F423743

General Info

Members Datasets Scaffolds Average Seq Length
365 246 365 322

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0049150|Ga0316584_0049150_926_1987
Length 353
Sequence MQAPPADVAKLELGGEDQPAPTRPPMPETSPPNQEALAAAAAGLTALETEIGRAVLGQRQVVRELIVALIAAGHVLLEGLPGVGKTLLVRALARAVGGRYGRIQFTPDLMPADVTGHALFDMKLEEFRIRRGPIFCNLLLGDEINRAPAKTQSAMLEAMQEQQVTIEGKAMPLEPPFLVYATQNPIEQEGTYPLPQAQLDRFLVKVFIDYPAADDEAAVVRQVTTGAAGDQLDLSRVGEVLSPTQVLALQAAATTLIIDDEVLNYAVRLVRATRDWVGIELGAGPRATIALVRAARGQALIDGRGYVLPDDVKTMAPAVLRHRIKLGADLEIEGVAPDDVLAELLASVPAPRG

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
135 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
136 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
148 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
149 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
152 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
156 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 0
Rhizoplane 9.86
Rhizosphere 77.81
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000459 3300002705 Bacteria 24817
2 JGI25154J39366_1002135 3300002738 Bacteria 5531
3 JGI25157J39369_1000021 3300002741 Bacteria 163907
4 Ga0055539_1000588 3300003752 Bacteria 10143
5 Ga0055539_1000994 3300003752 Bacteria 6180
6 Ga0055533_1000033 3300003756 Bacteria 265716
7 Ga0070658_10003240 3300005327 Bacteria 13443
8 Ga0070658_10027568 3300005327 Bacteria 4556
9 Ga0070658_10154567 3300005327 Bacteria 1922
10 Ga0070676_10023215 3300005328 Bacteria 3485
11 Ga0070690_100039685 3300005330 Bacteria 2975
12 Ga0070677_10018207 3300005333 Bacteria 2527
13 Ga0068869_100088609 3300005334 Bacteria 2323
14 Ga0070660_100039293 3300005339 Bacteria 3596
15 Ga0070660_100200264 3300005339 Bacteria 1619
16 Ga0070674_100081622 3300005356 Bacteria 2311
17 Ga0070673_100032257 3300005364 Bacteria 3942
18 Ga0070688_100098029 3300005365 Bacteria 1927
19 Ga0070667_100016738 3300005367 Bacteria 6068
20 Ga0070709_10173113 3300005434 Bacteria 1510
21 Ga0070714_100010300 3300005435 Bacteria 7386
22 Ga0070714_100012161 3300005435 Bacteria 6859
23 Ga0070713_100327006 3300005436 Bacteria 1417
24 Ga0070701_10176087 3300005438 Bacteria 1249
25 Ga0070705_100075413 3300005440 Bacteria 2053
26 Ga0070700_100357345 3300005441 Bacteria 1085
27 Ga0070708_100006721 3300005445 Bacteria 9158
28 Ga0070662_100061006 3300005457 Bacteria 2752
29 Ga0068867_100010019 3300005459 Bacteria 6680
30 Ga0070706_100044502 3300005467 Bacteria 4101
31 Ga0070707_100001447 3300005468 Bacteria 23241
32 Ga0070707_100025501 3300005468 Bacteria 5608
33 Ga0070698_100506962 3300005471 Bacteria 1145
34 Ga0070699_100038399 3300005518 Bacteria 4146
35 Ga0070679_100007164 3300005530 Bacteria 10410
36 Ga0070684_100122914 3300005535 Bacteria 2336
37 Ga0070697_100018133 3300005536 Bacteria 5547
38 Ga0068853_100000321 3300005539 Bacteria 33450
39 Ga0070672_100004791 3300005543 Bacteria 8879
40 Ga0070672_100272719 3300005543 Bacteria 1429
41 Ga0070696_100004547 3300005546 Bacteria 9265
42 Ga0070696_100020422 3300005546 Bacteria 4489
43 Ga0070665_100014189 3300005548 Bacteria 8005
44 Ga0070704_100075750 3300005549 Bacteria 2459
45 Ga0068855_100169570 3300005563 Bacteria 2472
46 Ga0070664_100053868 3300005564 Bacteria 3411
47 Ga0068857_100005113 3300005577 Bacteria 11156
48 Ga0068854_100013303 3300005578 Bacteria 5397
49 Ga0068854_100202877 3300005578 Bacteria 1560
50 Ga0068856_100000887 3300005614 Bacteria 32039
51 Ga0068852_100016406 3300005616 Bacteria 5775
52 Ga0068852_100058794 3300005616 Bacteria 3332
53 Ga0068859_100076709 3300005617 Bacteria 3383
54 Ga0068866_10057259 3300005718 Bacteria 2008
55 Ga0081538_10083408 3300005981 Bacteria 1689
56 Ga0070717_10017832 3300006028 Bacteria 5533
57 Ga0075366_10013680 3300006195 Bacteria 4626
58 Ga0075370_10047691 3300006353 Bacteria 2426
59 Ga0075428_100008315 3300006844 Bacteria 11501
60 Ga0075428_100104589 3300006844 Bacteria 3087
61 Ga0075431_100019389 3300006847 Bacteria 6933
62 Ga0075431_100064854 3300006847 Bacteria 3771
63 Ga0075433_10005244 3300006852 Bacteria 10159
64 Ga0075433_10017064 3300006852 Bacteria 6003
65 Ga0075433_10021765 3300006852 Bacteria 5379
66 Ga0075433_10087046 3300006852 Bacteria 2759
67 Ga0075434_100445535 3300006871 Bacteria 1316
68 Ga0068865_100009864 3300006881 Bacteria 5932
69 Ga0097620_100076708 3300006931 Bacteria 3383
70 Ga0075435_100002574 3300007076 Bacteria 12099
71 Ga0075435_100064810 3300007076 Bacteria 2970
72 Ga0075435_100124730 3300007076 Bacteria 2152
73 Ga0075435_100144778 3300007076 Bacteria 1995
74 Ga0075435_100240339 3300007076 Bacteria 1540
75 Ga0075435_100264118 3300007076 Bacteria 1467
76 Ga0105240_10000859 3300009093 Bacteria 54758
77 Ga0111539_10003396 3300009094 Bacteria 20968
78 Ga0111539_10489802 3300009094 Bacteria 1432
79 Ga0114129_10000435 3300009147 Bacteria 49624
80 Ga0114129_10020007 3300009147 Bacteria 9527
81 Ga0114129_10103613 3300009147 Bacteria 3934
82 Ga0114129_10164430 3300009147 Bacteria 3029
83 Ga0114129_10350168 3300009147 Bacteria 1957
84 Ga0114129_10461316 3300009147 Bacteria 1665
85 Ga0114129_10901674 3300009147 Bacteria 1120
86 Ga0105243_10149402 3300009148 Bacteria 2003
87 Ga0105242_10013814 3300009176 Bacteria 6248
88 Ga0105248_10123450 3300009177 Bacteria 2921
89 Ga0105237_10296261 3300009545 Bacteria 1620
90 Ga0105238_10071954 3300009551 Bacteria 3455
91 Ga0105239_10024610 3300010375 Bacteria 6632
92 Ga0105239_10062145 3300010375 Bacteria 4099
93 Ga0105239_10128767 3300010375 Bacteria 2814
94 Ga0105246_10041642 3300011119 Bacteria 3106
95 Ga0157371_10018112 3300013102 Bacteria 5214
96 Ga0157369_10018857 3300013105 Bacteria 7731
97 Ga0157378_10222614 3300013297 Bacteria 1794
98 Ga0163162_10434065 3300013306 Bacteria 1446
99 Ga0157372_10005220 3300013307 Bacteria 13806
100 Ga0163163_10018201 3300014325 Bacteria 6570
101 Ga0157379_10063964 3300014968 Bacteria 3288
