F423731

General Info

Members Datasets Scaffolds Average Seq Length
365 194 730 59

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100208901|Ga0307409_1002089012
Length 69
Sequence VVGLAAYDPAMYFTDRGIEELVERRGEETVTLEWLGEQLRNFVDAHPEFETPIERLATWLARDDEDDED

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
70 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
71 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
72 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
103 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
104 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
110 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
182 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
183 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
188 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
189 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
190 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 3.56
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100208901 3300031995 Bacteria 1753
2 JGI25406J46586_10025105 3300003203 Bacteria 2320
3 JGI25406J46586_10050805 3300003203 Bacteria 1391
4 Ga0070658_11959910 3300005327 Bacteria 506
5 Ga0070668_100012050 3300005347 Bacteria 6439
6 Ga0070668_101204280 3300005347 Bacteria 686
7 Ga0070667_100071504 3300005367 Bacteria 2955
8 Ga0070667_100214752 3300005367 Bacteria 1711
9 Ga0070713_101103828 3300005436 Bacteria 767
10 Ga0070698_100326766 3300005471 Bacteria 1465
11 Ga0070679_100372369 3300005530 Bacteria 1375
12 Ga0070684_101943043 3300005535 Bacteria 555
13 Ga0068853_102271846 3300005539 Bacteria 526
14 Ga0070695_101155788 3300005545 Bacteria 635
15 Ga0070693_101377185 3300005547 Bacteria 548
16 Ga0070665_100387670 3300005548 Bacteria 1405
17 Ga0068855_100031338 3300005563 Bacteria 6349
18 Ga0070664_101168294 3300005564 Bacteria 726
19 Ga0068856_100204063 3300005614 Bacteria 1991
20 Ga0068856_100723596 3300005614 Bacteria 1015
21 Ga0068856_100879638 3300005614 Bacteria 915
22 Ga0068856_101734219 3300005614 Bacteria 637
23 Ga0070702_101394839 3300005615 Bacteria 573
24 Ga0068852_100012765 3300005616 Bacteria 6397
25 Ga0068852_101722826 3300005616 Bacteria 649
26 Ga0068859_100110122 3300005617 Bacteria 2816
27 Ga0068859_101394878 3300005617 Bacteria 773
28 Ga0068860_100757615 3300005843 Bacteria 983
29 Ga0068860_102109042 3300005843 Bacteria 585
30 Ga0068862_100384522 3300005844 Bacteria 1310
31 Ga0081539_10000657 3300005985 Bacteria 69568
32 Ga0081539_10001151 3300005985 Bacteria 47918
33 Ga0081539_10093352 3300005985 Bacteria 1550
34 Ga0081539_10172842 3300005985 Bacteria 1020
35 Ga0081539_10272787 3300005985 Bacteria 740
36 Ga0070717_10410684 3300006028 Bacteria 1217
37 Ga0075364_10082594 3300006051 Bacteria 2126
38 Ga0075428_100783573 3300006844 Bacteria 1014
39 Ga0075428_102592662 3300006844 Bacteria 518
40 Ga0097620_100110125 3300006931 Bacteria 2816
41 Ga0097620_101394485 3300006931 Bacteria 773
42 Ga0105240_11487546 3300009093 Bacteria 710
43 Ga0111539_12311294 3300009094 Bacteria 624
44 Ga0111539_12420797 3300009094 Bacteria 609
45 Ga0105245_10785197 3300009098 Bacteria 990
46 Ga0105245_11165008 3300009098 Bacteria 818
47 Ga0105245_13193441 3300009098 Bacteria 508
48 Ga0105241_11279140 3300009174 Bacteria 698
49 Ga0105242_11596127 3300009176 Bacteria 686
50 Ga0105237_10070805 3300009545 Bacteria 3483
51 Ga0105237_11348271 3300009545 Bacteria 720
52 Ga0105237_11691235 3300009545 Bacteria 640
