F423706

General Info

Members Datasets Scaffolds Average Seq Length
365 229 730 97

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10000630|Ga0207646_100006307
Length 117
Sequence VVIGKEQLTTDHWQLTTDKTMARSVKKGPFVDDHLMKAIVRMNETRDKKVHKTWSRRSTITPEMVGHTIAVHNGKKFIPVYITENMVGHKFGEFAPTRTFKGHSEKAEKSAAAAPKK

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
84 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
85 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 3.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 3.01
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10000630 3300025922 Bacteria 45810
2 MBSR1b_contig_8750419 2162886012 Bacteria 1158
3 rootH2_10067636 3300003320 Bacteria 1193
4 Ga0065715_10371594 3300005293 Bacteria 920
5 Ga0065707_10875988 3300005295 Bacteria 574
6 Ga0070658_10019025 3300005327 Bacteria 5501
7 Ga0070676_11598424 3300005328 Bacteria 504
8 Ga0070683_100388356 3300005329 Bacteria 1330
9 Ga0070683_100763598 3300005329 Bacteria 926
10 Ga0070690_100649017 3300005330 Bacteria 806
11 Ga0070670_100006072 3300005331 Bacteria 10217
12 Ga0070677_10010860 3300005333 Bacteria 3126
13 Ga0068869_100329016 3300005334 Bacteria 1241
14 Ga0068869_100338740 3300005334 Bacteria 1223
15 Ga0070666_10216956 3300005335 Bacteria 1348
16 Ga0070666_10292633 3300005335 Bacteria 1159
17 Ga0070680_100336507 3300005336 Bacteria 1282
18 Ga0070680_100433830 3300005336 Bacteria 1121
19 Ga0070660_100099153 3300005339 Bacteria 2307
20 Ga0070660_100934697 3300005339 Bacteria 732
21 Ga0070689_100051828 3300005340 Bacteria 3173
22 Ga0070687_100415462 3300005343 Bacteria 886
23 Ga0070661_100059332 3300005344 Bacteria 2805
24 Ga0070661_100266887 3300005344 Bacteria 1324
25 Ga0070661_100726439 3300005344 Bacteria 811
26 Ga0070668_100745724 3300005347 Bacteria 866
27 Ga0070668_101366205 3300005347 Bacteria 645
28 Ga0070669_100002919 3300005353 Bacteria 12314
29 Ga0070669_100114495 3300005353 Bacteria 2050
30 Ga0070669_100645766 3300005353 Bacteria 890
31 Ga0070669_100871930 3300005353 Bacteria 768
32 Ga0070675_100020814 3300005354 Bacteria 5235
33 Ga0070675_100074840 3300005354 Bacteria 2814
34 Ga0070671_100164348 3300005355 Bacteria 1877
35 Ga0070673_100157160 3300005364 Bacteria 1931
36 Ga0070673_100262945 3300005364 Bacteria 1508
37 Ga0070688_100024432 3300005365 Bacteria 3566
38 Ga0070659_100026205 3300005366 Bacteria 4484
39 Ga0070659_100234388 3300005366 Bacteria 1517
40 Ga0070667_100045803 3300005367 Bacteria 3679
41 Ga0070667_100114238 3300005367 Bacteria 2344
42 Ga0070703_10102265 3300005406 Bacteria 1012
43 Ga0070714_100298825 3300005435 Bacteria 1500
44 Ga0070701_10132169 3300005438 Bacteria 1419
45 Ga0070705_101222600 3300005440 Bacteria 620
46 Ga0070678_100333000 3300005456 Bacteria 1300
47 Ga0070662_100103201 3300005457 Bacteria 2162
48 Ga0070662_100157394 3300005457 Bacteria 1774
49 Ga0070662_100224642 3300005457 Bacteria 1500
50 Ga0070662_101190041 3300005457 Bacteria 655
51 Ga0070681_10005840 3300005458 Bacteria 11918
52 Ga0070681_10300034 3300005458 Bacteria 1516
53 Ga0070685_10003884 3300005466 Bacteria 7554
54 Ga0070706_100037299 3300005467 Bacteria 4490
55 Ga0070698_100031923 3300005471 Bacteria 5458
56 Ga0070699_100217133 3300005518 Bacteria 1703
57 Ga0070679_100296615 3300005530 Bacteria 1568
58 Ga0070679_100598960 3300005530 Bacteria 1045
59 Ga0070679_100806554 3300005530 Bacteria 882
60 Ga0070679_100933238 3300005530 Bacteria 811
61 Ga0070684_100050678 3300005535 Bacteria 3606
62 Ga0070697_100092728 3300005536 Bacteria 2500