102 Ga0206353_11418429 3300020082 Bacteria 1637
103 Ga0213872_10008160 3300021361 Bacteria 5081
104 Ga0213875_10025720 3300021388 Bacteria 2803
105 Ga0209674_100064 3300025226 Bacteria 265769
106 Ga0209563_100126 3300025230 Bacteria 113122
107 Ga0207427_100197 3300025231 Bacteria 57629
108 Ga0209258_100905 3300025242 Bacteria 15234
109 Ga0209646_1000060 3300025246 Bacteria 256386
110 Ga0209026_1000049 3300025250 Bacteria 255273
111 Ga0209677_100411 3300025253 Bacteria 25661
112 Ga0209677_100792 3300025253 Bacteria 15906
113 Ga0209677_101222 3300025253 Bacteria 11674
114 Ga0209759_1000069 3300025256 Bacteria 182437
115 Ga0209759_1001428 3300025256 Bacteria 13546
116 Ga0209051_1040790 3300025303 Bacteria 1659
117 Ga0207642_10067065 3300025899 Bacteria 1692
118 Ga0207645_10053163 3300025907 Bacteria 2588
119 Ga0207705_10008643 3300025909 Bacteria 7422
120 Ga0207705_10040272 3300025909 Bacteria 3351
121 Ga0207695_10001410 3300025913 Bacteria 40494
122 Ga0207695_10045326 3300025913 Bacteria 4669
123 Ga0207671_10135410 3300025914 Bacteria 1894
124 Ga0207652_10213268 3300025921 Bacteria 1739
125 Ga0207646_10001726 3300025922 Bacteria 26574
126 Ga0207646_10070097 3300025922 Bacteria 3131
127 Ga0207646_10488699 3300025922 Bacteria 1110
128 Ga0207694_10053878 3300025924 Bacteria 3120
129 Ga0207700_10262770 3300025928 Bacteria 1479
130 Ga0207664_10007264 3300025929 Bacteria 7682
131 Ga0207706_10175449 3300025933 Bacteria 1883
132 Ga0207686_10184933 3300025934 Bacteria 1480
133 Ga0207669_10088348 3300025937 Bacteria 2010
134 Ga0207669_10285533 3300025937 Bacteria 1247
135 Ga0207711_10079110 3300025941 Bacteria 2869
136 Ga0207689_10014953 3300025942 Bacteria 6585
137 Ga0207667_10001779 3300025949 Bacteria 27124
138 Ga0207651_10021780 3300025960 Bacteria 3903
139 Ga0207668_10015318 3300025972 Bacteria 4761
140 Ga0207658_10064796 3300025986 Bacteria 2742
141 Ga0207703_10128257 3300026035 Bacteria 2187
142 Ga0207639_10000322 3300026041 Bacteria 33462
143 Ga0207639_10047897 3300026041 Bacteria 3233
144 Ga0207708_10107030 3300026075 Bacteria 2168
145 Ga0207702_10002045 3300026078 Bacteria 19536
146 Ga0207641_10310066 3300026088 Bacteria 1493
147 Ga0207648_10013245 3300026089 Bacteria 7683
148 Ga0207675_100349836 3300026118 Bacteria 1448
149 Ga0207698_10040107 3300026142 Bacteria 3475
150 Ga0207698_10204637 3300026142 Bacteria 1771
151 Ga0268264_10044256 3300028381 Bacteria 3692
152 Ga0268264_10649384 3300028381 Bacteria 1044
153 Ga0265336_10000123 3300028666 Bacteria 57956
154 Ga0265324_10000932 3300029957 Bacteria 18361
155 Ga0307509_10133088 3300031507 Bacteria 2438
156 Ga0307509_10155475 3300031507 Bacteria 2194
157 Ga0307408_100064077 3300031548 Bacteria 2691
158 Ga0316575_10013955 3300031665 Bacteria 3010
159 Ga0316579_10009168 3300031691 Bacteria 4154
160 Ga0316579_10011137 3300031691 Bacteria 3817
161 Ga0316579_10036991 3300031691 Bacteria 2253
162 Ga0316576_10000969 3300031727 Bacteria 14721
163 Ga0316576_10010468 3300031727 Bacteria 6027
164 Ga0316576_10019760 3300031727 Bacteria 4620
165 Ga0316576_10101332 3300031727 Bacteria 2152
166 Ga0316576_10117989 3300031727 Bacteria 1991
167 Ga0316578_10000504 3300031728 Bacteria 13230
168 Ga0316578_10004350 3300031728 Bacteria 6673
169 Ga0316578_10009079 3300031728 Bacteria 5094
170 Ga0316578_10029223 3300031728 Bacteria 3127
171 Ga0316578_10032769 3300031728 Bacteria 2971
172 Ga0316578_10043502 3300031728 Bacteria 2609
173 Ga0316578_10143776 3300031728 Bacteria 1436
174 Ga0307516_10061998 3300031730 Bacteria 3625
175 Ga0307405_10039514 3300031731 Bacteria 2852
176 Ga0307405_10079408 3300031731 Bacteria 2139
177 Ga0316577_10014398 3300031733 Bacteria 4341
178 Ga0316577_10095612 3300031733 Bacteria 1664
179 Ga0307413_10077656 3300031824 Bacteria 2115
180 Ga0307410_10222958 3300031852 Bacteria 1451
181 Ga0307406_10011858 3300031901 Bacteria 4953
182 Ga0307406_10104252 3300031901 Bacteria 1938
183 Ga0307406_10150836 3300031901 Bacteria 1658
184 Ga0307407_10034368 3300031903 Bacteria 2775
185 Ga0307407_10059676 3300031903 Bacteria 2222
186 Ga0307407_10076921 3300031903 Bacteria 2005
187 Ga0307407_10112451 3300031903 Bacteria 1712
188 Ga0307412_10263989 3300031911 Bacteria 1344
189 Ga0307409_100053536 3300031995 Bacteria 3101
190 Ga0307416_100265963 3300032002 Bacteria 1680
191 Ga0307414_10013233 3300032004 Bacteria 4907
192 Ga0307414_10094698 3300032004 Bacteria 2230
193 Ga0307414_10269130 3300032004 Bacteria 1426
194 Ga0307411_10012499 3300032005 Bacteria 4636
195 Ga0307411_10019776 3300032005 Bacteria 3898
196 Ga0307415_100048428 3300032126 Bacteria 2868
197 Ga0307415_100342835 3300032126 Bacteria 1255
198 Ga0307415_100404672 3300032126 Bacteria 1166
199 Ga0316585_10011328 3300032137 Bacteria 2629
200 Ga0316585_10032866 3300032137 Bacteria 1635
201 Ga0316580_10000920 3300032139 Bacteria 7278
202 Ga0316580_10014011 3300032139 Bacteria 2445
203 Ga0373959_0007841 3300034820 Bacteria 1802
204 Ga0373934_0058990 3300035086 Bacteria 1527
205 Ga0316574_0001444 3300035398 Bacteria 11280
206 Ga0316574_0002059 3300035398 Bacteria 9941
207 Ga0373931_0003056 3300035691 Bacteria 7481
208 Ga0373931_0059165 3300035691 Bacteria 2060
209 Ga0373931_0084979 3300035691 Bacteria 1753
210 Ga0316582_0033880 3300036647 Bacteria 3141
211 Ga0316582_0147284 3300036647 Bacteria 1590
212 Ga0316584_0004099 3300036712 Bacteria 9608
213 Ga0316584_0018166 3300036712 Bacteria 5071
214 Ga0316584_0041042 3300036712 Bacteria 3449
215 Ga0316584_0049150 3300036712 Bacteria 3152
216 Ga0316584_0134913 3300036712 Bacteria 1843
217 Ga0373925_0181367 3300037068 Bacteria 1667
218 Ga0395898_0149279 3300037466 Bacteria 2237
219 Ga0395905_0038059 3300037471 Bacteria 4513
220 Ga0316581_0045428 3300037588 Bacteria 1341
221 Ga0436364_0903801 3300037853 Bacteria 9680
222 Ga0400484_19561 3300038725 Bacteria 6120
223 Ga0400490_02805 3300038726 Bacteria 6901
