F423312

General Info

Members Datasets Scaffolds Average Seq Length
364 279 268 182

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10431401|Ga0157371_104314012
Length 209
Sequence MQSSFMGRGVVTGEETTLPEKETTMKLKSRMACVVSVLALAITPAMHAQKDPMVGGAAMYPSKNIVENAVNSADHTTLVAAVKAAGLVDTLEGAGPFTVFAPTNEAFTKLPAGTVDTLLKPENKDALTKVLTYHVVAGNMSTDDLKKSVKEGHGKAELKTVSGGKLWVMEKNGHILLQDEKGGTAAITIANVAQSNGMIQVINSVLLPN

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
7 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
10 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
11 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
12 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
13 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
14 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
15 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
16 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
17 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
18 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
19 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
20 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
21 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
22 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
23 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
24 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
25 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
26 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
27 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
28 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
29 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
30 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
31 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
32 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
33 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
34 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
35 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
36 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
37 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
38 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
39 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
40 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
41 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
42 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
43 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
44 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
45 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
46 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
47 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
48 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
49 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
50 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
51 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
52 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
53 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
54 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
55 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
56 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
57 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
58 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
59 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
60 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
61 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
62 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
63 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
64 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
65 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
66 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
67 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
68 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
69 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
70 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
71 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
72 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
73 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
74 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
75 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
76 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
77 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
78 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
79 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
80 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
81 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
82 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
83 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
84 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
85 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
86 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
87 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
88 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
89 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
90 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
91 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
92 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
93 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
94 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
95 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
96 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
97 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
98 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
101 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
102 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
107 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
110 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
111 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
112 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
113 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
114 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
115 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
116 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
117 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
127 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
135 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
142 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
143 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
144 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
226 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
278 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
279 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.63
Metatranscriptomes 0
Isolates 26.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 22.53
Rhizoplane 1.92
Rhizosphere 60.71
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10078180 3300001989 Bacteria 1019
2 rootH2_10001276 3300003320 Bacteria 51880
3 rootH2_10030045 3300003320 Bacteria 4393
4 Ga0065707_10306159 3300005295 Bacteria 994
5 Ga0070658_10059893 3300005327 Bacteria 3100
6 Ga0070658_10083846 3300005327 Bacteria 2620
7 Ga0070690_100056554 3300005330 Bacteria 2516
8 Ga0068869_100981280 3300005334 Bacteria 735
9 Ga0068868_100186782 3300005338 Bacteria 1722
10 Ga0070660_100009059 3300005339 Bacteria 6985
11 Ga0070660_100041993 3300005339 Bacteria 3488
12 Ga0070689_100105233 3300005340 Bacteria 2238
13 Ga0070689_101488673 3300005340 Bacteria 613
14 Ga0070661_100008005 3300005344 Bacteria 7300
15 Ga0070668_100243199 3300005347 Bacteria 1491
16 Ga0070669_100360513 3300005353 Unclassified 1182
17 Ga0070671_100386287 3300005355 Bacteria 1197
18 Ga0070674_100039640 3300005356 Bacteria 3182
19 Ga0070673_100078290 3300005364 Bacteria 2674
20 Ga0070667_100010652 3300005367 Bacteria 7594