53 Ga0105238_10883923 3300009551 Bacteria 911
54 Ga0105249_10973269 3300009553 Bacteria 917
55 Ga0105239_10167857 3300010375 Bacteria 2454
56 Ga0105239_10486260 3300010375 Bacteria 1403
57 Ga0105239_11386869 3300010375 Bacteria 811
58 Ga0105239_11765659 3300010375 Bacteria 716
59 Ga0105239_11781780 3300010375 Bacteria 713
60 Ga0157371_11486796 3300013102 Bacteria 528
61 Ga0157370_11120278 3300013104 Bacteria 711
62 Ga0157374_12155476 3300013296 Bacteria 584
63 Ga0157372_10595903 3300013307 Bacteria 1288
64 Ga0157380_13466404 3300014326 Bacteria 505
65 Ga0157376_10602479 3300014969 Bacteria 1094
66 Ga0157376_12925194 3300014969 Bacteria 517
67 Ga0206352_10329904 3300020078 Bacteria 544
68 Ga0207688_10597206 3300025901 Bacteria 695
69 Ga0207647_10123601 3300025904 Bacteria 1524
70 Ga0207654_10193079 3300025911 Bacteria 1336
71 Ga0207671_10223907 3300025914 Bacteria 1474
72 Ga0207671_10496612 3300025914 Bacteria 973
73 Ga0207693_11272846 3300025915 Bacteria 551
74 Ga0207663_11527763 3300025916 Bacteria 538
75 Ga0207657_10411258 3300025919 Bacteria 1064
76 Ga0207652_10497340 3300025921 Bacteria 1098
77 Ga0207694_10188623 3300025924 Bacteria 1674
78 Ga0207650_10769891 3300025925 Bacteria 815
79 Ga0207679_11270305 3300025945 Bacteria 676
80 Ga0207667_10017723 3300025949 Bacteria 8010
81 Ga0207668_10027581 3300025972 Bacteria 3700
82 Ga0207668_10505576 3300025972 Bacteria 1040
83 Ga0207658_10301058 3300025986 Bacteria 1381
84 Ga0207639_11691049 3300026041 Bacteria 593
85 Ga0207702_10204773 3300026078 Bacteria 1831
86 Ga0207702_11060832 3300026078 Bacteria 804
87 Ga0207702_11610482 3300026078 Bacteria 642
88 Ga0207648_10730896 3300026089 Bacteria 919
89 Ga0207676_11191185 3300026095 Bacteria 755
90 Ga0207683_10193152 3300026121 Bacteria 1849
91 Ga0207698_10003818 3300026142 Bacteria 9113
92 Ga0207698_10718455 3300026142 Bacteria 995
93 Ga0207698_11843858 3300026142 Bacteria 620
94 Ga0268266_10824357 3300028379 Bacteria 896
95 Ga0268265_10090761 3300028380 Bacteria 2441
96 Ga0268264_10254501 3300028381 Bacteria 1633
97 Ga0268264_11677354 3300028381 Bacteria 646
98 Ga0307517_10038845 3300028786 Bacteria 5252
99 Ga0307515_10013547 3300028794 Bacteria 15226
100 Ga0307515_10098109 3300028794 Bacteria 3572
101 Ga0307515_10102202 3300028794 Bacteria 3450
102 Ga0307512_10028842 3300030522 Bacteria 4858
103 Ga0307512_10036047 3300030522 Bacteria 4202
104 Ga0316177_1049009 3300030731 Bacteria 879
105 Ga0314311_1001602 3300030733 Bacteria 1957
106 Ga0316181_1138754 3300030744 Bacteria 570
107 Ga0316182_1016243 3300030745 Bacteria 845
108 Ga0307513_10025375 3300031456 Bacteria 6869
109 Ga0307513_10177236 3300031456 Bacteria 2000
110 Ga0307513_10245822 3300031456 Bacteria 1590
111 Ga0307513_10539394 3300031456 Bacteria 880
112 Ga0307509_10039956 3300031507 Bacteria 5106
113 Ga0307408_100035231 3300031548 Bacteria 3511
114 Ga0307508_10020399 3300031616 Bacteria 6018
115 Ga0307508_10042208 3300031616 Bacteria 4093
116 Ga0307508_10237862 3300031616 Bacteria 1419
117 Ga0316576_10006620 3300031727 Bacteria 7235
118 Ga0307516_10029583 3300031730 Bacteria 5536
119 Ga0307516_10059360 3300031730 Bacteria 3720
120 Ga0307516_10273368 3300031730 Bacteria 1374
121 Ga0307516_10680485 3300031730 Bacteria 685
122 Ga0307516_10703418 3300031730 Bacteria 668
123 Ga0307405_10042817 3300031731 Bacteria 2758
124 Ga0307413_10016423 3300031824 Bacteria 3824
125 Ga0307413_10610378 3300031824 Bacteria 894
126 Ga0307413_11047145 3300031824 Bacteria 702