63 Ga0068853_100200513 3300005539 Bacteria 1816
64 Ga0068853_100709607 3300005539 Bacteria 960
65 Ga0070672_100035129 3300005543 Bacteria 3808
66 Ga0070672_100106794 3300005543 Bacteria 2278
67 Ga0070672_100455332 3300005543 Bacteria 1102
68 Ga0070672_101097247 3300005543 Bacteria 707
69 Ga0070686_100114426 3300005544 Bacteria 1843
70 Ga0070696_100421193 3300005546 Bacteria 1048
71 Ga0070665_100053131 3300005548 Bacteria 4063
72 Ga0070665_100666575 3300005548 Bacteria 1053
73 Ga0068855_100006029 3300005563 Bacteria 14785
74 Ga0068855_100037664 3300005563 Bacteria 5749
75 Ga0068855_100507665 3300005563 Bacteria 1309
76 Ga0070664_100037620 3300005564 Bacteria 4069
77 Ga0070664_100155871 3300005564 Bacteria 2018
78 Ga0070664_100352739 3300005564 Bacteria 1338
79 Ga0070664_100534053 3300005564 Bacteria 1084
80 Ga0068857_100063642 3300005577 Bacteria 3279
81 Ga0068857_100781509 3300005577 Bacteria 911
82 Ga0068857_101084197 3300005577 Bacteria 773
83 Ga0068857_101366005 3300005577 Bacteria 689
84 Ga0068854_100029686 3300005578 Bacteria 3787
85 Ga0068854_100107822 3300005578 Bacteria 2097
86 Ga0068856_100007358 3300005614 Bacteria 10744
87 Ga0068856_100032953 3300005614 Bacteria 5074
88 Ga0068856_100295673 3300005614 Bacteria 1636
89 Ga0068852_100271599 3300005616 Bacteria 1632
90 Ga0068859_100000703 3300005617 Bacteria 33591
91 Ga0068859_100747455 3300005617 Bacteria 1067
92 Ga0068859_100850160 3300005617 Bacteria 998
93 Ga0068864_100031613 3300005618 Bacteria 4493
94 Ga0068864_102105562 3300005618 Bacteria 570
95 Ga0068866_10564701 3300005718 Bacteria 763
96 Ga0068861_100184294 3300005719 Bacteria 1740
97 Ga0068861_100233674 3300005719 Bacteria 1560
98 Ga0068861_100358006 3300005719 Bacteria 1282
99 Ga0068851_10024482 3300005834 Bacteria 2956
100 Ga0068870_10008502 3300005840 Bacteria 4621
101 Ga0068858_100351873 3300005842 Bacteria 1411
102 Ga0068860_101780408 3300005843 Bacteria 638
103 Ga0068862_100018672 3300005844 Bacteria 5776
104 Ga0081455_10090796 3300005937 Bacteria 2475
105 Ga0081455_11059781 3300005937 Bacteria 501
106 Ga0081538_10022140 3300005981 Bacteria 4616
107 Ga0081538_10034533 3300005981 Bacteria 3341
108 Ga0081539_10004359 3300005985 Bacteria 15776
109 Ga0075366_10267511 3300006195 Bacteria 1044
110 Ga0075428_100276858 3300006844 Bacteria 1805
111 Ga0075428_100597649 3300006844 Bacteria 1179
112 Ga0075428_102448038 3300006844 Bacteria 535
113 Ga0075431_100046193 3300006847 Bacteria 4490
114 Ga0075431_100080573 3300006847 Bacteria 3361
115 Ga0075434_100168248 3300006871 Bacteria 2212
116 Ga0075434_101150220 3300006871 Bacteria 789
117 Ga0075429_100328603 3300006880 Bacteria 1338
118 Ga0068865_100005424 3300006881 Bacteria 7732
119 Ga0068865_101249357 3300006881 Bacteria 659
120 Ga0097620_100000703 3300006931 Bacteria 33591
121 Ga0097620_100747466 3300006931 Bacteria 1067
122 Ga0097620_100850196 3300006931 Bacteria 998
123 Ga0075435_100978044 3300007076 Bacteria 739
124 Ga0105240_10034110 3300009093 Bacteria 6568
125 Ga0105240_11166762 3300009093 Bacteria 817
126 Ga0111539_10109827 3300009094 Bacteria 3236
127 Ga0111539_12038236 3300009094 Bacteria 665
128 Ga0105245_10927007 3300009098 Bacteria 913
129 Ga0105247_10870515 3300009101 Bacteria 693
130 Ga0105247_11868761 3300009101 Bacteria 502
131 Ga0105243_10817570 3300009148 Bacteria 920
132 Ga0105241_10266943 3300009174 Bacteria 1456
133 Ga0105241_11680871 3300009174 Bacteria 616
134 Ga0105248_10000094 3300009177 Bacteria 98558
135 Ga0105248_10003761 3300009177 Bacteria 16804
