3300036712 Bacteria 15631
204 Ga0316584_0012930 3300036712 Bacteria 5896
205 Ga0316584_0319488 3300036712 Bacteria 1120
206 Ga0395899_0538558 3300037312 Bacteria 752
207 Ga0395898_0262963 3300037466 Bacteria 1646
208 Ga0395905_0127126 3300037471 Bacteria 2397
209 Ga0395901_0881861 3300038443 Unclassified 878
210 Ga0395901_1319082 3300038443 Bacteria 683
211 Ga0400489_62341 3300039093 Unclassified 1275
212 Ga0400489_95090 3300039093 Bacteria 2912
213 Ga0439447_076469 3300041407 Bacteria 775
214 Ga0451835_1203830 3300041492 Bacteria 826
215 Ga0450898_019305 3300042134 Bacteria 1187
216 Ga0451577_0000081 3300042876 Bacteria 216944
217 Ga0451577_0000470 3300042876 Bacteria 69538
218 Ga0451577_0001530 3300042876 Bacteria 30370
219 Ga0451577_0001901 3300042876 Bacteria 26497
220 Ga0451577_0001964 3300042876 Bacteria 25873
221 Ga0451577_0007828 3300042876 Bacteria 10453
222 Ga0451577_0009905 3300042876 Bacteria 9134
223 Ga0451577_0028430 3300042876 Bacteria 5057
224 Ga0451577_0036849 3300042876 Bacteria 4403
225 Ga0451577_0088586 3300042876 Bacteria 2761
226 Ga0451577_0116902 3300042876 Bacteria 2389
227 Ga0451577_0246128 3300042876 Bacteria 1618
228 Ga0451577_0456927 3300042876 Unclassified 1160
229 Ga0451577_0471840 3300042876 Bacteria 1139
230 Ga0451577_0597541 3300042876 Bacteria 1001
231 Ga0451577_0742159 3300042876 Bacteria 888
232 Ga0466972_0056682 3300044658 Bacteria 1884
233 Ga0453683_0000002 3300044673 Bacteria 1244396
234 Ga0453683_0000063 3300044673 Bacteria 175298
235 Ga0453683_0000379 3300044673 Bacteria 53272
236 Ga0453683_0000393 3300044673 Bacteria 52084
237 Ga0453683_0000696 3300044673 Bacteria 35148
238 Ga0453683_0005377 3300044673 Bacteria 8947
239 Ga0453683_0006420 3300044673 Bacteria 8067
240 Ga0453683_0010239 3300044673 Bacteria 6221
241 Ga0453683_0013181 3300044673 Bacteria 5404
242 Ga0453683_0019814 3300044673 Bacteria 4304
243 Ga0453683_0066425 3300044673 Bacteria 2254
244 Ga0453683_0071173 3300044673 Bacteria 2175
245 Ga0453683_0146684 3300044673 Bacteria 1490
246 Ga0453684_0000140 3300044712 Bacteria 319864
247 Ga0453684_0000756 3300044712 Bacteria 112323
248 Ga0453684_0000765 3300044712 Bacteria 111511
249 Ga0453684_0001111 3300044712 Bacteria 84488
250 Ga0453684_0001176 3300044712 Bacteria 81199
251 Ga0453684_0001403 3300044712 Bacteria 69539
252 Ga0453684_0001778 3300044712 Bacteria 57535
253 Ga0453684_0002093 3300044712 Bacteria 50497
254 Ga0453684_0003696 3300044712 Bacteria 33900
255 Ga0453684_0014131 3300044712 Bacteria 12835
256 Ga0453684_0029917 3300044712 Bacteria 7713
257 Ga0453684_0033815 3300044712 Bacteria 7113
258 Ga0453684_0035379 3300044712 Bacteria 6904
259 Ga0453684_0047417 3300044712 Bacteria 5699
260 Ga0453684_0123095 3300044712 Bacteria 3128
261 Ga0453684_0171548 3300044712 Unclassified 2556
262 Ga0453684_0206883 3300044712 Bacteria 2283
263 Ga0453684_0226357 3300044712 Bacteria 2162
264 Ga0453684_0226824 3300044712 Bacteria 2160
265 Ga0453684_0253621 3300044712 Bacteria 2019
266 Ga0453684_0308381 3300044712 Bacteria 1797
267 Ga0453684_0403076 3300044712 Bacteria 1531
268 Ga0453684_0558089 3300044712 Bacteria 1261
269 Ga0453684_0979350 3300044712 Bacteria 901
270 Ga0453684_1131480 3300044712 Bacteria 825
271 Ga0453684_1235508 3300044712 Bacteria 782
272 Ga0451576_0000138 3300045051 Bacteria 185167
273 Ga0451576_0000462 3300045051 Bacteria 91935
274 Ga0451576_0010281 3300045051 Bacteria 10748
275 Ga0451576_0012241 3300045051 Bacteria 9661
276 Ga0451576_0022544 3300045051 Bacteria 6826
277 Ga0451576_0209437 3300045051 Bacteria 2036
278 Ga0451576_0257103 3300045051 Bacteria 1825
279 Ga0451576_0285119 3300045051 Bacteria 1727
280 Ga0451576_0309351 3300045051 Bacteria 1653
281 Ga0451576_0352002 3300045051 Bacteria 1542
282 Ga0495603_0045349 3300046455 Bacteria 2622
283 Ga0495629_0000103 3300046459 Bacteria 75051
284 Ga0495629_0105977 3300046459 Bacteria 1961
285 Ga0495582_0005364 3300046473 Bacteria 7153
286 Ga0495639_0007134 3300046475 Bacteria 4798