127 Ga0307413_11727243 3300031824 Bacteria 559
128 Ga0307410_10026557 3300031852 Bacteria 3647
129 Ga0307410_10605063 3300031852 Bacteria 915
130 Ga0307410_11647740 3300031852 Bacteria 568
131 Ga0326468_10000007 3300031889 Bacteria 13984
132 Ga0307406_10020031 3300031901 Bacteria 3932
133 Ga0307406_11324457 3300031901 Bacteria 629
134 Ga0307406_11467739 3300031901 Bacteria 599
135 Ga0307407_10170554 3300031903 Bacteria 1433
136 Ga0307407_10285885 3300031903 Bacteria 1144
137 Ga0307407_10445085 3300031903 Bacteria 939
138 Ga0307407_11680373 3300031903 Bacteria 505
139 Ga0307412_10187917 3300031911 Bacteria 1560
140 Ga0307412_10229815 3300031911 Bacteria 1428
141 Ga0307409_100016812 3300031995 Bacteria 4854
142 Ga0307409_100051929 3300031995 Bacteria 3140
143 Ga0307409_100248207 3300031995 Bacteria 1625
144 Ga0307409_102445151 3300031995 Bacteria 551
145 Ga0307416_100030703 3300032002 Bacteria 4035
146 Ga0307416_100049671 3300032002 Bacteria 3337
147 Ga0307416_100147616 3300032002 Bacteria 2151
148 Ga0307416_102366546 3300032002 Bacteria 631
149 Ga0307414_10139297 3300032004 Bacteria 1897
150 Ga0307414_10391687 3300032004 Bacteria 1204
151 Ga0307411_10135859 3300032005 Bacteria 1805
152 Ga0307411_10462631 3300032005 Bacteria 1064
153 Ga0307411_10648330 3300032005 Bacteria 914
154 Ga0307411_11075184 3300032005 Bacteria 724
155 Ga0307415_100084023 3300032126 Bacteria 2283
156 Ga0307415_100118544 3300032126 Bacteria 1979
157 Ga0307415_100146893 3300032126 Bacteria 1809
158 Ga0307415_100939084 3300032126 Bacteria 800
159 Ga0307507_10049027 3300033179 Bacteria 4100
160 Ga0307510_10099355 3300033180 Bacteria 2709
161 Ga0307510_10353300 3300033180 Bacteria 920
162 Ga0373938_0169175 3300034957 Bacteria 591
163 Ga0373943_0890148 3300035170 Bacteria 532
164 Ga0373962_0003533 3300035242 Bacteria 3756
165 Ga0373931_1059813 3300035691 Bacteria 551
166 Ga0316584_0029364 3300036712 Bacteria 4058
167 Ga0395900_1355106 3300037418 Bacteria 625
168 Ga0395898_0176977 3300037466 Bacteria 2039
169 Ga0395905_0272607 3300037471 Bacteria 1578
170 Ga0436364_1419485 3300037853 Bacteria 1705
171 Ga0395901_0056120 3300038443 Bacteria 4097
172 Ga0395901_0720837 3300038443 Bacteria 993
173 Ga0451797_1302182 3300041453 Bacteria 714
174 Ga0451795_0255135 3300041456 Bacteria 912
175 Ga0451800_0206486 3300041459 Bacteria 740
176 Ga0451800_0767562 3300041459 Bacteria 943
177 Ga0451802_0019394 3300041460 Bacteria 622
178 Ga0451802_0285489 3300041460 Bacteria 549
179 Ga0451802_1449645 3300041460 Bacteria 536
180 Ga0451807_0735036 3300041486 Bacteria 546
181 Ga0451833_0284343 3300041491 Bacteria 1048
182 Ga0451837_0942084 3300041494 Bacteria 694
183 Ga0451845_0882158 3300041501 Bacteria 566
184 Ga0451851_0498667 3300041507 Bacteria 600
185 Ga0451853_0895106 3300041512 Bacteria 685
186 Ga0451853_2326902 3300041512 Bacteria 1656
187 Ga0451853_3931030 3300041512 Bacteria 568
188 Ga0439448_0227880 3300042005 Bacteria 656
189 Ga0466969_0384011 3300044656 Bacteria 637
190 Ga0466972_0307080 3300044658 Bacteria 741
191 Ga0466972_0417650 3300044658 Bacteria 629
192 Ga0466965_0004626 3300044683 Bacteria 6130
193 Ga0466965_0128647 3300044683 Bacteria 1312
194 Ga0466965_0571998 3300044683 Bacteria 640
195 Ga0466966_0011716 3300044684 Bacteria 5814
196 Ga0466966_0110704 3300044684 Bacteria 1693
197 Ga0466966_0179717 3300044684 Bacteria 1284
198 Ga0466966_0765184 3300044684 Bacteria 582
199 Ga0466966_0903309 3300044684 Bacteria 532