224 Ga0400490_06023 3300038726 Bacteria 36740
225 Ga0400490_52347 3300038726 Bacteria 19647
226 Ga0400491_09219 3300038727 Bacteria 2544
227 Ga0400485_05324 3300038735 Bacteria 2290
228 Ga0400485_08298 3300038735 Bacteria 1841
229 Ga0400488_41083 3300038741 Bacteria 13543
230 Ga0400488_56971 3300038741 Bacteria 6826
231 Ga0400486_17763 3300038742 Bacteria 12835
232 Ga0242420_002863 3300038996 Bacteria 2502
233 Ga0400483_015569 3300039062 Bacteria 4586
234 Ga0400483_050988 3300039062 Bacteria 17885
235 Ga0400483_064034 3300039062 Bacteria 2444
236 Ga0400483_184269 3300039062 Bacteria 13757
237 Ga0400489_08233 3300039093 Bacteria 5023
238 Ga0400487_45086 3300039110 Bacteria 5437
239 Ga0400487_62361 3300039110 Bacteria 7426
240 Ga0436361_0147149 3300039447 Bacteria 5290
241 Ga0439446_0084296 3300042156 Bacteria 988
242 Ga0451577_0121747 3300042876 Bacteria 2337
243 Ga0466969_0054637 3300044656 Bacteria 1955
244 Ga0466972_0006078 3300044658 Bacteria 6064
245 Ga0453683_0013564 3300044673 Bacteria 5314
246 Ga0466965_0015929 3300044683 Bacteria 3571
247 Ga0466966_0002819 3300044684 Bacteria 11437
248 Ga0466961_0037077 3300044693 Bacteria 3128
249 Ga0466963_0079767 3300044694 Bacteria 2215
250 Ga0466963_0173656 3300044694 Bacteria 1503
251 Ga0466964_0001494 3300044706 Bacteria 8019
252 Ga0453684_0002361 3300044712 Bacteria 46138
253 Ga0453684_0007022 3300044712 Bacteria 21037
254 Ga0453684_0033440 3300044712 Bacteria 7169
255 Ga0466971_0028787 3300044719 Bacteria 2484
256 Ga0466968_0008438 3300044735 Bacteria 3946
257 Ga0466957_0003346 3300044842 Bacteria 8788
258 Ga0466960_0004992 3300044901 Bacteria 5230
259 Ga0451576_0000336 3300045051 Bacteria 113581
260 Ga0451576_0001014 3300045051 Bacteria 51909
261 Ga0466958_0238198 3300045836 Bacteria 1162
262 Ga0495641_0018355 3300046461 Bacteria 3612
263 Ga0495650_0011619 3300046471 Bacteria 4807
264 Ga0495580_0044732 3300046472 Bacteria 3148
265 Ga0495664_0200565 3300046477 Bacteria 1209
266 Ga0495583_0000046 3300046506 Bacteria 218059
267 Ga0495606_0001300 3300046507 Bacteria 34419
268 Ga0495608_0323945 3300046511 Bacteria 952
269 Ga0495656_0070650 3300046615 Bacteria 1550
270 Ga0495625_0016534 3300046660 Bacteria 5802
271 Ga0495588_0082191 3300046674 Bacteria 1682
272 Ga0495623_0033342 3300046679 Bacteria 3305
273 Ga0495669_0050257 3300046684 Bacteria 1869
274 Ga0495613_0021817 3300046689 Bacteria 4773
275 Ga0495649_0000638 3300046694 Bacteria 28526
276 Ga0495589_0018543 3300046794 Bacteria 3567
277 Ga0495581_0038327 3300047315 Bacteria 2774
278 Ga0495604_0145519 3300047317 Bacteria 1689
279 Ga0495677_0134008 3300047445 Bacteria 949
280 Ga0495686_0004315 3300047472 Bacteria 11761
281 Ga0496100_0192059 3300048903 Bacteria 1483
282 Ga0496100_0229200 3300048903 Bacteria 1366
283 Ga0496101_0130836 3300048904 Bacteria 1906
284 Ga0496102_0032258 3300048905 Bacteria 4706
285 Ga0496102_0043527 3300048905 Bacteria 4072
286 Ga0496102_0102242 3300048905 Bacteria 2664
287 Ga0496103_0035191 3300048906 Bacteria 3066
288 Ga0496104_0046836 3300048907 Bacteria 4074
289 Ga0496105_0165599 3300048908 Bacteria 1814
290 Ga0496105_0283655 3300048908 Bacteria 1335
291 Ga0496105_0540038 3300048908 Bacteria 911
292 Ga0496106_0055430 3300048909 Bacteria 2996
293 Ga0496107_0068760 3300048910 Bacteria 2570
294 Ga0496108_0000706 3300048911 Bacteria 25921
295 Ga0496108_0002744 3300048911 Bacteria 14087
296 Ga0496108_0005867 3300048911 Bacteria 9956
297 Ga0496108_0092648 3300048911 Bacteria 2570
298 Ga0496108_0378427 3300048911 Bacteria 1236
299 Ga0496109_0004021 3300048912 Bacteria 12278
300 Ga0496109_0013289 3300048912 Bacteria 7133
301 Ga0496109_0031134 3300048912 Bacteria 4785
302 Ga0496109_0138549 3300048912 Bacteria 2275
303 Ga0496110_0006014 3300048913 Bacteria 9556
304 Ga0496110_0020183 3300048913 Bacteria 5623
305 Ga0496110_0025690 3300048913 Bacteria 5036
306 Ga0496110_0042109 3300048913 Bacteria 3986
307 Ga0496110_0106313 3300048913 Bacteria 2518
308 Ga0496110_0109311 3300048913 Bacteria 2483
309 Ga0496111_0104066 3300048914 Bacteria 2088
310 Ga0496111_0396922 3300048914 Bacteria 1019
311 Ga0496112_0002310 3300048915 Bacteria 15288
312 Ga0496112_0002874 3300048915 Bacteria 14003
313 Ga0496112_0280054 3300048915 Bacteria 1615
314 Ga0496113_0009838 3300048916 Bacteria 6294
315 Ga0496114_0577712 3300048917 Bacteria 992
316 Ga0496115_0150491 3300048918 Bacteria 1922
317 Ga0501031_0074334 3300049568 Bacteria 2213
318 Ga0501033_0068003 3300049570 Bacteria 2620
319 Ga0501034_0104422 3300049571 Bacteria 2827
320 Ga0501036_0117969 3300049572 Bacteria 2241
321 Ga0501037_0040981 3300049573 Bacteria 3407
322 Ga0501038_0052538 3300049574 Bacteria 3513
323 Ga0501039_0043668 3300049575 Bacteria 3462
324 Ga0501040_0114625 3300049576 Bacteria 1887
325 Ga0501041_0008178 3300049577 Bacteria 6156
326 Ga0501043_0128178 3300049579 Bacteria 1989
327 Ga0501043_0178451 3300049579 Bacteria 1655
328 Ga0501046_0058433 3300049580 Bacteria 3023
329 Ga0501047_0167118 3300049581 Bacteria 2070
330 Ga0501048_0014762 3300049582 Bacteria 5780
331 Ga0501048_0164190 3300049582 Bacteria 1572
332 Ga0501068_0086355 3300049584 Bacteria 1931
333 Ga0501069_0162312 3300049585 Bacteria 1287
334 Ga0501071_0332174 3300049587 Bacteria 1155
335 Ga0501072_0007533 3300049588 Bacteria 8261
336 Ga0501074_0051713 3300049590 Bacteria 2965
337 Ga0501075_0009458 3300049591 Bacteria 6819
338 Ga0501076_0009844 3300049592 Bacteria 7066
339 Ga0501077_0005573 3300049593 Bacteria 7665
340 Ga0501079_0068637 3300049741 Bacteria 2736
341 Ga0501080_0012370 3300049742 Bacteria 7822
342 Ga0501081_0004023 3300049743 Bacteria 9429
343 Ga0501045_0017543 3300049824 Bacteria 5083
344 nmdc:mga0k408_39104_c1 3300050493 Bacteria 2724
345 nmdc:mga07m45_7860_c1 3300050496 Bacteria 3829
346 nmdc:mga05p37_14681_c1 3300050507 Bacteria 9410
347 nmdc:mga05p37_454698_c1 3300050507 Bacteria 1481