287 Ga0495594_0015330 3300046499 Bacteria 4025
288 Ga0495594_0102024 3300046499 Bacteria 1614
289 Ga0495628_0353765 3300046516 Unclassified 1079
290 Ga0495640_0405195 3300046533 Bacteria 837
291 Ga0495586_0330915 3300046535 Bacteria 874
292 Ga0495586_0390689 3300046535 Unclassified 800
293 Ga0495587_0236952 3300046536 Unclassified 1027
294 Ga0495645_0435197 3300046543 Bacteria 830
295 Ga0495622_0023364 3300046557 Bacteria 2882
296 Ga0495667_0310963 3300046559 Archaea 998
297 Ga0495634_0035342 3300046642 Bacteria 3423
298 Ga0495635_0007222 3300046663 Bacteria 7763
299 Ga0495623_0093069 3300046679 Bacteria 1846
300 Ga0495623_0212142 3300046679 Bacteria 1108
301 Ga0495658_0000049 3300046683 Bacteria 59430
302 Ga0495613_0005747 3300046689 Bacteria 9290
303 Ga0495581_0000612 3300047315 Bacteria 18718
304 Ga0495604_0196311 3300047317 Bacteria 1403
305 Ga0495676_0215909 3300047321 Bacteria 1324
306 Ga0495680_0009377 3300047322 Bacteria 8806
307 Ga0495680_0082489 3300047322 Bacteria 2426
308 Ga0495680_0296436 3300047322 Bacteria 1136
309 Ga0495675_0501486 3300047444 Bacteria 697
310 Ga0495684_0398986 3300047471 Bacteria 966
311 Ga0495686_0001672 3300047472 Bacteria 23056
312 Ga0495686_0090612 3300047472 Bacteria 1857
313 Ga0495593_0221163 3300047673 Bacteria 950
314 Ga0496100_0274758 3300048903 Bacteria 1254
315 Ga0496109_0353011 3300048912 Bacteria 1389
316 Ga0496110_0039028 3300048913 Bacteria 4134
317 Ga0501292_006533 3300049515 Bacteria 1660
318 Ga0501299_011010 3300049522 Bacteria 1520
319 Ga0501034_0014618 3300049571 Bacteria 8083
320 Ga0501034_0512919 3300049571 Bacteria 1111
321 Ga0501043_0282819 3300049579 Bacteria 1271
322 Ga0501043_0300621 3300049579 Bacteria 1226
323 Ga0501047_0033150 3300049581 Bacteria 4986
324 Ga0501069_0229489 3300049585 Bacteria 1080
325 Ga0501069_0303440 3300049585 Bacteria 937
326 Ga0501070_0038297 3300049586 Bacteria 4000
327 Ga0501070_0246038 3300049586 Bacteria 1463
328 Ga0501070_0919862 3300049586 Bacteria 681
329 Ga0501071_0089669 3300049587 Bacteria 2257
330 Ga0501072_0193085 3300049588 Bacteria 1624
331 Ga0501073_0016037 3300049589 Bacteria 5431
332 Ga0501073_0164665 3300049589 Bacteria 1536
333 Ga0501216_020207 3300049660 Bacteria 1161
334 Ga0501217_066074 3300049661 Bacteria 976
335 Ga0501227_000033 3300049665 Bacteria 20089
336 Ga0501233_001776 3300049668 Bacteria 3727
337 Ga0501236_034584 3300049670 Bacteria 814
338 Ga0501229_003979 3300049706 Bacteria 1788
339 Ga0501044_0025834 3300049823 Bacteria 6225
340 nmdc:mga05p37_834566_c1 3300050507 Bacteria 1003
341 nmdc:mga09592_149890_c1 3300050508 Bacteria 2012
342 nmdc:mga09592_5327_c1 3300050508 Bacteria 10456
343 nmdc:mga0qj67_529432_c1 3300050509 Bacteria 946
344 nmdc:mga0qj67_613041_c1 3300050509 Bacteria 870
345 nmdc:mga06r32_133842_c1 3300050510 Bacteria 2453
346 nmdc:mga06r32_54064_c1 3300050510 Bacteria 3850
347 nmdc:mga08y16_19418_c1 3300050511 Bacteria 7165
348 nmdc:mga0n895_25962_c1 3300050512 Bacteria 5540
349 nmdc:mga0rr50_14021_c1 3300050513 Bacteria 5240
350 nmdc:mga0rr50_35651_c1 3300050513 Bacteria 3574
351 nmdc:mga0rr50_715339_c1 3300050513 Bacteria 855
352 nmdc:mga08x19_77185_c1 3300050514 Bacteria 2181
353 nmdc:mga0a205_31363_c1 3300050515 Bacteria 5092
354 Ga0495619_0004145 3300053085 Bacteria 9262
355 Ga0495619_0010662 3300053085 Bacteria 5785
356 Ga0500583_0073316 3300053092 Bacteria 1641
357 Ga0500642_0003248 3300053130 Bacteria 4885
358 Ga0500642_0014595 3300053130 Bacteria 2927
359 Ga0500568_0003953 3300053139 Bacteria 8067
360 Ga0500568_0010037 3300053139 Bacteria 4463
361 Ga0500573_0144242 3300053140 Bacteria 1309
362 Ga0500636_0211104 3300053177 Bacteria 1019
363 Ga0501084_0447848 3300054114 Bacteria 1092
364 Ga0501082_0044869 3300060353 Bacteria 3813
365 Ga0501082_0061975 3300060353 Bacteria 3219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10543342 Ga0207687_105433422 179
2 3300048912 Ga0496109_0353011 Ga0496109_0353011_16_579 183
3 3300005467 Ga0070706_100001127 Ga0070706_1000011275 184