136 Ga0105248_10103789 3300009177 Bacteria 3204
137 Ga0105248_11768084 3300009177 Bacteria 701
138 Ga0105237_10388495 3300009545 Bacteria 1400
139 Ga0105237_11741089 3300009545 Bacteria 631
140 Ga0105238_11707560 3300009551 Bacteria 661
141 Ga0105249_10227475 3300009553 Bacteria 1838
142 Ga0105249_10263117 3300009553 Bacteria 1715
143 Ga0105249_10827606 3300009553 Bacteria 990
144 Ga0105249_12281955 3300009553 Bacteria 614
145 Ga0105239_10659581 3300010375 Bacteria 1195
146 Ga0105239_11875738 3300010375 Bacteria 695
147 Ga0105239_12307033 3300010375 Bacteria 626
148 Ga0157321_1038404 3300012487 Bacteria 518
149 Ga0157345_1011780 3300012498 Bacteria 781
150 Ga0157327_1038028 3300012512 Bacteria 634
151 Ga0157373_10280377 3300013100 Bacteria 1181
152 Ga0157370_10057777 3300013104 Bacteria 3688
153 Ga0157370_10270892 3300013104 Bacteria 1569
154 Ga0157370_10504576 3300013104 Bacteria 1111
155 Ga0157369_10071201 3300013105 Bacteria 3733
156 Ga0157374_12416542 3300013296 Bacteria 553
157 Ga0157378_12407458 3300013297 Bacteria 578
158 Ga0163162_10326194 3300013306 Bacteria 1668
159 Ga0157372_10161930 3300013307 Bacteria 2586
160 Ga0157372_10831980 3300013307 Bacteria 1072
161 Ga0157375_10012356 3300013308 Bacteria 7571
162 Ga0157375_10315742 3300013308 Bacteria 1727
163 Ga0157375_10390176 3300013308 Bacteria 1559
164 Ga0157375_11368315 3300013308 Bacteria 833
165 Ga0157380_10001355 3300014326 Bacteria 15948
166 Ga0157380_10235140 3300014326 Bacteria 1648
167 Ga0157380_11364706 3300014326 Bacteria 758
168 Ga0182008_10104693 3300014497 Bacteria 1400
169 Ga0157377_10016185 3300014745 Bacteria 3832
170 Ga0157377_10163648 3300014745 Bacteria 1386
171 Ga0157379_10765157 3300014968 Bacteria 910
172 Ga0157376_10995346 3300014969 Bacteria 861
173 Ga0157376_11206535 3300014969 Bacteria 785
174 Ga0163161_10277580 3300017792 Bacteria 1313
175 Ga0163161_10291980 3300017792 Bacteria 1282
176 Ga0163161_10634724 3300017792 Bacteria 884
177 Ga0207656_10010726 3300025321 Bacteria 3441
178 Ga0207682_10001734 3300025893 Bacteria 10002
179 Ga0207680_10091447 3300025903 Bacteria 1936
180 Ga0207699_10841127 3300025906 Bacteria 676
181 Ga0207643_10001235 3300025908 Bacteria 15094
182 Ga0207705_10004644 3300025909 Bacteria 10363
183 Ga0207654_10222725 3300025911 Bacteria 1252
184 Ga0207707_10004838 3300025912 Bacteria 11811
185 Ga0207707_10338154 3300025912 Bacteria 1298
186 Ga0207695_10065096 3300025913 Bacteria 3749
187 Ga0207671_10131102 3300025914 Bacteria 1924
188 Ga0207660_10202962 3300025917 Bacteria 1549
189 Ga0207660_11083586 3300025917 Bacteria 653
190 Ga0207660_11505402 3300025917 Bacteria 544
191 Ga0207657_10010473 3300025919 Bacteria 9250
192 Ga0207652_10038455 3300025921 Bacteria 4056
193 Ga0207652_10336231 3300025921 Bacteria 1363
194 Ga0207646_10291431 3300025922 Bacteria 1475
195 Ga0207681_10061548 3300025923 Bacteria 2581
196 Ga0207681_10268421 3300025923 Bacteria 1338
197 Ga0207681_10669806 3300025923 Bacteria 861
198 Ga0207694_10254871 3300025924 Bacteria 1436
199 Ga0207650_10071878 3300025925 Bacteria 2603
200 Ga0207659_10001705 3300025926 Bacteria 13041
201 Ga0207659_10087747 3300025926 Bacteria 2316
202 Ga0207700_10606370 3300025928 Bacteria 974
203 Ga0207664_10247560 3300025929 Bacteria 1554
204 Ga0207644_10074382 3300025931 Bacteria 2493
205 Ga0207690_10038202 3300025932 Bacteria 3123
206 Ga0207706_10013582 3300025933 Bacteria 7398
207 Ga0207706_10029742 3300025933 Bacteria 4875
208 Ga0207706_10064180 3300025933 Bacteria 3233
209 Ga0207706_10494624 3300025933 Bacteria 1056