348 nmdc:mga05p37_45859_c2 3300050507 Bacteria 3928
349 nmdc:mga05p37_527353_c1 3300050507 Bacteria 1349
350 nmdc:mga0qj67_77274_c1 3300050509 Bacteria 2663
351 nmdc:mga06r32_134448_c1 3300050510 Bacteria 2447
352 nmdc:mga06r32_213936_c1 3300050510 Bacteria 1915
353 nmdc:mga06r32_26455_c1 3300050510 Bacteria 5409
354 nmdc:mga08y16_5894_c1 3300050511 Bacteria 12842
355 nmdc:mga0n895_320601_c1 3300050512 Bacteria 1570
356 nmdc:mga0rr50_218689_c1 3300050513 Bacteria 1572
357 nmdc:mga0rr50_67246_c1 3300050513 Bacteria 2721
358 nmdc:mga0rr50_79712_c1 3300050513 Bacteria 2522
359 nmdc:mga0a205_148879_c1 3300050515 Bacteria 2241
360 nmdc:mga0a205_20956_c1 3300050515 Bacteria 6177
361 nmdc:mga0a205_30800_c1 3300050515 Bacteria 5138
362 nmdc:mga0a205_3857_c1 3300050515 Bacteria 8471
363 Ga0500635_0000005 3300053080 Bacteria 187821
364 Ga0501084_0004475 3300054114 Bacteria 11413
365 Ga0501082_0061595 3300060353 Bacteria 3230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046615 Ga0495656_0070650 Ga0495656_0070650_17_805 262
2 3300037588 Ga0316581_0045428 Ga0316581_0045428_523_1320 265
3 3300049587 Ga0501071_0332174 Ga0501071_0332174_292_1122 276
4 3300046477 Ga0495664_0200565 Ga0495664_0200565_331_1197 288
5 3300048917 Ga0496114_0577712 Ga0496114_0577712_91_960 289
6 3300047445 Ga0495677_0134008 Ga0495677_0134008_57_929 290
7 3300048908 Ga0496105_0540038 Ga0496105_0540038_16_888 290
8 3300005616 Ga0068852_100016406 Ga0068852_1000164063 291
9 3300026142 Ga0207698_10040107 Ga0207698_100401072 291
10 3300046511 Ga0495608_0323945 Ga0495608_0323945_26_937 295
11 3300005441 Ga0070700_100357345 Ga0070700_1003573451 296
12 3300013297 Ga0157378_10222614 Ga0157378_102226141 296
13 3300026118 Ga0207675_100349836 Ga0207675_1003498362 296
14 3300032126 Ga0307415_100342835 Ga0307415_1003428351 296
15 3300006852 Ga0075433_10005244 Ga0075433_100052443 297
16 3300048911 Ga0496108_0000706 Ga0496108_0000706_7066_8013 297
17 3300048913 Ga0496110_0042109 Ga0496110_0042109_1974_2921 297
18 3300050515 nmdc:mga0a205_3857_c1 nmdc:mga0a205_3857_c1_1385_2332 297
19 3300011119 Ga0105246_10041642 Ga0105246_100416423 298
20 3300042156 Ga0439446_0084296 Ga0439446_0084296_72_968 298
21 3300005471 Ga0070698_100506962 Ga0070698_1005069621 299
22 3300034820 Ga0373959_0007841 Ga0373959_0007841_62_1024 302
23 3300049576 Ga0501040_0114625 Ga0501040_0114625_714_1697 303
24 3300006844 Ga0075428_100008315 Ga0075428_1000083157 306
25 3300006847 Ga0075431_100019389 Ga0075431_1000193891 306
26 3300006852 Ga0075433_10087046 Ga0075433_100870462 306
27 3300009147 Ga0114129_10000435 Ga0114129_1000043529 306
28 3300044656 Ga0466969_0054637 Ga0466969_0054637_940_1926 306
29 3300044683 Ga0466965_0015929 Ga0466965_0015929_1372_2358 306
30 3300044684 Ga0466966_0002819 Ga0466966_0002819_1770_2756 306
31 3300044693 Ga0466961_0037077 Ga0466961_0037077_1250_2236 306
32 3300044694 Ga0466963_0079767 Ga0466963_0079767_739_1725 306
33 3300044706 Ga0466964_0001494 Ga0466964_0001494_5282_6268 306
34 3300044719 Ga0466971_0028787 Ga0466971_0028787_998_1984 306
35 3300044842 Ga0466957_0003346 Ga0466957_0003346_5329_6315 306
36 3300045836 Ga0466958_0238198 Ga0466958_0238198_115_1101 306
37 3300050507 nmdc:mga05p37_14681_c1 nmdc:mga05p37_14681_c1_5385_6368 306
38 3300050510 nmdc:mga06r32_134448_c1 nmdc:mga06r32_134448_c1_20_1003 306
39 3300050515 nmdc:mga0a205_148879_c1 nmdc:mga0a205_148879_c1_1161_2144 306
40 3300009147 Ga0114129_10103613 Ga0114129_101036134 308
41 3300050507 nmdc:mga05p37_45859_c2 nmdc:mga05p37_45859_c2_435_1421 308
42 3300028381 Ga0268264_10649384 Ga0268264_106493841 311
43 3300045051 Ga0451576_0000336 Ga0451576_0000336_78229_79191 311
44 3300049585 Ga0501069_0162312 Ga0501069_0162312_121_1104 311
45 3300006844 Ga0075428_100104589 Ga0075428_1001045893 312
46 3300006847 Ga0075431_100064854 Ga0075431_1000648543 312
47 3300009147 Ga0114129_10901674 Ga0114129_109016741 312
48 3300031548 Ga0307408_100064077 Ga0307408_1000640773 312
49 3300031731 Ga0307405_10079408 Ga0307405_100794083 312
50 3300031824 Ga0307413_10077656 Ga0307413_100776562 312
51 3300031901 Ga0307406_10011858 Ga0307406_100118583 312
52 3300031901 Ga0307406_10104252 Ga0307406_101042522 312
53 3300031903 Ga0307407_10059676 Ga0307407_100596762 312
54 3300031903 Ga0307407_10112451 Ga0307407_101124512 312
55 3300031911 Ga0307412_10263989 Ga0307412_102639892 312
56 3300031995 Ga0307409_100053536 Ga0307409_1000535362 312
57 3300032004 Ga0307414_10269130 Ga0307414_102691302 312
58 3300032005 Ga0307411_10019776 Ga0307411_100197762 312
59 3300035691 Ga0373931_0059165 Ga0373931_0059165_52_1035 312
60 3300038996 Ga0242420_002863 Ga0242420_002863_1155_2138 312
61 3300050507 nmdc:mga05p37_454698_c1 nmdc:mga05p37_454698_c1_414_1364 312
62 3300050509 nmdc:mga0qj67_77274_c1 nmdc:mga0qj67_77274_c1_896_1846 312
63 3300050510 nmdc:mga06r32_213936_c1 nmdc:mga06r32_213936_c1_607_1557 312
64 3300050510 nmdc:mga06r32_26455_c1 nmdc:mga06r32_26455_c1_1613_2563 312
65 3300005539 Ga0068853_100000321 Ga0068853_10000032114 313
66 3300009093 Ga0105240_10000859 Ga0105240_1000085926 313
67 3300009551 Ga0105238_10071954 Ga0105238_100719543 313
68 3300010375 Ga0105239_10062145 Ga0105239_100621452 313
69 3300025913 Ga0207695_10001410 Ga0207695_1000141026 313
70 3300025924 Ga0207694_10053878 Ga0207694_100538782 313
71 3300026041 Ga0207639_10000322 Ga0207639_1000032214 313
72 3300005468 Ga0070707_100001447 Ga0070707_10000144712 315
73 3300009147 Ga0114129_10164430 Ga0114129_101644301 315
74 3300009147 Ga0114129_10350168 Ga0114129_103501682 315
75 3300021388 Ga0213875_10025720 Ga0213875_100257202 315
76 3300025922 Ga0207646_10001726 Ga0207646_1000172620 315
77 3300031691 Ga0316579_10009168 Ga0316579_100091682 315
78 3300031733 Ga0316577_10014398 Ga0316577_100143984 315
79 3300036647 Ga0316582_0147284 Ga0316582_0147284_383_1330 315
80 3300036712 Ga0316584_0018166 Ga0316584_0018166_2690_3637 315