200 Ga0466961_0014823 3300044693 Bacteria 5009
201 Ga0466961_0058581 3300044693 Bacteria 2450
202 Ga0466961_0158827 3300044693 Bacteria 1409
203 Ga0466961_0308420 3300044693 Bacteria 966
204 Ga0466961_0461088 3300044693 Bacteria 769
205 Ga0466963_0020371 3300044694 Bacteria 4170
206 Ga0466963_0035543 3300044694 Bacteria 3246
207 Ga0466963_0063491 3300044694 Bacteria 2472
208 Ga0466963_0079405 3300044694 Bacteria 2220
209 Ga0466963_0103489 3300044694 Bacteria 1950
210 Ga0466963_0143094 3300044694 Bacteria 1657
211 Ga0466963_0230951 3300044694 Bacteria 1296
212 Ga0466963_0282432 3300044694 Bacteria 1167
213 Ga0466963_0336045 3300044694 Bacteria 1063
214 Ga0466963_0371634 3300044694 Bacteria 1007
215 Ga0466963_0410335 3300044694 Bacteria 955
216 Ga0466963_0545189 3300044694 Bacteria 819
217 Ga0466963_0694140 3300044694 Bacteria 718
218 Ga0466963_1243042 3300044694 Bacteria 523
219 Ga0466964_0055024 3300044706 Bacteria 1642
220 Ga0466964_0155803 3300044706 Bacteria 1063
221 Ga0466964_0158917 3300044706 Bacteria 1054
222 Ga0466971_0009731 3300044719 Bacteria 4196
223 Ga0466971_0029699 3300044719 Bacteria 2445
224 Ga0466968_0348600 3300044735 Bacteria 719
225 Ga0466970_0013226 3300044765 Bacteria 4230
226 Ga0466970_0014822 3300044765 Bacteria 4006
227 Ga0466970_0293556 3300044765 Bacteria 916
228 Ga0466970_0300024 3300044765 Bacteria 906
229 Ga0466970_0526385 3300044765 Bacteria 682
230 Ga0466957_0026087 3300044842 Bacteria 3465
231 Ga0466957_0057906 3300044842 Bacteria 2373
232 Ga0466957_0237433 3300044842 Bacteria 1209
233 Ga0466957_0298653 3300044842 Bacteria 1082
234 Ga0466957_0490599 3300044842 Bacteria 850
235 Ga0466957_0520366 3300044842 Bacteria 826
236 Ga0466957_1102528 3300044842 Bacteria 572
237 Ga0466957_1132017 3300044842 Bacteria 565
238 Ga0466960_0506490 3300044901 Bacteria 708
239 Ga0466959_0035201 3300045049 Bacteria 3705
240 Ga0466959_0065120 3300045049 Bacteria 2645
241 Ga0466959_0497979 3300045049 Bacteria 824
242 Ga0466959_0725280 3300045049 Bacteria 666
243 Ga0466959_0785301 3300045049 Bacteria 637
244 Ga0466959_0853887 3300045049 Bacteria 608
245 Ga0466958_0006833 3300045836 Bacteria 6239
246 Ga0466958_0021645 3300045836 Bacteria 3760
247 Ga0466958_0027084 3300045836 Bacteria 3391
248 Ga0466958_0275162 3300045836 Bacteria 1079
249 Ga0466958_0285593 3300045836 Bacteria 1058
250 Ga0466958_0421604 3300045836 Bacteria 863
251 Ga0466958_1073150 3300045836 Bacteria 526
252 Ga0466967_0005967 3300045976 Bacteria 8549
253 Ga0466967_0030227 3300045976 Bacteria 4544
254 Ga0466967_0050671 3300045976 Bacteria 3636
255 Ga0466967_0050736 3300045976 Bacteria 3634
256 Ga0466967_0097842 3300045976 Bacteria 2678
257 Ga0466967_0127799 3300045976 Bacteria 2356
258 Ga0466967_0131318 3300045976 Bacteria 2325
259 Ga0466967_0369672 3300045976 Bacteria 1391
260 Ga0466967_0520333 3300045976 Bacteria 1169
261 Ga0466967_0596405 3300045976 Bacteria 1090
262 Ga0466967_0779283 3300045976 Bacteria 949
263 Ga0466967_1413843 3300045976 Bacteria 693
264 Ga0495606_0006676 3300046507 Bacteria 10578
265 Ga0495632_0062904 3300046519 Bacteria 1798
266 Ga0495668_0001911 3300046616 Bacteria 18567
267 Ga0495625_0005228 3300046660 Bacteria 11947
268 Ga0495658_0269159 3300046683 Bacteria 1074
269 Ga0495649_0515006 3300046694 Bacteria 594
270 Ga0495626_0000147 3300048091 Bacteria 87994
271 Ga0496102_0006658 3300048905 Bacteria 9876
272 Ga0496103_0022379 3300048906 Bacteria 3806
273 Ga0496108_0000010 3300048911 Bacteria 273269