4 3300031727 Ga0316576_10219345 Ga0316576_102193452 190
5 3300005445 Ga0070708_100006969 Ga0070708_1000069693 205
6 3300005467 Ga0070706_100003680 Ga0070706_10000368010 205
7 3300005468 Ga0070707_100178062 Ga0070707_1001780622 205
8 3300005546 Ga0070696_100466510 Ga0070696_1004665102 205
9 3300006914 Ga0075436_100149012 Ga0075436_1001490122 205
10 3300007076 Ga0075435_100205064 Ga0075435_1002050641 205
11 3300009174 Ga0105241_10099941 Ga0105241_100999413 205
12 3300025910 Ga0207684_10065013 Ga0207684_100650132 205
13 3300025922 Ga0207646_10405877 Ga0207646_104058772 205
14 3300028379 Ga0268266_10690685 Ga0268266_106906852 205
15 3300031249 Ga0265339_10018153 Ga0265339_100181532 205
16 3300031250 Ga0265331_10009141 Ga0265331_100091414 205
17 3300031344 Ga0265316_10008029 Ga0265316_100080299 205
18 3300031712 Ga0265342_10027509 Ga0265342_100275092 205
19 3300035119 Ga0373956_0167938 Ga0373956_0167938_187_810 205
20 3300038443 Ga0395901_0881861 Ga0395901_0881861_204_827 205
21 3300046459 Ga0495629_0105977 Ga0495629_0105977_364_987 205
22 3300046533 Ga0495640_0405195 Ga0495640_0405195_51_674 205
23 3300046679 Ga0495623_0212142 Ga0495623_0212142_221_844 205
24 3300047317 Ga0495604_0196311 Ga0495604_0196311_404_1027 205
25 3300047322 Ga0495680_0296436 Ga0495680_0296436_23_646 205
26 3300047471 Ga0495684_0398986 Ga0495684_0398986_251_874 205
27 3300047673 Ga0495593_0221163 Ga0495593_0221163_128_751 205
28 3300050513 nmdc:mga0rr50_35651_c1 nmdc:mga0rr50_35651_c1_935_1558 205
29 3300050514 nmdc:mga08x19_77185_c1 nmdc:mga08x19_77185_c1_1531_2154 205
30 3300053085 Ga0495619_0010662 Ga0495619_0010662_4661_5284 205
31 3300049571 Ga0501034_0512919 Ga0501034_0512919_435_1091 206
32 3300049579 Ga0501043_0282819 Ga0501043_0282819_33_689 206
33 3300049581 Ga0501047_0033150 Ga0501047_0033150_3919_4575 206
34 3300042876 Ga0451577_0001964 Ga0451577_0001964_15625_16269 208
35 3300044712 Ga0453684_0000756 Ga0453684_0000756_102180_102824 208
36 3300046559 Ga0495667_0310963 Ga0495667_0310963_205_846 210
37 3300046679 Ga0495623_0093069 Ga0495623_0093069_1195_1836 210
38 iso_pu_bacteria 2837678835 2837683202 210
39 3300031733 Ga0316577_10061562 Ga0316577_100615624 213
40 3300033527 Ga0316586_1041917 Ga0316586_10419172 213
41 3300036647 Ga0316582_0042532 Ga0316582_0042532_424_1065 213
42 3300039093 Ga0400489_62341 Ga0400489_62341_110_751 213
43 3300042876 Ga0451577_0000470 Ga0451577_0000470_6441_7082 213
44 3300044712 Ga0453684_0001403 Ga0453684_0001403_62457_63098 213
45 3300004798 Ga0058859_10017081 Ga0058859_100170811 214
46 3300005295 Ga0065707_10088710 Ga0065707_100887104 214
47 3300005330 Ga0070690_100004270 Ga0070690_1000042708 214
48 3300005330 Ga0070690_100561217 Ga0070690_1005612172 214
49 3300005334 Ga0068869_100279904 Ga0068869_1002799042 214
50 3300005335 Ga0070666_10001474 Ga0070666_100014742 214
51 3300005338 Ga0068868_100858683 Ga0068868_1008586831 214
52 3300005340 Ga0070689_100047345 Ga0070689_1000473454 214
53 3300005340 Ga0070689_100304126 Ga0070689_1003041262 214
54 3300005340 Ga0070689_100768378 Ga0070689_1007683781 214
55 3300005343 Ga0070687_100099286 Ga0070687_1000992862 214
56 3300005343 Ga0070687_100147192 Ga0070687_1001471921 214
57 3300005345 Ga0070692_10258281 Ga0070692_102582812 214
58 3300005345 Ga0070692_10314304 Ga0070692_103143042 214
59 3300005353 Ga0070669_100013188 Ga0070669_1000131882 214
60 3300005438 Ga0070701_10076279 Ga0070701_100762792 214
61 3300005439 Ga0070711_100012534 Ga0070711_1000125342 214
62 3300005441 Ga0070700_100311528 Ga0070700_1003115282 214
63 3300005445 Ga0070708_100004596 Ga0070708_10000459610 214
64 3300005456 Ga0070678_100101828 Ga0070678_1001018282 214
65 3300005466 Ga0070685_10101342 Ga0070685_101013421 214
66 3300005466 Ga0070685_10202561 Ga0070685_102025612 214
67 3300005467 Ga0070706_100000079 Ga0070706_10000007913 214
68 3300005467 Ga0070706_100015210 Ga0070706_1000152106 214
69 3300005468 Ga0070707_100026149 Ga0070707_1000261493 214