21 Ga0070709_10064064 3300005434 Bacteria 2349
22 Ga0070714_100484052 3300005435 Bacteria 1178
23 Ga0070714_101095974 3300005435 Unclassified 776
24 Ga0070713_100488808 3300005436 Bacteria 1160
25 Ga0070713_100505446 3300005436 Bacteria 1141
26 Ga0070710_11008349 3300005437 Bacteria 607
27 Ga0070711_100622205 3300005439 Bacteria 903
28 Ga0070708_100554406 3300005445 Bacteria 1084
29 Ga0070708_101010419 3300005445 Bacteria 780
30 Ga0068867_100029318 3300005459 Bacteria 3964
31 Ga0068867_100112766 3300005459 Bacteria 2091
32 Ga0070672_100746108 3300005543 Unclassified 859
33 Ga0070665_100000442 3300005548 Bacteria 60619
34 Ga0070665_100060842 3300005548 Bacteria 3785
35 Ga0070665_100178074 3300005548 Bacteria 2127
36 Ga0070704_100796235 3300005549 Unclassified 844
37 Ga0068855_100038005 3300005563 Bacteria 5722
38 Ga0068855_100298272 3300005563 Bacteria 1785
39 Ga0068855_100617355 3300005563 Bacteria 1168
40 Ga0070664_100139346 3300005564 Bacteria 2135
41 Ga0068857_101316709 3300005577 Bacteria 701
42 Ga0068854_100156979 3300005578 Bacteria 1759
43 Ga0068854_100674711 3300005578 Bacteria 890
44 Ga0068856_100178134 3300005614 Bacteria 2138
45 Ga0068856_100195852 3300005614 Bacteria 2035
46 Ga0068856_100561010 3300005614 Bacteria 1163
47 Ga0068852_100088485 3300005616 Bacteria 2766
48 Ga0068852_100095808 3300005616 Bacteria 2666
49 Ga0068852_100462818 3300005616 Bacteria 1257
50 Ga0068859_100000026 3300005617 Bacteria 188742
51 Ga0068864_100000250 3300005618 Bacteria 47956
52 Ga0068864_100018778 3300005618 Bacteria 5778
53 Ga0068851_10010929 3300005834 Bacteria 4246
54 Ga0068851_10233564 3300005834 Bacteria 1037
55 Ga0068863_100000019 3300005841 Bacteria 205585
56 Ga0068863_100003814 3300005841 Bacteria 14895
57 Ga0068858_100000479 3300005842 Bacteria 41666
58 Ga0068858_100038676 3300005842 Bacteria 4425
59 Ga0068860_100066966 3300005843 Bacteria 3413
60 Ga0068860_100663798 3300005843 Bacteria 1051
61 Ga0068860_100703815 3300005843 Bacteria 1020
62 Ga0068862_100267700 3300005844 Unclassified 1562
63 Ga0081540_1016972 3300005983 Bacteria 4527
64 Ga0075365_10007879 3300006038 Bacteria 6001
65 Ga0075363_100137531 3300006048 Bacteria 1374
66 Ga0075364_10032130 3300006051 Bacteria 3372
67 Ga0075367_10001418 3300006178 Bacteria 10270
68 Ga0075366_10073792 3300006195 Bacteria 2034
69 Ga0097621_100477374 3300006237 Bacteria 1127
70 Ga0075370_10076854 3300006353 Bacteria 1915
71 Ga0075428_100071588 3300006844 Bacteria 3789
72 Ga0075430_100731381 3300006846 Bacteria 816
73 Ga0075431_100315695 3300006847 Bacteria 1577
74 Ga0075429_100969356 3300006880 Bacteria 744
75 Ga0097620_100000026 3300006931 Bacteria 188742
76 Ga0105250_10011442 3300009092 Bacteria 3680
77 Ga0105250_10195951 3300009092 Bacteria 851
78 Ga0105240_10000953 3300009093 Bacteria 51586
79 Ga0105240_10053213 3300009093 Bacteria 5083
80 Ga0105240_11842243 3300009093 Bacteria 630
81 Ga0111539_10001158 3300009094 Bacteria 34853
82 Ga0111539_10053118 3300009094 Bacteria 4823
83 Ga0111539_10108337 3300009094 Bacteria 3260
84 Ga0105247_10055261 3300009101 Bacteria 2450
85 Ga0114129_10002596 3300009147 Bacteria 25107
86 Ga0105241_10001560 3300009174 Bacteria 17525
87 Ga0105248_10220869 3300009177 Bacteria 2133
88 Ga0105237_10810940 3300009545 Bacteria 943
89 Ga0105237_10849496 3300009545 Bacteria 920
90 Ga0105238_10071877 3300009551 Bacteria 3457
91 Ga0105238_10571035 3300009551 Bacteria 1137
92 Ga0105249_10067640 3300009553 Bacteria 3292
93 Ga0105239_10193809 3300010375 Bacteria 2275
94 Ga0105239_10272500 3300010375 Bacteria 1904
95 Ga0105239_10275517 3300010375 Bacteria 1893
96 Ga0105239_10505961 3300010375 Unclassified 1373
97 Ga0105239_10652635 3300010375 Bacteria 1202
98 Ga0105239_11761499 3300010375 Bacteria 717
99 Ga0105246_10271009 3300011119 Bacteria 1357
100 Ga0105246_10278283 3300011119 Bacteria 1341
101 Ga0157371_10002598 3300013102 Bacteria 17139