210 Ga0207706_10766646 3300025933 Bacteria 821
211 Ga0207670_10040034 3300025936 Bacteria 3074
212 Ga0207670_10398008 3300025936 Bacteria 1100
213 Ga0207704_10286751 3300025938 Bacteria 1254
214 Ga0207691_10000326 3300025940 Bacteria 47354
215 Ga0207691_10132522 3300025940 Bacteria 2200
216 Ga0207691_11395710 3300025940 Bacteria 576
217 Ga0207711_10000086 3300025941 Bacteria 99422
218 Ga0207711_10038186 3300025941 Bacteria 4082
219 Ga0207711_10068612 3300025941 Bacteria 3071
220 Ga0207689_10088286 3300025942 Bacteria 2547
221 Ga0207689_11423452 3300025942 Bacteria 580
222 Ga0207661_10299844 3300025944 Bacteria 1440
223 Ga0207661_10458114 3300025944 Bacteria 1162
224 Ga0207679_10191685 3300025945 Bacteria 1700
225 Ga0207679_10301104 3300025945 Bacteria 1382
226 Ga0207667_10000358 3300025949 Bacteria 61982
227 Ga0207667_10003792 3300025949 Bacteria 18611
228 Ga0207667_10953363 3300025949 Bacteria 847
229 Ga0207651_10170236 3300025960 Bacteria 1717
230 Ga0207712_10458083 3300025961 Bacteria 1083
231 Ga0207712_10838393 3300025961 Bacteria 810
232 Ga0207712_10910618 3300025961 Bacteria 777
233 Ga0207668_10018999 3300025972 Bacteria 4334
234 Ga0207668_11450012 3300025972 Bacteria 619
235 Ga0207668_11631059 3300025972 Bacteria 582
236 Ga0207640_10073287 3300025981 Bacteria 2313
237 Ga0207640_10347710 3300025981 Bacteria 1190
238 Ga0207658_10257021 3300025986 Bacteria 1487
239 Ga0207703_10663497 3300026035 Bacteria 990
240 Ga0207639_10272484 3300026041 Bacteria 1485
241 Ga0207639_10359683 3300026041 Bacteria 1302
242 Ga0207639_10424686 3300026041 Bacteria 1202
243 Ga0207678_10039314 3300026067 Bacteria 4106
244 Ga0207641_10425224 3300026088 Bacteria 1280
245 Ga0207641_11432657 3300026088 Bacteria 692
246 Ga0207648_10159182 3300026089 Bacteria 1994
247 Ga0207676_10079574 3300026095 Bacteria 2658
248 Ga0207674_10001292 3300026116 Bacteria 32705
249 Ga0207674_10907684 3300026116 Bacteria 849
250 Ga0207674_10998027 3300026116 Bacteria 806
251 Ga0207674_11424208 3300026116 Bacteria 662
252 Ga0207675_100012794 3300026118 Bacteria 7839
253 Ga0207675_100193010 3300026118 Bacteria 1954
254 Ga0207683_10088877 3300026121 Bacteria 2750
255 Ga0207683_10607638 3300026121 Bacteria 1012
256 Ga0207698_10002128 3300026142 Bacteria 11685
257 Ga0207698_10419460 3300026142 Bacteria 1284
258 Ga0207698_10540894 3300026142 Bacteria 1140
259 Ga0209996_1031164 3300027395 Bacteria 775
260 Ga0209995_1004784 3300027471 Bacteria 2174
261 Ga0209999_1023410 3300027543 Bacteria 1138
262 Ga0209983_1026354 3300027665 Bacteria 1230
263 Ga0209971_1019246 3300027682 Bacteria 1621
264 Ga0209966_1087508 3300027695 Bacteria 695
265 Ga0209974_10005588 3300027876 Bacteria 4414
266 Ga0207428_10036808 3300027907 Bacteria 3987
267 Ga0268266_10120603 3300028379 Bacteria 2333
268 Ga0268265_10172749 3300028380 Bacteria 1849
269 Ga0268265_10293937 3300028380 Bacteria 1459
270 Ga0268264_10078205 3300028381 Bacteria 2819
271 Ga0268264_11704465 3300028381 Bacteria 641
272 Ga0268264_12366802 3300028381 Bacteria 537
273 Ga0307408_100930963 3300031548 Bacteria 797
274 Ga0316576_10670257 3300031727 Bacteria 753
275 Ga0316577_10087979 3300031733 Bacteria 1738
276 Ga0307406_10735648 3300031901 Bacteria 827
277 Ga0316593_10028615 3300032168 Bacteria 1797
278 Ga0316593_10119224 3300032168 Bacteria 947
279 Ga0316593_10445490 3300032168 Bacteria 505
280 Ga0373943_0456952 3300035170 Bacteria 743
281 Ga0316574_0011365 3300035398 Bacteria 5058
282 Ga0316584_0000010 3300036712 Bacteria 65029
283 Ga0395901_0537773 3300038443 Bacteria 1185