274 Ga0496108_1447653 3300048911 Bacteria 573
275 Ga0496112_0650366 3300048915 Bacteria 984
276 Ga0501031_0019599 3300049568 Bacteria 4406
277 Ga0501032_0009110 3300049569 Bacteria 7205
278 Ga0501032_0011980 3300049569 Bacteria 6209
279 Ga0501032_0284620 3300049569 Bacteria 1070
280 Ga0501033_0024680 3300049570 Bacteria 4533
281 Ga0501033_0519894 3300049570 Bacteria 822
282 Ga0501033_1120918 3300049570 Bacteria 523
283 Ga0501034_0085231 3300049571 Bacteria 3161
284 Ga0501034_0108792 3300049571 Bacteria 2763
285 Ga0501034_0449877 3300049571 Bacteria 1206
286 Ga0501034_1707415 3300049571 Bacteria 502
287 Ga0501036_0002299 3300049572 Bacteria 14945
288 Ga0501036_0012022 3300049572 Bacteria 7176
289 Ga0501036_0035055 3300049572 Bacteria 4245
290 Ga0501037_0002352 3300049573 Bacteria 13662
291 Ga0501037_0018608 3300049573 Bacteria 5119
292 Ga0501037_0179473 3300049573 Bacteria 1503
293 Ga0501037_0326131 3300049573 Bacteria 1062
294 Ga0501038_0001745 3300049574 Bacteria 20203
295 Ga0501038_0015697 3300049574 Bacteria 6883
296 Ga0501039_0003015 3300049575 Bacteria 12591
297 Ga0501039_0005824 3300049575 Bacteria 9331
298 Ga0501040_0000752 3300049576 Bacteria 20108
299 Ga0501041_0008513 3300049577 Bacteria 6037
300 Ga0501042_0012949 3300049578 Bacteria 5666
301 Ga0501042_0018614 3300049578 Bacteria 4811
302 Ga0501042_0073472 3300049578 Bacteria 2446
303 Ga0501043_0018956 3300049579 Bacteria 5400
304 Ga0501043_0318459 3300049579 Bacteria 1186
305 Ga0501043_0497208 3300049579 Bacteria 911
306 Ga0501046_0007911 3300049580 Bacteria 9305
307 Ga0501046_0063991 3300049580 Bacteria 2871
308 Ga0501046_0154457 3300049580 Bacteria 1730
309 Ga0501047_0038595 3300049581 Bacteria 4620
310 Ga0501047_0097588 3300049581 Bacteria 2816
311 Ga0501047_0262686 3300049581 Bacteria 1574
312 Ga0501048_0008834 3300049582 Bacteria 7590
313 Ga0501048_0018736 3300049582 Bacteria 5089
314 Ga0501068_0115943 3300049584 Bacteria 1668
315 Ga0501070_0001359 3300049586 Bacteria 21923
316 Ga0501070_0832901 3300049586 Bacteria 723
317 Ga0501070_1516824 3300049586 Bacteria 507
318 Ga0501071_0082419 3300049587 Bacteria 2355
319 Ga0501072_0012093 3300049588 Bacteria 6594
320 Ga0501073_0308182 3300049589 Bacteria 1092
321 Ga0501074_0654644 3300049590 Bacteria 742
322 Ga0501075_0054470 3300049591 Bacteria 3009
323 Ga0501076_0024395 3300049592 Bacteria 4674
324 Ga0501077_0269315 3300049593 Bacteria 1083
325 Ga0501249_159495 3300049679 Bacteria 572
326 Ga0501079_0019841 3300049741 Bacteria 5135
327 Ga0501080_0041817 3300049742 Bacteria 4269
328 Ga0501080_0517354 3300049742 Bacteria 1065
329 Ga0501081_0014923 3300049743 Bacteria 5125
330 Ga0501035_0028310 3300049822 Bacteria 5116
331 Ga0501035_0103170 3300049822 Bacteria 2501
332 Ga0501044_0221258 3300049823 Bacteria 1844
333 Ga0501044_0300025 3300049823 Bacteria 1536
334 Ga0501044_0322577 3300049823 Bacteria 1468
335 Ga0501044_0614722 3300049823 Bacteria 979
336 Ga0501045_0011334 3300049824 Bacteria 6259
337 Ga0501045_1400594 3300049824 Bacteria 508
338 nmdc:mga00v17_129883_c1 3300050491 Bacteria 1609
339 nmdc:mga05p37_7902_c1 3300050507 Bacteria 12554
340 nmdc:mga09592_112938_c1 3300050508 Bacteria 2331
341 nmdc:mga08y16_390093_c1 3300050511 Bacteria 1426
342 Ga0495655_0266519 3300053083 Bacteria 580
343 Ga0500646_0341773 3300053090 Bacteria 544
344 Ga0500583_0028427 3300053092 Bacteria 2426
345 Ga0500583_0082763 3300053092 Bacteria 1553
346 Ga0500651_0642369 3300053093 Bacteria 572