102 Ga0157371_10017165 3300013102 Bacteria 5382
103 Ga0157371_10080458 3300013102 Bacteria 2307
104 Ga0157371_10431401 3300013102 Bacteria 967
105 Ga0157370_10214606 3300013104 Bacteria 1783
106 Ga0157370_11123743 3300013104 Bacteria 710
107 Ga0157369_10030606 3300013105 Bacteria 5935
108 Ga0157369_10064825 3300013105 Bacteria 3934
109 Ga0157369_10094577 3300013105 Bacteria 3190
110 Ga0157369_10103817 3300013105 Bacteria 3028
111 Ga0157374_10000002 3300013296 Bacteria 1054226
112 Ga0157374_10228416 3300013296 Bacteria 1828
113 Ga0157378_10002116 3300013297 Bacteria 17691
114 Ga0157378_10718668 3300013297 Bacteria 1020
115 Ga0163163_10599090 3300014325 Bacteria 1165
116 Ga0157380_10749418 3300014326 Bacteria 988
117 Ga0182008_10070181 3300014497 Bacteria 1723
118 Ga0157377_11007206 3300014745 Bacteria 631
119 Ga0157379_10021476 3300014968 Bacteria 5714
120 Ga0157379_10057510 3300014968 Bacteria 3475
121 Ga0157376_10411089 3300014969 Bacteria 1311
122 Ga0157376_11578698 3300014969 Bacteria 690
123 Ga0213873_10186188 3300021358 Bacteria 639
124 Ga0213876_10000042 3300021384 Bacteria 166095
125 Ga0213876_10258390 3300021384 Bacteria 925
126 Ga0213871_10094445 3300021441 Bacteria 870
127 Ga0209148_1000136 3300025254 Bacteria 169088
128 Ga0209148_1014516 3300025254 Bacteria 1391
129 Ga0209455_1000085 3300025272 Bacteria 247601
130 Ga0207656_10030541 3300025321 Bacteria 2227
131 Ga0207696_1019948 3300025711 Bacteria 2170
132 Ga0207710_10178846 3300025900 Bacteria 1040
133 Ga0207680_10000394 3300025903 Bacteria 20753
134 Ga0207647_10015219 3300025904 Bacteria 5282
135 Ga0207647_10068329 3300025904 Bacteria 2151
136 Ga0207699_10028258 3300025906 Bacteria 3115
137 Ga0207699_10394646 3300025906 Bacteria 984
138 Ga0207705_10017495 3300025909 Bacteria 5133
139 Ga0207705_10204011 3300025909 Bacteria 1498
140 Ga0207654_10000827 3300025911 Bacteria 17045
141 Ga0207695_10001392 3300025913 Bacteria 40886
142 Ga0207695_10012565 3300025913 Bacteria 10148
143 Ga0207671_10009713 3300025914 Bacteria 8012
144 Ga0207657_10011155 3300025919 Bacteria 8933
145 Ga0207657_10192998 3300025919 Bacteria 1642
146 Ga0207649_10156647 3300025920 Bacteria 1574
147 Ga0207652_10376380 3300025921 Bacteria 1282
148 Ga0207694_10028930 3300025924 Bacteria 4225
149 Ga0207650_10393233 3300025925 Bacteria 1146
150 Ga0207644_10242645 3300025931 Bacteria 1435
151 Ga0207690_10082906 3300025932 Bacteria 2243
152 Ga0207690_10305086 3300025932 Bacteria 1247
153 Ga0207670_10583205 3300025936 Bacteria 917
154 Ga0207669_10042585 3300025937 Bacteria 2652
155 Ga0207691_10557898 3300025940 Bacteria 971
156 Ga0207711_10141102 3300025941 Bacteria 2168
157 Ga0207689_10413130 3300025942 Bacteria 1126
158 Ga0207667_10043428 3300025949 Bacteria 4770
159 Ga0207667_10219969 3300025949 Bacteria 1946
160 Ga0207667_10438315 3300025949 Bacteria 1328
161 Ga0207651_10061646 3300025960 Bacteria 2610
162 Ga0207668_10299255 3300025972 Unclassified 1327
163 Ga0207668_11164333 3300025972 Bacteria 692
164 Ga0207658_10401878 3300025986 Bacteria 1204
165 Ga0207658_10622662 3300025986 Bacteria 971
166 Ga0207677_10062731 3300026023 Bacteria 2580
167 Ga0207677_10092312 3300026023 Bacteria 2204
168 Ga0207703_10000138 3300026035 Bacteria 87646
169 Ga0207703_10003593 3300026035 Bacteria 12959
170 Ga0207639_10006922 3300026041 Bacteria 7724
171 Ga0207639_11235656 3300026041 Bacteria 701
172 Ga0207702_10010005 3300026078 Bacteria 7952
173 Ga0207702_10024619 3300026078 Bacteria 4996
174 Ga0207641_10000005 3300026088 Bacteria 470841
175 Ga0207641_10000155 3300026088 Bacteria 97385
176 Ga0207648_10006384 3300026089 Bacteria 11718
177 Ga0207648_10155316 3300026089 Bacteria 2020
178 Ga0207676_10000049 3300026095 Bacteria 133695
179 Ga0207675_100198955 3300026118 Bacteria 1924
180 Ga0207698_10026425 3300026142 Bacteria 4107
181 Ga0207698_10032443 3300026142 Bacteria 3783
182 Ga0207698_10793737 3300026142 Bacteria 948
183 Ga0207428_10022349 3300027907 Bacteria 5339