70 3300005471 Ga0070698_100001339 Ga0070698_1000013397 214
71 3300005518 Ga0070699_100019915 Ga0070699_1000199154 214
72 3300005530 Ga0070679_100161522 Ga0070679_1001615224 214
73 3300005530 Ga0070679_100191130 Ga0070679_1001911302 214
74 3300005536 Ga0070697_100003825 Ga0070697_1000038255 214
75 3300005544 Ga0070686_100045006 Ga0070686_1000450062 214
76 3300005545 Ga0070695_100337056 Ga0070695_1003370562 214
77 3300005548 Ga0070665_100009284 Ga0070665_1000092849 214
78 3300005549 Ga0070704_100918404 Ga0070704_1009184041 214
79 3300005549 Ga0070704_100933009 Ga0070704_1009330091 214
80 3300005563 Ga0068855_100068461 Ga0068855_1000684614 214
81 3300005563 Ga0068855_100513270 Ga0068855_1005132702 214
82 3300005577 Ga0068857_100210540 Ga0068857_1002105402 214
83 3300005615 Ga0070702_100459847 Ga0070702_1004598471 214
84 3300005616 Ga0068852_100214485 Ga0068852_1002144852 214
85 3300005617 Ga0068859_100013107 Ga0068859_1000131072 214
86 3300005617 Ga0068859_100059119 Ga0068859_1000591193 214
87 3300005617 Ga0068859_100092890 Ga0068859_1000928903 214
88 3300005617 Ga0068859_100404294 Ga0068859_1004042942 214
89 3300005618 Ga0068864_100290898 Ga0068864_1002908982 214
90 3300005719 Ga0068861_100364104 Ga0068861_1003641042 214
91 3300005840 Ga0068870_10444800 Ga0068870_104448002 214
92 3300005842 Ga0068858_100750268 Ga0068858_1007502681 214
93 3300005843 Ga0068860_100063200 Ga0068860_1000632002 214
94 3300005843 Ga0068860_101020105 Ga0068860_1010201052 214
95 3300005844 Ga0068862_101347857 Ga0068862_1013478571 214
96 3300005937 Ga0081455_10034226 Ga0081455_100342265 214
97 3300006028 Ga0070717_10038919 Ga0070717_100389197 214
98 3300006237 Ga0097621_100534928 Ga0097621_1005349282 214
99 3300006844 Ga0075428_100001167 Ga0075428_1000011678 214
100 3300006844 Ga0075428_100073312 Ga0075428_1000733122 214
101 3300006844 Ga0075428_100131084 Ga0075428_1001310843 214
102 3300006844 Ga0075428_100520782 Ga0075428_1005207822 214
103 3300006846 Ga0075430_100059984 Ga0075430_1000599842 214
104 3300006847 Ga0075431_100049316 Ga0075431_1000493163 214
105 3300006847 Ga0075431_100149676 Ga0075431_1001496764 214
106 3300006852 Ga0075433_10066704 Ga0075433_100667045 214
107 3300006871 Ga0075434_100004036 Ga0075434_1000040365 214
108 3300006871 Ga0075434_100777167 Ga0075434_1007771672 214
109 3300006880 Ga0075429_100050796 Ga0075429_1000507964 214
110 3300006880 Ga0075429_100587330 Ga0075429_1005873302 214
111 3300006914 Ga0075436_100340202 Ga0075436_1003402022 214
112 3300006931 Ga0097620_100013106 Ga0097620_1000131062 214
113 3300006931 Ga0097620_100059119 Ga0097620_1000591193 214
114 3300006931 Ga0097620_100092888 Ga0097620_1000928882 214
115 3300006931 Ga0097620_100404302 Ga0097620_1004043022 214
116 3300007076 Ga0075435_100173104 Ga0075435_1001731042 214
117 3300007076 Ga0075435_100567027 Ga0075435_1005670272 214
118 3300007265 Ga0099794_10000186 Ga0099794_100001869 214
119 3300009093 Ga0105240_10010025 Ga0105240_100100253 214
120 3300009094 Ga0111539_10033817 Ga0111539_100338173 214
121 3300009094 Ga0111539_11213465 Ga0111539_112134651 214
122 3300009098 Ga0105245_10000825 Ga0105245_1000082529 214
123 3300009098 Ga0105245_10000825 Ga0105245_100008252 214
124 3300009147 Ga0114129_10703560 Ga0114129_107035602 214
125 3300009147 Ga0114129_11248931 Ga0114129_112489311 214
126 3300009174 Ga0105241_10575667 Ga0105241_105756671 214
127 3300009177 Ga0105248_10059733 Ga0105248_100597331 214
128 3300009177 Ga0105248_10236803 Ga0105248_102368033 214
129 3300009553 Ga0105249_10083800 Ga0105249_100838004 214
130 3300009553 Ga0105249_10477849 Ga0105249_104778492 214
131 3300009553 Ga0105249_11005336 Ga0105249_110053361 214
132 3300013102 Ga0157371_10413789 Ga0157371_104137891 214
133 3300013296 Ga0157374_10014880 Ga0157374_100148807 214
134 3300013296 Ga0157374_10608904 Ga0157374_106089042 214
135 3300013296 Ga0157374_10823067 Ga0157374_108230672 214
136 3300014326 Ga0157380_10092977 Ga0157380_100929772 214
137 3300014745 Ga0157377_10125460 Ga0157377_101254602 214