284 Ga0400487_11562 3300039110 Bacteria 1392
285 Ga0451793_0047399 3300041452 Bacteria 540
286 Ga0451807_2299364 3300041486 Bacteria 646
287 Ga0451853_3304737 3300041512 Bacteria 634
288 Ga0439434_0368870 3300042435 Bacteria 503
289 Ga0466963_0238734 3300044694 Bacteria 1274
290 Ga0453684_2117492 3300044712 Bacteria 564
291 Ga0466959_0496972 3300045049 Bacteria 825
292 Ga0495642_0161787 3300046528 Bacteria 971
293 Ga0495621_0200403 3300046539 Bacteria 803
294 Ga0495635_0498625 3300046663 Bacteria 802
295 Ga0495669_0559059 3300046684 Bacteria 557
296 Ga0496100_0118443 3300048903 Bacteria 1850
297 Ga0496101_0947454 3300048904 Bacteria 677
298 Ga0496102_0599270 3300048905 Bacteria 1025
299 Ga0496106_0191558 3300048909 Bacteria 1626
300 Ga0496107_0563058 3300048910 Bacteria 844
301 Ga0496108_1355413 3300048911 Bacteria 596
302 Ga0496111_1196976 3300048914 Bacteria 538
303 Ga0496112_1771417 3300048915 Bacteria 530
304 Ga0496114_1364561 3300048917 Bacteria 596
305 Ga0501031_0260977 3300049568 Bacteria 1126
306 Ga0501033_0444866 3300049570 Bacteria 901
307 Ga0501036_0033541 3300049572 Bacteria 4341
308 Ga0501036_0241767 3300049572 Bacteria 1514
309 Ga0501038_0247530 3300049574 Bacteria 1413
310 Ga0501039_0076801 3300049575 Bacteria 2597
311 Ga0501041_0223596 3300049577 Bacteria 1181
312 Ga0501042_0020339 3300049578 Bacteria 4619
313 Ga0501042_0049023 3300049578 Bacteria 3012
314 Ga0501046_0264929 3300049580 Bacteria 1262
315 Ga0501048_0112880 3300049582 Bacteria 1919
316 Ga0501048_0181575 3300049582 Bacteria 1492
317 Ga0501048_0353358 3300049582 Bacteria 1048
318 Ga0501048_1022335 3300049582 Bacteria 595
319 Ga0501070_0020844 3300049586 Bacteria 5499
320 Ga0501071_0004203 3300049587 Bacteria 9116
321 Ga0501071_0042308 3300049587 Bacteria 3264
322 Ga0501071_0342073 3300049587 Bacteria 1138
323 Ga0501072_0060525 3300049588 Bacteria 2986
324 Ga0501073_0165962 3300049589 Bacteria 1529
325 Ga0501075_0014965 3300049591 Bacteria 5565
326 Ga0501076_0006741 3300049592 Bacteria 8331
327 Ga0501076_0008777 3300049592 Bacteria 7427
328 Ga0501079_0165934 3300049741 Bacteria 1722
329 Ga0501080_0173236 3300049742 Bacteria 1989
330 Ga0501080_0424918 3300049742 Bacteria 1193
331 Ga0501081_0011857 3300049743 Bacteria 5710
332 Ga0501083_0928851 3300049744 Bacteria 566
333 Ga0501044_0142380 3300049823 Bacteria 2386
334 nmdc:mga03683_82203_c1 3300050489 Bacteria 1392
335 nmdc:mga0k408_280269_c1 3300050493 Bacteria 995
336 nmdc:mga05p37_148053_c1 3300050507 Bacteria 2873
337 nmdc:mga09592_724668_c1 3300050508 Bacteria 845
338 nmdc:mga0qj67_613708_c1 3300050509 Bacteria 869
339 nmdc:mga06r32_17483_c1 3300050510 Bacteria 6545
340 nmdc:mga06r32_282310_c1 3300050510 Bacteria 1647
341 nmdc:mga06r32_32387_c1 3300050510 Bacteria 4918
342 nmdc:mga08y16_84674_c1 3300050511 Bacteria 3305
343 nmdc:mga08y16_906356_c1 3300050511 Bacteria 867
344 nmdc:mga0n895_1929770_c1 3300050512 Bacteria 549
345 nmdc:mga0rr50_285305_c1 3300050513 Bacteria 1378
346 nmdc:mga0a205_312777_c1 3300050515 Bacteria 1442
347 Ga0500572_055197 3300053111 Bacteria 1194
348 Ga0500595_022321 3300053119 Bacteria 2243
349 Ga0500627_0428950 3300053158 Bacteria 559
350 Ga0501084_0128985 3300054114 Bacteria 2129
351 Ga0501084_0148157 3300054114 Bacteria 1977
352 Ga0587070_231481 3300059491 Bacteria 506
353 Ga0587085_006211 3300059506 Bacteria 1444
354 Ga0587091_034232 3300059511 Bacteria 970
355 Ga0587109_029386 3300059624 Bacteria 1034
356 Ga0587109_146732 3300059624 Bacteria 580
357 Ga0587115_094912 3300059626 Bacteria 546