184 Ga0207428_10398056 3300027907 Bacteria 1009
185 Ga0268266_10013344 3300028379 Bacteria 7078
186 Ga0268266_10087447 3300028379 Bacteria 2726
187 Ga0268266_10138823 3300028379 Bacteria 2180
188 Ga0268265_10119220 3300028380 Unclassified 2171
189 Ga0268265_10152152 3300028380 Unclassified 1953
190 Ga0307515_10155219 3300028794 Bacteria 2367
191 Ga0265314_10225731 3300031711 Bacteria 1090
192 Ga0307416_100432436 3300032002 Bacteria 1364
193 Ga0436364_0921296 3300037853 Bacteria 8688
194 Ga0436364_1327844 3300037853 Bacteria 2239
195 Ga0395901_0805136 3300038443 Bacteria 928
196 Ga0436365_0174155 3300039437 Bacteria 5922
197 Ga0436365_0281258 3300039437 Bacteria 1057
198 Ga0436365_1122293 3300039437 Bacteria 76517
199 Ga0436360_0840185 3300039438 Bacteria 4200
200 Ga0436361_0095125 3300039447 Bacteria 6844
201 Ga0436361_0765742 3300039447 Bacteria 3332
202 Ga0436362_0327678 3300039453 Bacteria 3010
203 Ga0451787_553326 3300041441 Bacteria 666
204 Ga0451791_1305476 3300041451 Bacteria 1274
205 Ga0451804_0618468 3300041463 Bacteria 782
206 Ga0451807_2087947 3300041486 Bacteria 1053
207 Ga0451837_0844656 3300041494 Bacteria 4194
208 Ga0451843_0440702 3300041509 Bacteria 732
209 Ga0466966_0476674 3300044684 Bacteria 750
210 Ga0466959_0039411 3300045049 Bacteria 3491
211 Ga0466967_0217947 3300045976 Bacteria 1812
212 Ga0495629_0466113 3300046459 Bacteria 854
213 Ga0495641_0000206 3300046461 Bacteria 45921
214 Ga0495651_0405991 3300046462 Bacteria 888
215 Ga0495662_0095791 3300046476 Bacteria 1450
216 Ga0495596_0056457 3300046500 Bacteria 1533
217 Ga0495631_0194112 3300046518 Bacteria 869
218 Ga0495643_0088628 3300046522 Bacteria 1599
219 Ga0495673_0017559 3300047469 Bacteria 3628
220 Ga0495673_0333189 3300047469 Bacteria 538
221 Ga0495686_0114905 3300047472 Unclassified 1610
222 Ga0496102_0556653 3300048905 Bacteria 1070
223 Ga0496103_0449480 3300048906 Bacteria 827
224 Ga0496112_0297615 3300048915 Bacteria 1559
225 Ga0496116_0000032 3300048919 Bacteria 419997
226 Ga0496117_0140304 3300048920 Bacteria 1449
227 Ga0496118_0080015 3300048921 Bacteria 2302
228 Ga0496118_0143530 3300048921 Bacteria 1508
229 Ga0496119_0055647 3300048922 Bacteria 2402
230 Ga0496119_0267097 3300048922 Bacteria 856
231 Ga0496120_0028760 3300048923 Bacteria 3402
232 Ga0496124_0022773 3300048927 Bacteria 5735
233 Ga0496125_0000059 3300048928 Bacteria 264149
234 Ga0496125_0543767 3300048928 Bacteria 645
235 Ga0496126_0021156 3300048929 Bacteria 6360
236 Ga0496126_0486236 3300048929 Bacteria 988
237 Ga0501031_0030185 3300049568 Unclassified 3535
238 Ga0501034_0587172 3300049571 Bacteria 1020
239 Ga0501036_0003407 3300049572 Bacteria 12704
240 Ga0501038_0067232 3300049574 Unclassified 3049
241 Ga0501039_0102952 3300049575 Unclassified 2228
242 Ga0501039_0684104 3300049575 Bacteria 802
243 Ga0501043_0008675 3300049579 Bacteria 8000
244 Ga0501046_0042074 3300049580 Bacteria 3643
245 Ga0501047_0221367 3300049581 Unclassified 1749
246 Ga0501072_0095014 3300049588 Unclassified 2369
247 Ga0501076_0816377 3300049592 Bacteria 769
248 Ga0501079_0352635 3300049741 Bacteria 1153
249 Ga0501080_0777376 3300049742 Bacteria 841
250 Ga0501044_0021121 3300049823 Bacteria 6951
251 nmdc:mga00v17_17081_c1 3300050491 Bacteria 4098
252 nmdc:mga0yw44_286864_c1 3300050492 Bacteria 1101
253 nmdc:mga0yw44_539_c1 3300050492 Bacteria 13607
254 nmdc:mga06z11_24918_c1 3300050494 Bacteria 2828
255 nmdc:mga06z11_98040_c1 3300050494 Bacteria 1603
256 nmdc:mga07m45_43756_c1 3300050496 Bacteria 2511
257 nmdc:mga05p37_488_c1 3300050507 Bacteria 43466
258 nmdc:mga09592_357476_c1 3300050508 Bacteria 1264
259 nmdc:mga0qj67_644618_c1 3300050509 Bacteria 845
260 nmdc:mga06r32_149970_c1 3300050510 Bacteria 2310
261 nmdc:mga06r32_533134_c1 3300050510 Bacteria 1149
262 nmdc:mga08y16_34051_c1 3300050511 Bacteria 5351
263 nmdc:mga08y16_658956_c1 3300050511 Bacteria 1050