81 3300037853 Ga0436364_0903801 Ga0436364_0903801_268_1215 315
82 3300044658 Ga0466972_0006078 Ga0466972_0006078_974_1921 315
83 3300044735 Ga0466968_0008438 Ga0466968_0008438_2159_3106 315
84 3300044901 Ga0466960_0004992 Ga0466960_0004992_184_1131 315
85 3300005530 Ga0070679_100007164 Ga0070679_1000071647 316
86 3300005548 Ga0070665_100014189 Ga0070665_1000141892 316
87 3300009094 Ga0111539_10489802 Ga0111539_104898022 316
88 3300025909 Ga0207705_10040272 Ga0207705_100402723 316
89 3300031731 Ga0307405_10039514 Ga0307405_100395142 316
90 3300042876 Ga0451577_0121747 Ga0451577_0121747_1203_2186 316
91 3300044712 Ga0453684_0002361 Ga0453684_0002361_36232_37215 316
92 3300045051 Ga0451576_0001014 Ga0451576_0001014_13525_14508 316
93 3300005365 Ga0070688_100098029 Ga0070688_1000980292 317
94 3300006028 Ga0070717_10017832 Ga0070717_100178322 317
95 3300007076 Ga0075435_100002574 Ga0075435_10000257410 317
96 3300007076 Ga0075435_100144778 Ga0075435_1001447782 317
97 3300009094 Ga0111539_10003396 Ga0111539_100033967 317
98 3300010375 Ga0105239_10128767 Ga0105239_101287672 317
99 3300013306 Ga0163162_10434065 Ga0163162_104340652 317
100 3300031507 Ga0307509_10155475 Ga0307509_101554752 317
101 3300035691 Ga0373931_0084979 Ga0373931_0084979_570_1532 317
102 3300044712 Ga0453684_0033440 Ga0453684_0033440_1663_2652 317
103 3300046461 Ga0495641_0018355 Ga0495641_0018355_2066_3067 317
104 3300048903 Ga0496100_0192059 Ga0496100_0192059_177_1139 317
105 3300048909 Ga0496106_0055430 Ga0496106_0055430_1402_2364 317
106 3300048910 Ga0496107_0068760 Ga0496107_0068760_1421_2383 317
107 3300048912 Ga0496109_0031134 Ga0496109_0031134_3762_4724 317
108 3300048913 Ga0496110_0025690 Ga0496110_0025690_3918_4880 317
109 3300048914 Ga0496111_0396922 Ga0496111_0396922_34_996 317
110 3300048918 Ga0496115_0150491 Ga0496115_0150491_943_1905 317
111 3300050511 nmdc:mga08y16_5894_c1 nmdc:mga08y16_5894_c1_6784_7758 317
112 3300050513 nmdc:mga0rr50_67246_c1 nmdc:mga0rr50_67246_c1_659_1621 317
113 3300050515 nmdc:mga0a205_30800_c1 nmdc:mga0a205_30800_c1_1509_2471 317
114 3300048911 Ga0496108_0378427 Ga0496108_0378427_186_1172 318
115 3300005435 Ga0070714_100012161 Ga0070714_1000121611 320
116 3300048911 Ga0496108_0092648 Ga0496108_0092648_701_1672 320
117 3300048912 Ga0496109_0138549 Ga0496109_0138549_686_1657 320
118 3300048913 Ga0496110_0106313 Ga0496110_0106313_94_1065 320
119 3300048913 Ga0496110_0109311 Ga0496110_0109311_752_1723 320
120 3300049571 Ga0501034_0104422 Ga0501034_0104422_437_1426 320
121 3300049582 Ga0501048_0164190 Ga0501048_0164190_355_1344 320
122 3300037068 Ga0373925_0181367 Ga0373925_0181367_73_1053 321
123 3300044712 Ga0453684_0007022 Ga0453684_0007022_17559_18536 321
124 3300048904 Ga0496101_0130836 Ga0496101_0130836_303_1283 321
125 3300053080 Ga0500635_0000005 Ga0500635_0000005_46867_47853 321
126 3300005327 Ga0070658_10003240 Ga0070658_100032405 322
127 3300005327 Ga0070658_10027568 Ga0070658_100275682 322
128 3300005327 Ga0070658_10154567 Ga0070658_101545672 322
129 3300005434 Ga0070709_10173113 Ga0070709_101731132 322
130 3300005435 Ga0070714_100010300 Ga0070714_1000103006 322
131 3300005436 Ga0070713_100327006 Ga0070713_1003270062 322
132 3300005440 Ga0070705_100075413 Ga0070705_1000754132 322
133 3300005445 Ga0070708_100006721 Ga0070708_1000067219 322
134 3300005467 Ga0070706_100044502 Ga0070706_1000445023 322
135 3300005468 Ga0070707_100025501 Ga0070707_1000255014 322
136 3300005518 Ga0070699_100038399 Ga0070699_1000383992 322
137 3300005536 Ga0070697_100018133 Ga0070697_1000181335 322
138 3300005543 Ga0070672_100272719 Ga0070672_1002727192 322
139 3300005546 Ga0070696_100004547 Ga0070696_1000045476 322
140 3300005546 Ga0070696_100020422 Ga0070696_1000204222 322
141 3300005549 Ga0070704_100075750 Ga0070704_1000757502 322
142 3300005616 Ga0068852_100058794 Ga0068852_1000587943 322
143 3300005617 Ga0068859_100076709 Ga0068859_1000767092 322
144 3300006852 Ga0075433_10017064 Ga0075433_100170645 322
145 3300006852 Ga0075433_10021765 Ga0075433_100217655 322
146 3300006871 Ga0075434_100445535 Ga0075434_1004455352 322
147 3300006931 Ga0097620_100076708 Ga0097620_1000767084 322
148 3300007076 Ga0075435_100064810 Ga0075435_1000648102 322
149 3300007076 Ga0075435_100124730 Ga0075435_1001247302 322
150 3300007076 Ga0075435_100240339 Ga0075435_1002403392 322
151 3300007076 Ga0075435_100264118 Ga0075435_1002641182 322
152 3300009147 Ga0114129_10461316 Ga0114129_104613162 322
153 3300013102 Ga0157371_10018112 Ga0157371_100181122 322
154 3300013105 Ga0157369_10018857 Ga0157369_100188573 322
155 3300013307 Ga0157372_10005220 Ga0157372_1000522010 322
156 3300014325 Ga0163163_10018201 Ga0163163_100182012 322
157 3300020082 Ga0206353_11418429 Ga0206353_114184292 322
158 3300025907 Ga0207645_10053163 Ga0207645_100531632 322
159 3300025909 Ga0207705_10008643 Ga0207705_100086433 322
160 3300025921 Ga0207652_10213268 Ga0207652_102132682 322
161 3300025922 Ga0207646_10070097 Ga0207646_100700972 322
162 3300025922 Ga0207646_10488699 Ga0207646_104886992 322
163 3300025928 Ga0207700_10262770 Ga0207700_102627702 322
164 3300025929 Ga0207664_10007264 Ga0207664_100072642 322
165 3300026035 Ga0207703_10128257 Ga0207703_101282572 322
166 3300026075 Ga0207708_10107030 Ga0207708_101070302 322
167 3300026088 Ga0207641_10310066 Ga0207641_103100662 322
168 3300026142 Ga0207698_10204637 Ga0207698_102046372 322
169 3300031852 Ga0307410_10222958 Ga0307410_102229581 322
170 3300031901 Ga0307406_10150836 Ga0307406_101508362 322
171 3300031903 Ga0307407_10034368 Ga0307407_100343682 322
172 3300032004 Ga0307414_10013233 Ga0307414_100132335 322
173 3300032004 Ga0307414_10094698 Ga0307414_100946982 322
174 3300032005 Ga0307411_10012499 Ga0307411_100124992 322
175 3300032126 Ga0307415_100048428 Ga0307415_1000484282 322
176 3300037471 Ga0395905_0038059 Ga0395905_0038059_822_1805 322