347 Ga0500650_0206952 3300053098 Bacteria 892
348 Ga0500650_0451219 3300053098 Bacteria 551
349 Ga0500569_004248 3300053109 Bacteria 3002
350 Ga0500594_0002125 3300053118 Bacteria 4282
351 Ga0500621_033141 3300053126 Bacteria 2061
352 Ga0500652_036670 3300053131 Bacteria 1953
353 Ga0500658_0547277 3300053134 Bacteria 521
354 Ga0500577_0430735 3300053142 Bacteria 577
355 Ga0500579_131086 3300053143 Bacteria 1172
356 Ga0500588_0018765 3300053146 Bacteria 1828
357 Ga0500600_0185968 3300053149 Bacteria 994
358 Ga0500630_076705 3300053159 Bacteria 1571
359 Ga0500633_0109303 3300053160 Bacteria 1023
360 Ga0500587_059016 3300053739 Bacteria 584
361 Ga0501084_0014995 3300054114 Bacteria 6426
362 Ga0501084_0186685 3300054114 Bacteria 1750
363 Ga0501082_0046357 3300060353 Bacteria 3747
364 Ga0466962_0004066 3300061719 Bacteria 7002
365 Ga0530510_0026743 3300061734 Bacteria 4131
366 Ga0307409_100208901
367 JGI25406J46586_10025105
368 JGI25406J46586_10050805
369 Ga0070658_11959910
370 Ga0070668_100012050
371 Ga0070668_101204280
372 Ga0070667_100071504
373 Ga0070667_100214752
374 Ga0070713_101103828
375 Ga0070698_100326766
376 Ga0070679_100372369
377 Ga0070684_101943043
378 Ga0068853_102271846
379 Ga0070695_101155788
380 Ga0070693_101377185
381 Ga0070665_100387670
382 Ga0068855_100031338
383 Ga0070664_101168294
384 Ga0068856_100204063
385 Ga0068856_100723596
386 Ga0068856_100879638
387 Ga0068856_101734219
388 Ga0070702_101394839
389 Ga0068852_100012765
390 Ga0068852_101722826
391 Ga0068859_100110122
392 Ga0068859_101394878
393 Ga0068860_100757615
394 Ga0068860_102109042
395 Ga0068862_100384522
396 Ga0081539_10000657
397 Ga0081539_10001151
398 Ga0081539_10093352
399 Ga0081539_10172842
400 Ga0081539_10272787
401 Ga0070717_10410684
402 Ga0075364_10082594
403 Ga0075428_100783573
404 Ga0075428_102592662
405 Ga0097620_100110125
406 Ga0097620_101394485
407 Ga0105240_11487546
408 Ga0111539_12311294
409 Ga0111539_12420797
410 Ga0105245_10785197
411 Ga0105245_11165008
412 Ga0105245_13193441
413 Ga0105241_11279140
414 Ga0105242_11596127
415 Ga0105237_10070805
416 Ga0105237_11348271
417 Ga0105237_11691235
418 Ga0105238_10883923
419 Ga0105249_10973269
420 Ga0105239_10167857
421 Ga0105239_10486260
422 Ga0105239_11386869
423 Ga0105239_11765659
424 Ga0105239_11781780
425 Ga0157371_11486796
426 Ga0157370_11120278
427 Ga0157374_12155476
428 Ga0157372_10595903
429 Ga0157380_13466404
430 Ga0157376_10602479
431 Ga0157376_12925194
432 Ga0206352_10329904
433 Ga0207688_10597206
434 Ga0207647_10123601
435 Ga0207654_10193079
436 Ga0207671_10223907
437 Ga0207671_10496612
438 Ga0207693_11272846
439 Ga0207663_11527763
440 Ga0207657_10411258
441 Ga0207652_10497340
442 Ga0207694_10188623
443 Ga0207650_10769891
444 Ga0207679_11270305
445 Ga0207667_10017723
446 Ga0207668_10027581
447 Ga0207668_10505576
448 Ga0207658_10301058
449 Ga0207639_11691049
450 Ga0207702_10204773
451 Ga0207702_11060832
452 Ga0207702_11610482
453 Ga0207648_10730896
454 Ga0207676_11191185
455 Ga0207683_10193152
456 Ga0207698_10003818
457 Ga0207698_10718455
458 Ga0207698_11843858
459 Ga0268266_10824357
460 Ga0268265_10090761
461 Ga0268264_10254501
462 Ga0268264_11677354
463 Ga0307517_10038845
464 Ga0307515_10013547
465 Ga0307515_10098109
466 Ga0307515_10102202
467 Ga0307512_10028842
468 Ga0307512_10036047
469 Ga0316177_1049009
470 Ga0314311_1001602
471 Ga0316181_1138754
472 Ga0316182_1016243
473 Ga0307513_10025375
474 Ga0307513_10177236
475 Ga0307513_10245822
476 Ga0307513_10539394