264 nmdc:mga0a205_102825_c1 3300050515 Bacteria 2755
265 Ga0500555_002513 3300053103 Bacteria 5301
266 Ga0500595_085356 3300053119 Bacteria 920
267 Ga0500616_0069111 3300053153 Bacteria 1807
268 Ga0466962_0118456 3300061719 Bacteria 1277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053103 Ga0500555_002513 Ga0500555_002513_2430_2978 149
2 3300047469 Ga0495673_0333189 Ga0495673_0333189_30_518 152
3 3300005340 Ga0070689_100105233 Ga0070689_1001052333 162
4 3300005834 Ga0068851_10233564 Ga0068851_102335642 162
5 3300025932 Ga0207690_10305086 Ga0207690_103050862 162
6 3300025940 Ga0207691_10557898 Ga0207691_105578981 162
7 3300037853 Ga0436364_0921296 Ga0436364_0921296_3104_3610 163
8 3300041451 Ga0451791_1305476 Ga0451791_1305476_124_759 163
9 3300046500 Ga0495596_0056457 Ga0495596_0056457_633_1262 163
10 3300046518 Ga0495631_0194112 Ga0495631_0194112_93_722 163
11 3300049742 Ga0501080_0777376 Ga0501080_0777376_224_808 163
12 3300005338 Ga0068868_100186782 Ga0068868_1001867822 164
13 3300005347 Ga0070668_100243199 Ga0070668_1002431993 164
14 3300005364 Ga0070673_100078290 Ga0070673_1000782903 164
15 3300005367 Ga0070667_100010652 Ga0070667_1000106528 164
16 3300005616 Ga0068852_100088485 Ga0068852_1000884854 164
17 3300005617 Ga0068859_100000026 Ga0068859_100000026130 164
18 3300005618 Ga0068864_100018778 Ga0068864_1000187784 164
19 3300005834 Ga0068851_10010929 Ga0068851_100109296 164
20 3300005841 Ga0068863_100003814 Ga0068863_1000038143 164
21 3300005842 Ga0068858_100038676 Ga0068858_1000386765 164
22 3300005843 Ga0068860_100066966 Ga0068860_1000669662 164
23 3300006931 Ga0097620_100000026 Ga0097620_100000026130 164
24 3300009101 Ga0105247_10055261 Ga0105247_100552612 164
25 3300009174 Ga0105241_10001560 Ga0105241_100015602 164
26 3300009553 Ga0105249_10067640 Ga0105249_100676403 164
27 3300010375 Ga0105239_10193809 Ga0105239_101938093 164
28 3300011119 Ga0105246_10271009 Ga0105246_102710091 164
29 3300011119 Ga0105246_10278283 Ga0105246_102782831 164
30 3300013296 Ga0157374_10228416 Ga0157374_102284163 164
31 3300014968 Ga0157379_10021476 Ga0157379_100214764 164
32 3300025321 Ga0207656_10030541 Ga0207656_100305413 164
33 3300025900 Ga0207710_10178846 Ga0207710_101788462 164
34 3300025903 Ga0207680_10000394 Ga0207680_100003944 164
35 3300025911 Ga0207654_10000827 Ga0207654_100008273 164
36 3300025914 Ga0207671_10009713 Ga0207671_100097138 164
37 3300025936 Ga0207670_10583205 Ga0207670_105832052 164
38 3300025942 Ga0207689_10413130 Ga0207689_104131302 164
39 3300025960 Ga0207651_10061646 Ga0207651_100616463 164
40 3300025972 Ga0207668_11164333 Ga0207668_111643331 164
41 3300025986 Ga0207658_10401878 Ga0207658_104018782 164
42 3300026023 Ga0207677_10062731 Ga0207677_100627312 164
43 3300026035 Ga0207703_10003593 Ga0207703_1000359311 164
44 3300026088 Ga0207641_10000155 Ga0207641_1000015569 164
45 3300026142 Ga0207698_10026425 Ga0207698_100264253 164
46 3300032002 Ga0307416_100432436 Ga0307416_1004324361 164
47 3300039437 Ga0436365_0281258 Ga0436365_0281258_447_998 165
48 3300041509 Ga0451843_0440702 Ga0451843_0440702_14_640 165
49 3300046461 Ga0495641_0000206 Ga0495641_0000206_24675_25289 165
50 3300046476 Ga0495662_0095791 Ga0495662_0095791_160_774 165
51 3300041486 Ga0451807_2087947 Ga0451807_2087947_105_647 167
52 3300013296 Ga0157374_10000002 Ga0157374_10000002688 169
53 3300041441 Ga0451787_553326 Ga0451787_553326_143_652 169
54 3300005549 Ga0070704_100796235 Ga0070704_1007962351 170
55 3300021384 Ga0213876_10000042 Ga0213876_10000042132 170
56 3300039437 Ga0436365_1122293 Ga0436365_1122293_34123_34695 170
57 3300046459 Ga0495629_0466113 Ga0495629_0466113_110_739 170
58 3300047469 Ga0495673_0017559 Ga0495673_0017559_2009_2638 170
59 3300050494 nmdc:mga06z11_98040_c1 nmdc:mga06z11_98040_c1_19_534 170
60 3300037853 Ga0436364_1327844 Ga0436364_1327844_1327_1851 171
61 3300005843 Ga0068860_100663798 Ga0068860_1006637982 172