177 3300044673 Ga0453683_0013564 Ga0453683_0013564_127_1110 322
178 3300046472 Ga0495580_0044732 Ga0495580_0044732_243_1226 322
179 3300046674 Ga0495588_0082191 Ga0495588_0082191_630_1613 322
180 3300046689 Ga0495613_0021817 Ga0495613_0021817_1746_2714 322
181 3300047315 Ga0495581_0038327 Ga0495581_0038327_1177_2145 322
182 3300048905 Ga0496102_0032258 Ga0496102_0032258_247_1230 322
183 3300048905 Ga0496102_0043527 Ga0496102_0043527_1116_2099 322
184 3300048905 Ga0496102_0102242 Ga0496102_0102242_1639_2622 322
185 3300048906 Ga0496103_0035191 Ga0496103_0035191_1734_2717 322
186 3300048907 Ga0496104_0046836 Ga0496104_0046836_1114_2097 322
187 3300048908 Ga0496105_0165599 Ga0496105_0165599_281_1264 322
188 3300048911 Ga0496108_0002744 Ga0496108_0002744_11731_12714 322
189 3300048911 Ga0496108_0005867 Ga0496108_0005867_6795_7778 322
190 3300048912 Ga0496109_0004021 Ga0496109_0004021_5055_6038 322
191 3300048912 Ga0496109_0013289 Ga0496109_0013289_4082_5065 322
192 3300048913 Ga0496110_0006014 Ga0496110_0006014_4912_5895 322
193 3300048913 Ga0496110_0020183 Ga0496110_0020183_3508_4491 322
194 3300048914 Ga0496111_0104066 Ga0496111_0104066_805_1788 322
195 3300048915 Ga0496112_0002310 Ga0496112_0002310_7229_8212 322
196 3300048915 Ga0496112_0002874 Ga0496112_0002874_11666_12649 322
197 3300048916 Ga0496113_0009838 Ga0496113_0009838_3430_4413 322
198 3300049579 Ga0501043_0178451 Ga0501043_0178451_395_1363 322
199 3300049581 Ga0501047_0167118 Ga0501047_0167118_120_1088 322
200 3300050507 nmdc:mga05p37_527353_c1 nmdc:mga05p37_527353_c1_334_1317 322
201 3300050512 nmdc:mga0n895_320601_c1 nmdc:mga0n895_320601_c1_333_1316 322
202 3300050513 nmdc:mga0rr50_218689_c1 nmdc:mga0rr50_218689_c1_174_1157 322
203 3300050513 nmdc:mga0rr50_79712_c1 nmdc:mga0rr50_79712_c1_300_1283 322
204 3300050515 nmdc:mga0a205_20956_c1 nmdc:mga0a205_20956_c1_1947_2930 322
205 3300005328 Ga0070676_10023215 Ga0070676_100232154 323
206 3300005333 Ga0070677_10018207 Ga0070677_100182072 323
207 3300005339 Ga0070660_100200264 Ga0070660_1002002642 323
208 3300005356 Ga0070674_100081622 Ga0070674_1000816222 323
209 3300005367 Ga0070667_100016738 Ga0070667_1000167385 323
210 3300005438 Ga0070701_10176087 Ga0070701_101760871 323
211 3300005457 Ga0070662_100061006 Ga0070662_1000610062 323
212 3300005459 Ga0068867_100010019 Ga0068867_1000100192 323
213 3300005543 Ga0070672_100004791 Ga0070672_1000047915 323
214 3300005564 Ga0070664_100053868 Ga0070664_1000538682 323
215 3300005578 Ga0068854_100202877 Ga0068854_1002028772 323
216 3300005718 Ga0068866_10057259 Ga0068866_100572592 323
217 3300005981 Ga0081538_10083408 Ga0081538_100834082 323
218 3300006881 Ga0068865_100009864 Ga0068865_1000098647 323
219 3300009147 Ga0114129_10020007 Ga0114129_100200075 323
220 3300009148 Ga0105243_10149402 Ga0105243_101494021 323
221 3300009176 Ga0105242_10013814 Ga0105242_100138141 323
222 3300009177 Ga0105248_10123450 Ga0105248_101234502 323
223 3300025256 Ga0209759_1001428 Ga0209759_10014284 323
224 3300025899 Ga0207642_10067065 Ga0207642_100670652 323
225 3300025933 Ga0207706_10175449 Ga0207706_101754492 323
226 3300025937 Ga0207669_10088348 Ga0207669_100883481 323
227 3300025937 Ga0207669_10285533 Ga0207669_102855332 323
228 3300025941 Ga0207711_10079110 Ga0207711_100791102 323
229 3300025972 Ga0207668_10015318 Ga0207668_100153183 323
230 3300025986 Ga0207658_10064796 Ga0207658_100647962 323
231 3300026041 Ga0207639_10047897 Ga0207639_100478973 323
232 3300026089 Ga0207648_10013245 Ga0207648_100132452 323
233 3300028381 Ga0268264_10044256 Ga0268264_100442562 323
234 3300028666 Ga0265336_10000123 Ga0265336_1000012332 323
235 3300029957 Ga0265324_10000932 Ga0265324_100009323 323
236 3300031903 Ga0307407_10076921 Ga0307407_100769212 323
237 3300032002 Ga0307416_100265963 Ga0307416_1002659632 323
238 3300032126 Ga0307415_100404672 Ga0307415_1004046722 323
239 3300038725 Ga0400484_19561 Ga0400484_19561_2327_3310 323
240 3300038726 Ga0400490_02805 Ga0400490_02805_5310_6293 323
241 3300038726 Ga0400490_06023 Ga0400490_06023_1550_2533 323
242 3300038726 Ga0400490_52347 Ga0400490_52347_13647_14630 323
243 3300038727 Ga0400491_09219 Ga0400491_09219_855_1838 323
244 3300038735 Ga0400485_05324 Ga0400485_05324_484_1467 323
245 3300038735 Ga0400485_08298 Ga0400485_08298_294_1277 323
246 3300038741 Ga0400488_41083 Ga0400488_41083_5863_6846 323
247 3300038741 Ga0400488_56971 Ga0400488_56971_4756_5739 323
248 3300038742 Ga0400486_17763 Ga0400486_17763_5575_6558 323
249 3300039062 Ga0400483_015569 Ga0400483_015569_1099_2076 323
250 3300039062 Ga0400483_050988 Ga0400483_050988_4709_5692 323
251 3300039062 Ga0400483_064034 Ga0400483_064034_794_1771 323
252 3300039062 Ga0400483_184269 Ga0400483_184269_9592_10575 323
253 3300039093 Ga0400489_08233 Ga0400489_08233_1988_2971 323
254 3300039110 Ga0400487_45086 Ga0400487_45086_4075_5058 323
255 3300039110 Ga0400487_62361 Ga0400487_62361_512_1495 323
256 3300046679 Ga0495623_0033342 Ga0495623_0033342_923_1894 323
257 3300047317 Ga0495604_0145519 Ga0495604_0145519_127_1098 323
258 3300048915 Ga0496112_0280054 Ga0496112_0280054_178_1155 323
259 3300049568 Ga0501031_0074334 Ga0501031_0074334_106_1092 323
260 3300049570 Ga0501033_0068003 Ga0501033_0068003_1124_2110 323
261 3300049572 Ga0501036_0117969 Ga0501036_0117969_454_1440 323
262 3300049573 Ga0501037_0040981 Ga0501037_0040981_1117_2103 323
263 3300049574 Ga0501038_0052538 Ga0501038_0052538_1305_2291 323
264 3300049575 Ga0501039_0043668 Ga0501039_0043668_900_1886 323
265 3300049577 Ga0501041_0008178 Ga0501041_0008178_4921_5907 323
266 3300049579 Ga0501043_0128178 Ga0501043_0128178_656_1642 323
267 3300049580 Ga0501046_0058433 Ga0501046_0058433_1438_2424 323
268 3300049582 Ga0501048_0014762 Ga0501048_0014762_1616_2602 323
269 3300049584 Ga0501068_0086355 Ga0501068_0086355_457_1443 323
270 3300049588 Ga0501072_0007533 Ga0501072_0007533_6476_7462 323