358 Ga0587069_097996 3300059642 Bacteria 595
359 Ga0587110_031287 3300059654 Bacteria 650
360 Ga0587111_0099218 3300060346 Bacteria 723
361 Ga0501082_0058018 3300060353 Bacteria 3335
362 Ga0501082_0063820 3300060353 Bacteria 3171
363 Ga0530510_0006698 3300061734 Bacteria 8032
364 Ga0530510_0198711 3300061734 Bacteria 1489
365 Ga0530510_0213321 3300061734 Bacteria 1434
366 Ga0207646_10000630
367 MBSR1b_contig_8750419
368 rootH2_10067636
369 Ga0065715_10371594
370 Ga0065707_10875988
371 Ga0070658_10019025
372 Ga0070676_11598424
373 Ga0070683_100388356
374 Ga0070683_100763598
375 Ga0070690_100649017
376 Ga0070670_100006072
377 Ga0070677_10010860
378 Ga0068869_100329016
379 Ga0068869_100338740
380 Ga0070666_10216956
381 Ga0070666_10292633
382 Ga0070680_100336507
383 Ga0070680_100433830
384 Ga0070660_100099153
385 Ga0070660_100934697
386 Ga0070689_100051828
387 Ga0070687_100415462
388 Ga0070661_100059332
389 Ga0070661_100266887
390 Ga0070661_100726439
391 Ga0070668_100745724
392 Ga0070668_101366205
393 Ga0070669_100002919
394 Ga0070669_100114495
395 Ga0070669_100645766
396 Ga0070669_100871930
397 Ga0070675_100020814
398 Ga0070675_100074840
399 Ga0070671_100164348
400 Ga0070673_100157160
401 Ga0070673_100262945
402 Ga0070688_100024432
403 Ga0070659_100026205
404 Ga0070659_100234388
405 Ga0070667_100045803
406 Ga0070667_100114238
407 Ga0070703_10102265
408 Ga0070714_100298825
409 Ga0070701_10132169
410 Ga0070705_101222600
411 Ga0070678_100333000
412 Ga0070662_100103201
413 Ga0070662_100157394
414 Ga0070662_100224642
415 Ga0070662_101190041
416 Ga0070681_10005840
417 Ga0070681_10300034
418 Ga0070685_10003884
419 Ga0070706_100037299
420 Ga0070698_100031923
421 Ga0070699_100217133
422 Ga0070679_100296615
423 Ga0070679_100598960
424 Ga0070679_100806554
425 Ga0070679_100933238
426 Ga0070684_100050678
427 Ga0070697_100092728
428 Ga0068853_100200513
429 Ga0068853_100709607
430 Ga0070672_100035129
431 Ga0070672_100106794
432 Ga0070672_100455332
433 Ga0070672_101097247
434 Ga0070686_100114426
435 Ga0070696_100421193
436 Ga0070665_100053131
437 Ga0070665_100666575
438 Ga0068855_100006029
439 Ga0068855_100037664
440 Ga0068855_100507665
441 Ga0070664_100037620
442 Ga0070664_100155871
443 Ga0070664_100352739
444 Ga0070664_100534053
445 Ga0068857_100063642
446 Ga0068857_100781509
447 Ga0068857_101084197
448 Ga0068857_101366005
449 Ga0068854_100029686
450 Ga0068854_100107822
451 Ga0068856_100007358
452 Ga0068856_100032953
453 Ga0068856_100295673
454 Ga0068852_100271599
455 Ga0068859_100000703
456 Ga0068859_100747455
457 Ga0068859_100850160
458 Ga0068864_100031613
459 Ga0068864_102105562
460 Ga0068866_10564701
461 Ga0068861_100184294
462 Ga0068861_100233674
463 Ga0068861_100358006
464 Ga0068851_10024482
465 Ga0068870_10008502
466 Ga0068858_100351873
467 Ga0068860_101780408
468 Ga0068862_100018672
469 Ga0081455_10090796
470 Ga0081455_11059781
471 Ga0081538_10022140
472 Ga0081538_10034533
473 Ga0081539_10004359
474 Ga0075366_10267511
475 Ga0075428_100276858
476 Ga0075428_100597649
477 Ga0075428_102448038
478 Ga0075431_100046193
479 Ga0075431_100080573
480 Ga0075434_100168248
481 Ga0075434_101150220
482 Ga0075429_100328603
483 Ga0068865_100005424
484 Ga0068865_101249357
485 Ga0097620_100000703
486 Ga0097620_100747466
487 Ga0097620_100850196
488 Ga0075435_100978044
489 Ga0105240_10034110
490 Ga0105240_11166762
491 Ga0111539_10109827
492 Ga0111539_12038236
493 Ga0105245_10927007
494 Ga0105247_10870515
495 Ga0105247_11868761
496 Ga0105243_10817570
497 Ga0105241_10266943