477 Ga0307509_10039956
478 Ga0307408_100035231
479 Ga0307508_10020399
480 Ga0307508_10042208
481 Ga0307508_10237862
482 Ga0316576_10006620
483 Ga0307516_10029583
484 Ga0307516_10059360
485 Ga0307516_10273368
486 Ga0307516_10680485
487 Ga0307516_10703418
488 Ga0307405_10042817
489 Ga0307413_10016423
490 Ga0307413_10610378
491 Ga0307413_11047145
492 Ga0307413_11727243
493 Ga0307410_10026557
494 Ga0307410_10605063
495 Ga0307410_11647740
496 Ga0326468_10000007
497 Ga0307406_10020031
498 Ga0307406_11324457
499 Ga0307406_11467739
500 Ga0307407_10170554
501 Ga0307407_10285885
502 Ga0307407_10445085
503 Ga0307407_11680373
504 Ga0307412_10187917
505 Ga0307412_10229815
506 Ga0307409_100016812
507 Ga0307409_100051929
508 Ga0307409_100248207
509 Ga0307409_102445151
510 Ga0307416_100030703
511 Ga0307416_100049671
512 Ga0307416_100147616
513 Ga0307416_102366546
514 Ga0307414_10139297
515 Ga0307414_10391687
516 Ga0307411_10135859
517 Ga0307411_10462631
518 Ga0307411_10648330
519 Ga0307411_11075184
520 Ga0307415_100084023
521 Ga0307415_100118544
522 Ga0307415_100146893
523 Ga0307415_100939084
524 Ga0307507_10049027
525 Ga0307510_10099355
526 Ga0307510_10353300
527 Ga0373938_0169175
528 Ga0373943_0890148
529 Ga0373962_0003533
530 Ga0373931_1059813
531 Ga0316584_0029364
532 Ga0395900_1355106
533 Ga0395898_0176977
534 Ga0395905_0272607
535 Ga0436364_1419485
536 Ga0395901_0056120
537 Ga0395901_0720837
538 Ga0451797_1302182
539 Ga0451795_0255135
540 Ga0451800_0206486
541 Ga0451800_0767562
542 Ga0451802_0019394
543 Ga0451802_0285489
544 Ga0451802_1449645
545 Ga0451807_0735036
546 Ga0451833_0284343
547 Ga0451837_0942084
548 Ga0451845_0882158
549 Ga0451851_0498667
550 Ga0451853_0895106
551 Ga0451853_2326902
552 Ga0451853_3931030
553 Ga0439448_0227880
554 Ga0466969_0384011
555 Ga0466972_0307080
556 Ga0466972_0417650
557 Ga0466965_0004626
558 Ga0466965_0128647
559 Ga0466965_0571998
560 Ga0466966_0011716
561 Ga0466966_0110704
562 Ga0466966_0179717
563 Ga0466966_0765184
564 Ga0466966_0903309
565 Ga0466961_0014823
566 Ga0466961_0058581
567 Ga0466961_0158827
568 Ga0466961_0308420
569 Ga0466961_0461088
570 Ga0466963_0020371
571 Ga0466963_0035543
572 Ga0466963_0063491
573 Ga0466963_0079405
574 Ga0466963_0103489
575 Ga0466963_0143094
576 Ga0466963_0230951
577 Ga0466963_0282432
578 Ga0466963_0336045
579 Ga0466963_0371634
580 Ga0466963_0410335
581 Ga0466963_0545189
582 Ga0466963_0694140
583 Ga0466963_1243042
584 Ga0466964_0055024
585 Ga0466964_0155803
586 Ga0466964_0158917
587 Ga0466971_0009731
588 Ga0466971_0029699
589 Ga0466968_0348600
590 Ga0466970_0013226
591 Ga0466970_0014822
592 Ga0466970_0293556
593 Ga0466970_0300024
594 Ga0466970_0526385
595 Ga0466957_0026087
596 Ga0466957_0057906
597 Ga0466957_0237433
598 Ga0466957_0298653
599 Ga0466957_0490599
600 Ga0466957_0520366
601 Ga0466957_1102528
602 Ga0466957_1132017
603 Ga0466960_0506490
604 Ga0466959_0035201
605 Ga0466959_0065120
606 Ga0466959_0497979
607 Ga0466959_0725280
608 Ga0466959_0785301
609 Ga0466959_0853887
610 Ga0466958_0006833
611 Ga0466958_0021645
612 Ga0466958_0027084
613 Ga0466958_0275162
614 Ga0466958_0285593
615 Ga0466958_0421604
616 Ga0466958_1073150
617 Ga0466967_0005967
618 Ga0466967_0030227
619 Ga0466967_0050671
620 Ga0466967_0050736
621 Ga0466967_0097842
622 Ga0466967_0127799
623 Ga0466967_0131318
624 Ga0466967_0369672
625 Ga0466967_0520333
626 Ga0466967_0596405
627 Ga0466967_0779283
628 Ga0466967_1413843
629 Ga0495606_0006676
630 Ga0495632_0062904