138 3300014968 Ga0157379_10218121 Ga0157379_102181213 214
139 3300014968 Ga0157379_10302309 Ga0157379_103023091 214
140 3300014969 Ga0157376_10031611 Ga0157376_100316115 214
141 3300025903 Ga0207680_10001239 Ga0207680_100012391 214
142 3300025909 Ga0207705_10306734 Ga0207705_103067342 214
143 3300025910 Ga0207684_10000068 Ga0207684_10000068165 214
144 3300025910 Ga0207684_10036083 Ga0207684_100360831 214
145 3300025913 Ga0207695_10036520 Ga0207695_100365203 214
146 3300025915 Ga0207693_10187317 Ga0207693_101873171 214
147 3300025916 Ga0207663_10042346 Ga0207663_100423463 214
148 3300025918 Ga0207662_10035959 Ga0207662_100359594 214
149 3300025918 Ga0207662_10377176 Ga0207662_103771761 214
150 3300025921 Ga0207652_10405345 Ga0207652_104053452 214
151 3300025922 Ga0207646_10452886 Ga0207646_104528861 214
152 3300025922 Ga0207646_10769587 Ga0207646_107695872 214
153 3300025923 Ga0207681_10080838 Ga0207681_100808382 214
154 3300025927 Ga0207687_10000150 Ga0207687_1000015041 214
155 3300025927 Ga0207687_10910294 Ga0207687_109102941 214
156 3300025933 Ga0207706_10230260 Ga0207706_102302602 214
157 3300025936 Ga0207670_10004880 Ga0207670_100048804 214
158 3300025936 Ga0207670_10011973 Ga0207670_100119736 214
159 3300025936 Ga0207670_10029901 Ga0207670_100299014 214
160 3300025936 Ga0207670_10155981 Ga0207670_101559812 214
161 3300025941 Ga0207711_10311299 Ga0207711_103112992 214
162 3300025942 Ga0207689_10169088 Ga0207689_101690882 214
163 3300025945 Ga0207679_10877424 Ga0207679_108774241 214
164 3300025949 Ga0207667_10282005 Ga0207667_102820052 214
165 3300025961 Ga0207712_10084766 Ga0207712_100847662 214
166 3300025961 Ga0207712_10307551 Ga0207712_103075512 214
167 3300026035 Ga0207703_10379433 Ga0207703_103794331 214
168 3300026075 Ga0207708_10143122 Ga0207708_101431222 214
169 3300026075 Ga0207708_10272493 Ga0207708_102724931 214
170 3300026095 Ga0207676_10206953 Ga0207676_102069532 214
171 3300026118 Ga0207675_100143797 Ga0207675_1001437972 214
172 3300026121 Ga0207683_10001829 Ga0207683_100018299 214
173 3300027671 Ga0209588_1000023 Ga0209588_100002312 214
174 3300028379 Ga0268266_10027073 Ga0268266_100270735 214
175 3300028577 Ga0265318_10016584 Ga0265318_100165842 214
176 3300028653 Ga0265323_10036043 Ga0265323_100360432 214
177 3300028794 Ga0307515_10006859 Ga0307515_1000685916 214
178 3300028794 Ga0307515_10375341 Ga0307515_103753411 214
179 3300030521 Ga0307511_10100537 Ga0307511_101005372 214
180 3300031251 Ga0265327_10023766 Ga0265327_100237664 214
181 3300031251 Ga0265327_10078616 Ga0265327_100786161 214
182 3300031251 Ga0265327_10090423 Ga0265327_100904232 214
183 3300031344 Ga0265316_10178050 Ga0265316_101780502 214
184 3300031344 Ga0265316_10233538 Ga0265316_102335381 214
185 3300031344 Ga0265316_10286212 Ga0265316_102862122 214
186 3300031344 Ga0265316_10547778 Ga0265316_105477781 214
187 3300031456 Ga0307513_10024259 Ga0307513_100242596 214
188 3300031507 Ga0307509_10001760 Ga0307509_1000176013 214
189 3300031507 Ga0307509_10045639 Ga0307509_100456394 214
190 3300031507 Ga0307509_10067210 Ga0307509_100672106 214
191 3300031507 Ga0307509_10076060 Ga0307509_100760603 214
192 3300031507 Ga0307509_10544704 Ga0307509_105447041 214
193 3300031616 Ga0307508_10237133 Ga0307508_102371331 214
194 3300031616 Ga0307508_10249977 Ga0307508_102499772 214
195 3300031691 Ga0316579_10003454 Ga0316579_100034543 214
196 3300031727 Ga0316576_10086033 Ga0316576_100860333 214
197 3300031728 Ga0316578_10037686 Ga0316578_100376862 214
198 3300031728 Ga0316578_10072390 Ga0316578_100723904 214
199 3300031728 Ga0316578_10082050 Ga0316578_100820501 214
200 3300031733 Ga0316577_10023622 Ga0316577_100236225 214
201 3300031901 Ga0307406_10039967 Ga0307406_100399673 214
202 3300031911 Ga0307412_10233400 Ga0307412_102334002 214
203 3300032126 Ga0307415_100385086 Ga0307415_1003850862 214
204 3300032137 Ga0316585_10115001 Ga0316585_101150012 214
205 3300032139 Ga0316580_10085164 Ga0316580_100851642 214