271 3300049590 Ga0501074_0051713 Ga0501074_0051713_637_1623 323
272 3300049591 Ga0501075_0009458 Ga0501075_0009458_3264_4250 323
273 3300049592 Ga0501076_0009844 Ga0501076_0009844_4648_5634 323
274 3300049593 Ga0501077_0005573 Ga0501077_0005573_1910_2896 323
275 3300049741 Ga0501079_0068637 Ga0501079_0068637_415_1401 323
276 3300049742 Ga0501080_0012370 Ga0501080_0012370_4577_5563 323
277 3300049743 Ga0501081_0004023 Ga0501081_0004023_6911_7897 323
278 3300049824 Ga0501045_0017543 Ga0501045_0017543_2720_3706 323
279 3300054114 Ga0501084_0004475 Ga0501084_0004475_2866_3852 323
280 3300060353 Ga0501082_0061595 Ga0501082_0061595_910_1896 323
281 3300031665 Ga0316575_10013955 Ga0316575_100139551 324
282 3300031691 Ga0316579_10011137 Ga0316579_100111373 324
283 3300031691 Ga0316579_10036991 Ga0316579_100369912 324
284 3300031727 Ga0316576_10000969 Ga0316576_100009693 324
285 3300031727 Ga0316576_10010468 Ga0316576_100104682 324
286 3300031727 Ga0316576_10019760 Ga0316576_100197603 324
287 3300031727 Ga0316576_10101332 Ga0316576_101013321 324
288 3300031727 Ga0316576_10117989 Ga0316576_101179892 324
289 3300031728 Ga0316578_10000504 Ga0316578_100005044 324
290 3300031728 Ga0316578_10004350 Ga0316578_100043505 324
291 3300031728 Ga0316578_10009079 Ga0316578_100090793 324
292 3300031728 Ga0316578_10029223 Ga0316578_100292232 324
293 3300031728 Ga0316578_10032769 Ga0316578_100327693 324
294 3300031728 Ga0316578_10043502 Ga0316578_100435022 324
295 3300031728 Ga0316578_10143776 Ga0316578_101437762 324
296 3300031733 Ga0316577_10095612 Ga0316577_100956122 324
297 3300032137 Ga0316585_10011328 Ga0316585_100113282 324
298 3300032137 Ga0316585_10032866 Ga0316585_100328662 324
299 3300032139 Ga0316580_10000920 Ga0316580_100009205 324
300 3300032139 Ga0316580_10014011 Ga0316580_100140111 324
301 3300035398 Ga0316574_0001444 Ga0316574_0001444_3686_4672 324
302 3300035398 Ga0316574_0002059 Ga0316574_0002059_8111_9097 324
303 3300036647 Ga0316582_0033880 Ga0316582_0033880_1480_2466 324
304 3300036712 Ga0316584_0004099 Ga0316584_0004099_5231_6217 324
305 3300036712 Ga0316584_0041042 Ga0316584_0041042_1391_2377 324
306 3300036712 Ga0316584_0049150 Ga0316584_0049150_926_1987 324
307 3300036712 Ga0316584_0134913 Ga0316584_0134913_298_1284 324
308 3300002705 JGI25156J39149_1000459 JGI25156J39149_100045920 328
309 3300002738 JGI25154J39366_1002135 JGI25154J39366_10021351 328
310 3300002741 JGI25157J39369_1000021 JGI25157J39369_1000021134 328
311 3300003752 Ga0055539_1000588 Ga0055539_10005884 328
312 3300003752 Ga0055539_1000994 Ga0055539_10009942 328
313 3300003756 Ga0055533_1000033 Ga0055533_100003321 328
314 3300005330 Ga0070690_100039685 Ga0070690_1000396852 328
315 3300005334 Ga0068869_100088609 Ga0068869_1000886092 328
316 3300005339 Ga0070660_100039293 Ga0070660_1000392932 328
317 3300005364 Ga0070673_100032257 Ga0070673_1000322573 328
318 3300005535 Ga0070684_100122914 Ga0070684_1001229142 328
319 3300005563 Ga0068855_100169570 Ga0068855_1001695702 328
320 3300005577 Ga0068857_100005113 Ga0068857_10000511310 328
321 3300005578 Ga0068854_100013303 Ga0068854_1000133035 328
322 3300005614 Ga0068856_100000887 Ga0068856_10000088721 328
323 3300006195 Ga0075366_10013680 Ga0075366_100136803 328
324 3300006353 Ga0075370_10047691 Ga0075370_100476912 328
325 3300009545 Ga0105237_10296261 Ga0105237_102962612 328
326 3300010375 Ga0105239_10024610 Ga0105239_100246104 328
327 3300014968 Ga0157379_10063964 Ga0157379_100639642 328
328 3300021361 Ga0213872_10008160 Ga0213872_100081606 328
329 3300025226 Ga0209674_100064 Ga0209674_100064228 328
330 3300025230 Ga0209563_100126 Ga0209563_10012687 328
331 3300025231 Ga0207427_100197 Ga0207427_10019721 328
332 3300025242 Ga0209258_100905 Ga0209258_10090516 328
333 3300025246 Ga0209646_1000060 Ga0209646_100006022 328
334 3300025250 Ga0209026_1000049 Ga0209026_100004920 328
335 3300025253 Ga0209677_100411 Ga0209677_10041121 328
336 3300025253 Ga0209677_100792 Ga0209677_1007929 328
337 3300025253 Ga0209677_101222 Ga0209677_10122211 328
338 3300025256 Ga0209759_1000069 Ga0209759_100006920 328
339 3300025303 Ga0209051_1040790 Ga0209051_10407901 328
340 3300025913 Ga0207695_10045326 Ga0207695_100453262 328
341 3300025914 Ga0207671_10135410 Ga0207671_101354102 328
342 3300025934 Ga0207686_10184933 Ga0207686_101849332 328
343 3300025942 Ga0207689_10014953 Ga0207689_100149534 328
344 3300025949 Ga0207667_10001779 Ga0207667_1000177911 328
345 3300025960 Ga0207651_10021780 Ga0207651_100217802 328
346 3300026078 Ga0207702_10002045 Ga0207702_100020454 328
347 3300031507 Ga0307509_10133088 Ga0307509_101330882 328
348 3300031730 Ga0307516_10061998 Ga0307516_100619982 328
349 3300035086 Ga0373934_0058990 Ga0373934_0058990_469_1455 328
350 3300035691 Ga0373931_0003056 Ga0373931_0003056_2296_3282 328
351 3300037466 Ga0395898_0149279 Ga0395898_0149279_172_1158 328
352 3300039447 Ga0436361_0147149 Ga0436361_0147149_244_1230 328
353 3300044694 Ga0466963_0173656 Ga0466963_0173656_18_1004 328
354 3300046471 Ga0495650_0011619 Ga0495650_0011619_1555_2541 328
355 3300046506 Ga0495583_0000046 Ga0495583_0000046_194287_195273 328
356 3300046507 Ga0495606_0001300 Ga0495606_0001300_32073_33059 328
357 3300046660 Ga0495625_0016534 Ga0495625_0016534_1937_2923 328
358 3300046684 Ga0495669_0050257 Ga0495669_0050257_809_1795 328
359 3300046694 Ga0495649_0000638 Ga0495649_0000638_22669_23655 328
360 3300046794 Ga0495589_0018543 Ga0495589_0018543_981_1967 328
361 3300047472 Ga0495686_0004315 Ga0495686_0004315_9952_10938 328
362 3300048903 Ga0496100_0229200 Ga0496100_0229200_167_1153 328
363 3300048908 Ga0496105_0283655 Ga0496105_0283655_327_1313 328
364 3300050493 nmdc:mga0k408_39104_c1 nmdc:mga0k408_39104_c1_806_1792 328
365 3300050496 nmdc:mga07m45_7860_c1 nmdc:mga07m45_7860_c1_1769_2755 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