631 Ga0495668_0001911
632 Ga0495625_0005228
633 Ga0495658_0269159
634 Ga0495649_0515006
635 Ga0495626_0000147
636 Ga0496102_0006658
637 Ga0496103_0022379
638 Ga0496108_0000010
639 Ga0496108_1447653
640 Ga0496112_0650366
641 Ga0501031_0019599
642 Ga0501032_0009110
643 Ga0501032_0011980
644 Ga0501032_0284620
645 Ga0501033_0024680
646 Ga0501033_0519894
647 Ga0501033_1120918
648 Ga0501034_0085231
649 Ga0501034_0108792
650 Ga0501034_0449877
651 Ga0501034_1707415
652 Ga0501036_0002299
653 Ga0501036_0012022
654 Ga0501036_0035055
655 Ga0501037_0002352
656 Ga0501037_0018608
657 Ga0501037_0179473
658 Ga0501037_0326131
659 Ga0501038_0001745
660 Ga0501038_0015697
661 Ga0501039_0003015
662 Ga0501039_0005824
663 Ga0501040_0000752
664 Ga0501041_0008513
665 Ga0501042_0012949
666 Ga0501042_0018614
667 Ga0501042_0073472
668 Ga0501043_0018956
669 Ga0501043_0318459
670 Ga0501043_0497208
671 Ga0501046_0007911
672 Ga0501046_0063991
673 Ga0501046_0154457
674 Ga0501047_0038595
675 Ga0501047_0097588
676 Ga0501047_0262686
677 Ga0501048_0008834
678 Ga0501048_0018736
679 Ga0501068_0115943
680 Ga0501070_0001359
681 Ga0501070_0832901
682 Ga0501070_1516824
683 Ga0501071_0082419
684 Ga0501072_0012093
685 Ga0501073_0308182
686 Ga0501074_0654644
687 Ga0501075_0054470
688 Ga0501076_0024395
689 Ga0501077_0269315
690 Ga0501249_159495
691 Ga0501079_0019841
692 Ga0501080_0041817
693 Ga0501080_0517354
694 Ga0501081_0014923
695 Ga0501035_0028310
696 Ga0501035_0103170
697 Ga0501044_0221258
698 Ga0501044_0300025
699 Ga0501044_0322577
700 Ga0501044_0614722
701 Ga0501045_0011334
702 Ga0501045_1400594
703 nmdc:mga00v17_129883_c1
704 nmdc:mga05p37_7902_c1
705 nmdc:mga09592_112938_c1
706 nmdc:mga08y16_390093_c1
707 Ga0495655_0266519
708 Ga0500646_0341773
709 Ga0500583_0028427
710 Ga0500583_0082763
711 Ga0500651_0642369
712 Ga0500650_0206952
713 Ga0500650_0451219
714 Ga0500569_004248
715 Ga0500594_0002125
716 Ga0500621_033141
717 Ga0500652_036670
718 Ga0500658_0547277
719 Ga0500577_0430735
720 Ga0500579_131086
721 Ga0500588_0018765
722 Ga0500600_0185968
723 Ga0500630_076705
724 Ga0500633_0109303
725 Ga0500587_059016
726 Ga0501084_0014995
727 Ga0501084_0186685
728 Ga0501082_0046357
729 Ga0466962_0004066
730 Ga0530510_0026743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19599

DUF6104

Family of unknown function (DUF6104)

11

68

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rmg-assembly1.cif.gz_G substance p bound to active human neurokinin 1 receptor in complex with minigs/q70 0.5442 6 38
7rmg-assembly1.cif.gz_G substance p bound to active human neurokinin 1 receptor in complex with minigs/q70 0.4743 6 38
ID Description Score Start End Superfamily
af_Q6SJR1_81_145_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.8972 18 54 1.25.40.90
1wpbN01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.6871 25 55 1.10.287.680
1wpbM01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.669 25 55 1.10.287.680
1wpbJ01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.666 25 55 1.10.287.680
1wpbB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.663 25 55 1.10.287.680
ID Description Score Start End GO Terms
AF-A0A1Q4VF84-F1-model_v4 Uncharacterized protein 0.9812 2 56
AF-A0A1H0LAN7-F1-model_v4 Uncharacterized protein 0.9675 2 56
AF-A0A1H9RIF3-F1-model_v4 Uncharacterized protein 0.9613 1 57
AF-A0A239WRH2-F1-model_v4 Uncharacterized protein 0.9601 1 57
AF-A0A2T0GVV2-F1-model_v4 Uncharacterized protein 0.9576 1 51

Map