206 3300033179 Ga0307507_10214700 Ga0307507_102147003 214
207 3300033529 Ga0316587_1010501 Ga0316587_10105012 214
208 3300033541 Ga0316596_1013512 Ga0316596_10135123 214
209 3300035084 Ga0373928_0011534 Ga0373928_0011534_604_1248 214
210 3300035090 Ga0373949_0002008 Ga0373949_0002008_3488_4132 214
211 3300035091 Ga0373951_0008060 Ga0373951_0008060_811_1458 214
212 3300035117 Ga0373953_0059945 Ga0373953_0059945_557_1210 214
213 3300035118 Ga0373954_0076329 Ga0373954_0076329_466_1110 214
214 3300035119 Ga0373956_0106734 Ga0373956_0106734_482_1135 214
215 3300035119 Ga0373956_0207698 Ga0373956_0207698_163_807 214
216 3300035120 Ga0373957_0067691 Ga0373957_0067691_90_743 214
217 3300035172 Ga0373955_0036502 Ga0373955_0036502_14_667 214
218 3300035241 Ga0373961_0000048 Ga0373961_0000048_3930_4574 214
219 3300035398 Ga0316574_0091841 Ga0316574_0091841_203_853 214
220 3300035398 Ga0316574_0221594 Ga0316574_0221594_517_1170 214
221 3300035725 Ga0373947_0472989 Ga0373947_0472989_67_720 214
222 3300036401 Ga0373937_0000895 Ga0373937_0000895_5930_6583 214
223 3300036401 Ga0373937_0290406 Ga0373937_0290406_584_1228 214
224 3300036401 Ga0373937_0407093 Ga0373937_0407093_373_1017 214
225 3300036401 Ga0373937_0663911 Ga0373937_0663911_192_839 214
226 3300036647 Ga0316582_0005006 Ga0316582_0005006_4874_5524 214
227 3300036712 Ga0316584_0001136 Ga0316584_0001136_1975_2619 214
228 3300036712 Ga0316584_0012930 Ga0316584_0012930_1970_2620 214
229 3300036712 Ga0316584_0319488 Ga0316584_0319488_119_763 214
230 3300037312 Ga0395899_0538558 Ga0395899_0538558_11_655 214
231 3300037466 Ga0395898_0262963 Ga0395898_0262963_660_1304 214
232 3300037471 Ga0395905_0127126 Ga0395905_0127126_544_1188 214
233 3300038443 Ga0395901_1319082 Ga0395901_1319082_29_673 214
234 3300039093 Ga0400489_95090 Ga0400489_95090_1687_2427 214
235 3300041407 Ga0439447_076469 Ga0439447_076469_92_748 214
236 3300041492 Ga0451835_1203830 Ga0451835_1203830_105_755 214
237 3300042134 Ga0450898_019305 Ga0450898_019305_255_911 214
238 3300042876 Ga0451577_0000081 Ga0451577_0000081_31340_31987 214
239 3300042876 Ga0451577_0001530 Ga0451577_0001530_2506_3150 214
240 3300042876 Ga0451577_0001901 Ga0451577_0001901_19017_19661 214
241 3300042876 Ga0451577_0007828 Ga0451577_0007828_5955_6599 214
242 3300042876 Ga0451577_0009905 Ga0451577_0009905_7118_7765 214
243 3300042876 Ga0451577_0028430 Ga0451577_0028430_3908_4555 214
244 3300042876 Ga0451577_0036849 Ga0451577_0036849_1029_1676 214
245 3300042876 Ga0451577_0088586 Ga0451577_0088586_539_1186 214
246 3300042876 Ga0451577_0116902 Ga0451577_0116902_146_790 214
247 3300042876 Ga0451577_0246128 Ga0451577_0246128_947_1591 214
248 3300042876 Ga0451577_0456927 Ga0451577_0456927_98_742 214
249 3300042876 Ga0451577_0471840 Ga0451577_0471840_407_1051 214
250 3300042876 Ga0451577_0597541 Ga0451577_0597541_19_663 214
251 3300042876 Ga0451577_0742159 Ga0451577_0742159_128_775 214
252 3300044658 Ga0466972_0056682 Ga0466972_0056682_730_1386 214
253 3300044673 Ga0453683_0000002 Ga0453683_0000002_1074751_1075395 214
254 3300044673 Ga0453683_0000063 Ga0453683_0000063_168150_168794 214
255 3300044673 Ga0453683_0000379 Ga0453683_0000379_4175_4822 214
256 3300044673 Ga0453683_0000393 Ga0453683_0000393_30780_31424 214
257 3300044673 Ga0453683_0000696 Ga0453683_0000696_19155_19799 214
258 3300044673 Ga0453683_0005377 Ga0453683_0005377_5194_5838 214
259 3300044673 Ga0453683_0006420 Ga0453683_0006420_5473_6117 214
260 3300044673 Ga0453683_0010239 Ga0453683_0010239_5464_6108 214
261 3300044673 Ga0453683_0013181 Ga0453683_0013181_4628_5272 214
262 3300044673 Ga0453683_0019814 Ga0453683_0019814_473_1117 214
263 3300044673 Ga0453683_0066425 Ga0453683_0066425_1373_2020 214
264 3300044673 Ga0453683_0071173 Ga0453683_0071173_721_1368 214
265 3300044673 Ga0453683_0146684 Ga0453683_0146684_706_1350 214
266 3300044712 Ga0453684_0000140 Ga0453684_0000140_111572_112216 214
267 3300044712 Ga0453684_0000765 Ga0453684_0000765_66301_66945 214