74

204

0.99

PF17863

AAA_lid_2

AAA lid domain

271

344

0.94

PF07728

AAA_5

AAA domain (dynein-related subfamily)

74

202

0.85

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

42

251

0.83

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

75

210

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8966 6 327
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8782 6 327
3nbx-assembly1.cif.gz_X crystal structure of e. coli rava (regulatory atpase variant a) in complex with adp 0.7853 8 319
4upb-assembly1.cif.gz_E electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.7797 8 319
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.7765 8 319
ID Description Score Start End Superfamily
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9794 219 323 1.10.8.80
af_O53314_205_312_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9714 226 322 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9597 216 323 1.10.8.80
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 13 200 3.40.50.300
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9527 219 323 1.10.8.80
ID Description Score Start End GO Terms
AF-A0A840MJR8-F1-model_v4 MoxR-like ATPase (EC 3.6.3.-) 0.9853 5 328 GO:0005524
GO:0016887
AF-A0A1V5NTA5-F1-model_v4 ChlI/MoxR AAA lid domain-containing protein 0.9824 239 327
AF-A0A3M0WR89-F1-model_v4 MoxR family ATPase 0.9823 219 326
AF-A0A3D4QUL6-F1-model_v4 Magnesium chelatase 0.9817 232 327
AF-A0A660ZG47-F1-model_v4 AAA family ATPase 0.9804 13 190 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.85 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map