498 Ga0105241_11680871
499 Ga0105248_10000094
500 Ga0105248_10003761
501 Ga0105248_10103789
502 Ga0105248_11768084
503 Ga0105237_10388495
504 Ga0105237_11741089
505 Ga0105238_11707560
506 Ga0105249_10227475
507 Ga0105249_10263117
508 Ga0105249_10827606
509 Ga0105249_12281955
510 Ga0105239_10659581
511 Ga0105239_11875738
512 Ga0105239_12307033
513 Ga0157321_1038404
514 Ga0157345_1011780
515 Ga0157327_1038028
516 Ga0157373_10280377
517 Ga0157370_10057777
518 Ga0157370_10270892
519 Ga0157370_10504576
520 Ga0157369_10071201
521 Ga0157374_12416542
522 Ga0157378_12407458
523 Ga0163162_10326194
524 Ga0157372_10161930
525 Ga0157372_10831980
526 Ga0157375_10012356
527 Ga0157375_10315742
528 Ga0157375_10390176
529 Ga0157375_11368315
530 Ga0157380_10001355
531 Ga0157380_10235140
532 Ga0157380_11364706
533 Ga0182008_10104693
534 Ga0157377_10016185
535 Ga0157377_10163648
536 Ga0157379_10765157
537 Ga0157376_10995346
538 Ga0157376_11206535
539 Ga0163161_10277580
540 Ga0163161_10291980
541 Ga0163161_10634724
542 Ga0207656_10010726
543 Ga0207682_10001734
544 Ga0207680_10091447
545 Ga0207699_10841127
546 Ga0207643_10001235
547 Ga0207705_10004644
548 Ga0207654_10222725
549 Ga0207707_10004838
550 Ga0207707_10338154
551 Ga0207695_10065096
552 Ga0207671_10131102
553 Ga0207660_10202962
554 Ga0207660_11083586
555 Ga0207660_11505402
556 Ga0207657_10010473
557 Ga0207652_10038455
558 Ga0207652_10336231
559 Ga0207646_10291431
560 Ga0207681_10061548
561 Ga0207681_10268421
562 Ga0207681_10669806
563 Ga0207694_10254871
564 Ga0207650_10071878
565 Ga0207659_10001705
566 Ga0207659_10087747
567 Ga0207700_10606370
568 Ga0207664_10247560
569 Ga0207644_10074382
570 Ga0207690_10038202
571 Ga0207706_10013582
572 Ga0207706_10029742
573 Ga0207706_10064180
574 Ga0207706_10494624
575 Ga0207706_10766646
576 Ga0207670_10040034
577 Ga0207670_10398008
578 Ga0207704_10286751
579 Ga0207691_10000326
580 Ga0207691_10132522
581 Ga0207691_11395710
582 Ga0207711_10000086
583 Ga0207711_10038186
584 Ga0207711_10068612
585 Ga0207689_10088286
586 Ga0207689_11423452
587 Ga0207661_10299844
588 Ga0207661_10458114
589 Ga0207679_10191685
590 Ga0207679_10301104
591 Ga0207667_10000358
592 Ga0207667_10003792
593 Ga0207667_10953363
594 Ga0207651_10170236
595 Ga0207712_10458083
596 Ga0207712_10838393
597 Ga0207712_10910618
598 Ga0207668_10018999
599 Ga0207668_11450012
600 Ga0207668_11631059
601 Ga0207640_10073287
602 Ga0207640_10347710
603 Ga0207658_10257021
604 Ga0207703_10663497
605 Ga0207639_10272484
606 Ga0207639_10359683
607 Ga0207639_10424686
608 Ga0207678_10039314
609 Ga0207641_10425224
610 Ga0207641_11432657
611 Ga0207648_10159182
612 Ga0207676_10079574
613 Ga0207674_10001292
614 Ga0207674_10907684
615 Ga0207674_10998027
616 Ga0207674_11424208
617 Ga0207675_100012794
618 Ga0207675_100193010
619 Ga0207683_10088877
620 Ga0207683_10607638
621 Ga0207698_10002128
622 Ga0207698_10419460
623 Ga0207698_10540894
624 Ga0209996_1031164
625 Ga0209995_1004784
626 Ga0209999_1023410
627 Ga0209983_1026354
628 Ga0209971_1019246
629 Ga0209966_1087508
630 Ga0209974_10005588
631 Ga0207428_10036808
632 Ga0268266_10120603
633 Ga0268265_10172749
634 Ga0268265_10293937
635 Ga0268264_10078205
636 Ga0268264_11704465
637 Ga0268264_12366802
638 Ga0307408_100930963
639 Ga0316576_10670257
640 Ga0316577_10087979
641 Ga0307406_10735648
642 Ga0316593_10028615
643 Ga0316593_10119224
644 Ga0316593_10445490
645 Ga0373943_0456952
646 Ga0316574_0011365
647 Ga0316584_0000010
648 Ga0395901_0537773
649 Ga0400487_11562
650 Ga0451793_0047399
651 Ga0451807_2299364