268 3300044712 Ga0453684_0001111 Ga0453684_0001111_30292_30936 214
269 3300044712 Ga0453684_0001176 Ga0453684_0001176_79546_80190 214
270 3300044712 Ga0453684_0001778 Ga0453684_0001778_24291_24935 214
271 3300044712 Ga0453684_0002093 Ga0453684_0002093_24802_25455 214
272 3300044712 Ga0453684_0003696 Ga0453684_0003696_26512_27279 214
273 3300044712 Ga0453684_0014131 Ga0453684_0014131_7371_8018 214
274 3300044712 Ga0453684_0029917 Ga0453684_0029917_3361_4005 214
275 3300044712 Ga0453684_0033815 Ga0453684_0033815_1990_2634 214
276 3300044712 Ga0453684_0035379 Ga0453684_0035379_98_766 214
277 3300044712 Ga0453684_0047417 Ga0453684_0047417_3386_4030 214
278 3300044712 Ga0453684_0123095 Ga0453684_0123095_631_1275 214
279 3300044712 Ga0453684_0171548 Ga0453684_0171548_908_1552 214
280 3300044712 Ga0453684_0206883 Ga0453684_0206883_75_719 214
281 3300044712 Ga0453684_0226357 Ga0453684_0226357_1173_1820 214
282 3300044712 Ga0453684_0226824 Ga0453684_0226824_199_852 214
283 3300044712 Ga0453684_0253621 Ga0453684_0253621_689_1342 214
284 3300044712 Ga0453684_0308381 Ga0453684_0308381_115_759 214
285 3300044712 Ga0453684_0403076 Ga0453684_0403076_780_1424 214
286 3300044712 Ga0453684_0558089 Ga0453684_0558089_268_912 214
287 3300044712 Ga0453684_0979350 Ga0453684_0979350_146_790 214
288 3300044712 Ga0453684_1131480 Ga0453684_1131480_50_694 214
289 3300044712 Ga0453684_1235508 Ga0453684_1235508_50_694 214
290 3300045051 Ga0451576_0000138 Ga0451576_0000138_93351_93998 214
291 3300045051 Ga0451576_0000462 Ga0451576_0000462_20075_20719 214
292 3300045051 Ga0451576_0010281 Ga0451576_0010281_2037_2684 214
293 3300045051 Ga0451576_0012241 Ga0451576_0012241_6554_7198 214
294 3300045051 Ga0451576_0022544 Ga0451576_0022544_3797_4441 214
295 3300045051 Ga0451576_0209437 Ga0451576_0209437_878_1522 214
296 3300045051 Ga0451576_0257103 Ga0451576_0257103_913_1557 214
297 3300045051 Ga0451576_0285119 Ga0451576_0285119_289_933 214
298 3300045051 Ga0451576_0309351 Ga0451576_0309351_93_737 214
299 3300045051 Ga0451576_0352002 Ga0451576_0352002_823_1467 214
300 3300046455 Ga0495603_0045349 Ga0495603_0045349_1646_2293 214
301 3300046459 Ga0495629_0000103 Ga0495629_0000103_49246_49893 214
302 3300046473 Ga0495582_0005364 Ga0495582_0005364_3313_3960 214
303 3300046475 Ga0495639_0007134 Ga0495639_0007134_883_1530 214
304 3300046499 Ga0495594_0015330 Ga0495594_0015330_95_742 214
305 3300046499 Ga0495594_0102024 Ga0495594_0102024_141_788 214
306 3300046516 Ga0495628_0353765 Ga0495628_0353765_36_689 214
307 3300046535 Ga0495586_0330915 Ga0495586_0330915_171_818 214
308 3300046535 Ga0495586_0390689 Ga0495586_0390689_130_789 214
309 3300046536 Ga0495587_0236952 Ga0495587_0236952_314_967 214
310 3300046543 Ga0495645_0435197 Ga0495645_0435197_89_745 214
311 3300046557 Ga0495622_0023364 Ga0495622_0023364_1252_1899 214
312 3300046642 Ga0495634_0035342 Ga0495634_0035342_467_1114 214
313 3300046663 Ga0495635_0007222 Ga0495635_0007222_2649_3296 214
314 3300046683 Ga0495658_0000049 Ga0495658_0000049_31447_32094 214
315 3300046689 Ga0495613_0005747 Ga0495613_0005747_4703_5350 214
316 3300047315 Ga0495581_0000612 Ga0495581_0000612_4885_5532 214
317 3300047321 Ga0495676_0215909 Ga0495676_0215909_166_813 214
318 3300047322 Ga0495680_0009377 Ga0495680_0009377_614_1261 214
319 3300047322 Ga0495680_0082489 Ga0495680_0082489_495_1142 214
320 3300047444 Ga0495675_0501486 Ga0495675_0501486_10_657 214
321 3300047472 Ga0495686_0001672 Ga0495686_0001672_47_691 214
322 3300047472 Ga0495686_0090612 Ga0495686_0090612_207_851 214
323 3300048903 Ga0496100_0274758 Ga0496100_0274758_328_972 214
324 3300048913 Ga0496110_0039028 Ga0496110_0039028_2793_3449 214
325 3300049515 Ga0501292_006533 Ga0501292_006533_464_1108 214
326 3300049522 Ga0501299_011010 Ga0501299_011010_429_1073 214
327 3300049571 Ga0501034_0014618 Ga0501034_0014618_2082_2738 214
328 3300049579 Ga0501043_0300621 Ga0501043_0300621_220_864 214
329 3300049585 Ga0501069_0229489 Ga0501069_0229489_94_738 214
330 3300049585 Ga0501069_0303440 Ga0501069_0303440_48_692 214
331 3300049586 Ga0501070_0038297 Ga0501070_0038297_3219_3863 214
332 3300049586 Ga0501070_0246038 Ga0501070_0246038_799_1443 214
333 3300049586 Ga0501070_0919862 Ga0501070_0919862_23_667 214
334 3300049587 Ga0501071_0089669 Ga0501071_0089669_1371_2015 214
335 3300049588 Ga0501072_0193085 Ga0501072_0193085_769_1413 214
336 3300049589 Ga0501073_0016037 Ga0501073_0016037_2539_3204 214
337 3300049589 Ga0501073_0164665 Ga0501073_0164665_375_1019 214
338 3300049660 Ga0501216_020207 Ga0501216_020207_231_875 214
339 3300049661 Ga0501217_066074 Ga0501217_066074_67_711 214
340 3300049665 Ga0501227_000033 Ga0501227_000033_4319_4963 214
341 3300049668 Ga0501233_001776 Ga0501233_001776_1704_2348 214
342 3300049670 Ga0501236_034584 Ga0501236_034584_147_791 214
343 3300049706 Ga0501229_003979 Ga0501229_003979_445_1089 214
344 3300049823 Ga0501044_0025834 Ga0501044_0025834_4627_5271 214
345 3300050507 nmdc:mga05p37_834566_c1 nmdc:mga05p37_834566_c1_242_898 214
346 3300050508 nmdc:mga09592_149890_c1 nmdc:mga09592_149890_c1_546_1190 214
347 3300050508 nmdc:mga09592_5327_c1 nmdc:mga09592_5327_c1_121_765 214
348 3300050509 nmdc:mga0qj67_529432_c1 nmdc:mga0qj67_529432_c1_287_931 214
349 3300050509 nmdc:mga0qj67_613041_c1 nmdc:mga0qj67_613041_c1_140_787 214
350 3300050510 nmdc:mga06r32_133842_c1 nmdc:mga06r32_133842_c1_1174_1818 214
351 3300050510 nmdc:mga06r32_54064_c1 nmdc:mga06r32_54064_c1_949_1596 214
352 3300050511 nmdc:mga08y16_19418_c1 nmdc:mga08y16_19418_c1_3392_4036 214
353 3300050512 nmdc:mga0n895_25962_c1 nmdc:mga0n895_25962_c1_2665_3321 214
354 3300050513 nmdc:mga0rr50_14021_c1 nmdc:mga0rr50_14021_c1_813_1469 214
355 3300050513 nmdc:mga0rr50_715339_c1 nmdc:mga0rr50_715339_c1_168_812 214
356 3300050515 nmdc:mga0a205_31363_c1 nmdc:mga0a205_31363_c1_2827_3483 214
357 3300053085 Ga0495619_0004145 Ga0495619_0004145_6792_7439 214
358 3300053092 Ga0500583_0073316 Ga0500583_0073316_585_1229 214
359 3300053130 Ga0500642_0003248 Ga0500642_0003248_2882_3526 214
360 3300053130 Ga0500642_0014595 Ga0500642_0014595_1877_2521 214
361 3300053139 Ga0500568_0003953 Ga0500568_0003953_1357_2001 214
362 3300053139 Ga0500568_0010037 Ga0500568_0010037_1133_1777 214
363 3300053140 Ga0500573_0144242 Ga0500573_0144242_375_1019 214
364 3300053177 Ga0500636_0211104 Ga0500636_0211104_27_671 214
365 3300054114 Ga0501084_0447848 Ga0501084_0447848_141_785 214
366 3300060353 Ga0501082_0044869 Ga0501082_0044869_84_749 214
367 3300060353 Ga0501082_0061975 Ga0501082_0061975_1645_2289 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

44

255

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpx-assembly1.cif.gz_F crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9905 1 211
1vpx-assembly1.cif.gz_A crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9897 1 211
1vpx-assembly2.cif.gz_L crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9896 1 207
1vpx-assembly1.cif.gz_D crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9893 1 207
1vpx-assembly1.cif.gz_I crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9882 1 211
ID Description Score Start End Superfamily
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9857 1 211 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9765 1 211 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9592 1 210 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9375 1 210 3.20.20.70
af_A0A1L1QZF2_1_286_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9081 1 192 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6I1P4N1-F1-model_v4 deleted 1.005 79 174
AF-A0A4U3BD06-F1-model_v4 deleted 1.002 1 116
AF-A0A3C1YWL9-F1-model_v4 Fructose-6-phosphate aldolase 1.002 109 189 GO:0005975
AF-W1XGA7-F1-model_v4 Putative transaldolase 1 0.9998 99 185 GO:0005975
AF-A0A7V0P3G0-F1-model_v4 Fructose-6-phosphate aldolase 0.9997 72 211 GO:0005975
GO:0016832

Feature Viewer

pLDDT pTM Quality
96.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map