652 Ga0451853_3304737
653 Ga0439434_0368870
654 Ga0466963_0238734
655 Ga0453684_2117492
656 Ga0466959_0496972
657 Ga0495642_0161787
658 Ga0495621_0200403
659 Ga0495635_0498625
660 Ga0495669_0559059
661 Ga0496100_0118443
662 Ga0496101_0947454
663 Ga0496102_0599270
664 Ga0496106_0191558
665 Ga0496107_0563058
666 Ga0496108_1355413
667 Ga0496111_1196976
668 Ga0496112_1771417
669 Ga0496114_1364561
670 Ga0501031_0260977
671 Ga0501033_0444866
672 Ga0501036_0033541
673 Ga0501036_0241767
674 Ga0501038_0247530
675 Ga0501039_0076801
676 Ga0501041_0223596
677 Ga0501042_0020339
678 Ga0501042_0049023
679 Ga0501046_0264929
680 Ga0501048_0112880
681 Ga0501048_0181575
682 Ga0501048_0353358
683 Ga0501048_1022335
684 Ga0501070_0020844
685 Ga0501071_0004203
686 Ga0501071_0042308
687 Ga0501071_0342073
688 Ga0501072_0060525
689 Ga0501073_0165962
690 Ga0501075_0014965
691 Ga0501076_0006741
692 Ga0501076_0008777
693 Ga0501079_0165934
694 Ga0501080_0173236
695 Ga0501080_0424918
696 Ga0501081_0011857
697 Ga0501083_0928851
698 Ga0501044_0142380
699 nmdc:mga03683_82203_c1
700 nmdc:mga0k408_280269_c1
701 nmdc:mga05p37_148053_c1
702 nmdc:mga09592_724668_c1
703 nmdc:mga0qj67_613708_c1
704 nmdc:mga06r32_17483_c1
705 nmdc:mga06r32_282310_c1
706 nmdc:mga06r32_32387_c1
707 nmdc:mga08y16_84674_c1
708 nmdc:mga08y16_906356_c1
709 nmdc:mga0n895_1929770_c1
710 nmdc:mga0rr50_285305_c1
711 nmdc:mga0a205_312777_c1
712 Ga0500572_055197
713 Ga0500595_022321
714 Ga0500627_0428950
715 Ga0501084_0128985
716 Ga0501084_0148157
717 Ga0587070_231481
718 Ga0587085_006211
719 Ga0587091_034232
720 Ga0587109_029386
721 Ga0587109_146732
722 Ga0587115_094912
723 Ga0587069_097996
724 Ga0587110_031287
725 Ga0587111_0099218
726 Ga0501082_0058018
727 Ga0501082_0063820
728 Ga0530510_0006698
729 Ga0530510_0198711
730 Ga0530510_0213321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

23

103

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p5n-assembly1.cif.gz_Q structure of a mammalian 80s ribosome in complex with a single translocated israeli acute paralysis virus ires and erf1 0.9538 29 79
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9478 12 76
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9339 12 76
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9313 6 83
4v8a-assembly1.cif.gz_DS the structure of thermorubin in complex with the 70s ribosome from thermus thermophilus. 0.9206 7 83
ID Description Score Start End Superfamily
af_P06588_1_92_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9076 1 83 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9035 4 81 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9035 6 83 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8998 3 81 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8928 4 81 3.30.860.10
ID Description Score Start End GO Terms
AF-H6T3U6-F1-model_v4 Small ribosomal subunit protein uS19c (30S ribosomal protein S19, chloroplastic) 0.9429 5 85 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009536
GO:0019843
AF-A0A5D0IVM7-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9295 6 86 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1W9VL01-F1-model_v4 Small ribosomal subunit protein uS19 0.9215 1 84 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A5D0IVM7-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9185 6 86 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A348NQ58-F1-model_v4 Small ribosomal subunit protein uS19 0.9183 6 88 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Map