62 3300053153 Ga0500616_0069111 Ga0500616_0069111_38_595 173
63 3300013105 Ga0157369_10064825 Ga0157369_100648254 174
64 3300047472 Ga0495686_0114905 Ga0495686_0114905_455_1081 174
65 iso_pu_bacteria 2654587920 2656279724 177
66 iso_pu_bacteria 2937861824 2937863351 177
67 3300005543 Ga0070672_100746108 Ga0070672_1007461082 178
68 3300009177 Ga0105248_10220869 Ga0105248_102208692 178
69 3300025941 Ga0207711_10141102 Ga0207711_101411022 178
70 3300003320 rootH2_10001276 rootH2_1000127611 179
71 3300005340 Ga0070689_101488673 Ga0070689_1014886731 179
72 3300005353 Ga0070669_100360513 Ga0070669_1003605132 179
73 3300005434 Ga0070709_10064064 Ga0070709_100640642 179
74 3300005436 Ga0070713_100488808 Ga0070713_1004888081 179
75 3300005437 Ga0070710_11008349 Ga0070710_110083491 179
76 3300005439 Ga0070711_100622205 Ga0070711_1006222051 179
77 3300005844 Ga0068862_100267700 Ga0068862_1002677002 179
78 3300005983 Ga0081540_1016972 Ga0081540_10169726 179
79 3300006847 Ga0075431_100315695 Ga0075431_1003156952 179
80 3300009094 Ga0111539_10108337 Ga0111539_101083373 179
81 3300014326 Ga0157380_10749418 Ga0157380_107494181 179
82 3300025906 Ga0207699_10028258 Ga0207699_100282582 179
83 3300028380 Ga0268265_10152152 Ga0268265_101521523 179
84 3300045976 Ga0466967_0217947 Ga0466967_0217947_785_1357 179
85 3300046522 Ga0495643_0088628 Ga0495643_0088628_709_1263 179
86 3300049568 Ga0501031_0030185 Ga0501031_0030185_2890_3444 179
87 3300049571 Ga0501034_0587172 Ga0501034_0587172_298_852 179
88 3300049572 Ga0501036_0003407 Ga0501036_0003407_2887_3441 179
89 3300049574 Ga0501038_0067232 Ga0501038_0067232_1810_2364 179
90 3300049575 Ga0501039_0102952 Ga0501039_0102952_732_1286 179
91 3300049575 Ga0501039_0684104 Ga0501039_0684104_30_584 179
92 3300049579 Ga0501043_0008675 Ga0501043_0008675_7061_7615 179
93 3300049580 Ga0501046_0042074 Ga0501046_0042074_1910_2464 179
94 3300049581 Ga0501047_0221367 Ga0501047_0221367_955_1509 179
95 3300049588 Ga0501072_0095014 Ga0501072_0095014_1794_2348 179
96 3300049823 Ga0501044_0021121 Ga0501044_0021121_88_642 179
97 3300050510 nmdc:mga06r32_149970_c1 nmdc:mga06r32_149970_c1_594_1145 179
98 3300005330 Ga0070690_100056554 Ga0070690_1000565543 180
99 3300005445 Ga0070708_101010419 Ga0070708_1010104191 180
100 3300009094 Ga0111539_10001158 Ga0111539_1000115815 180
101 3300014745 Ga0157377_11007206 Ga0157377_110072061 180
102 3300026041 Ga0207639_10006922 Ga0207639_100069227 180
103 3300027907 Ga0207428_10022349 Ga0207428_100223494 180
104 3300046462 Ga0495651_0405991 Ga0495651_0405991_90_644 180
105 3300049741 Ga0501079_0352635 Ga0501079_0352635_14_568 180
106 3300050511 nmdc:mga08y16_34051_c1 nmdc:mga08y16_34051_c1_1958_2515 180
107 3300050511 nmdc:mga08y16_658956_c1 nmdc:mga08y16_658956_c1_406_966 180
108 iso_pu_bacteria 2509276022 2509393365 180
109 iso_pu_bacteria 2537561836 2538832455 180
110 iso_pu_bacteria 2643221562 2643830501 180
111 iso_pu_bacteria 2895395659 2895398755 180
112 3300003320 rootH2_10030045 rootH2_100300455 181
113 3300005295 Ga0065707_10306159 Ga0065707_103061592 181
114 3300005327 Ga0070658_10059893 Ga0070658_100598933 181
115 3300005334 Ga0068869_100981280 Ga0068869_1009812801 181
116 3300005339 Ga0070660_100009059 Ga0070660_1000090593 181
117 3300005344 Ga0070661_100008005 Ga0070661_1000080058 181
118 3300005435 Ga0070714_100484052 Ga0070714_1004840522 181
119 3300005435 Ga0070714_101095974 Ga0070714_1010959741 181
120 3300005445 Ga0070708_100554406 Ga0070708_1005544062 181
121 3300005548 Ga0070665_100000442 Ga0070665_1000004424 181
122 3300005563 Ga0068855_100038005 Ga0068855_1000380053 181
123 3300005563 Ga0068855_100298272 Ga0068855_1002982722 181
124 3300005564 Ga0070664_100139346 Ga0070664_1001393463 181
125 3300005577 Ga0068857_101316709 Ga0068857_1013167092 181
126 3300005578 Ga0068854_100156979 Ga0068854_1001569792 181
127 3300005614 Ga0068856_100178134 Ga0068856_1001781341 181
128 3300005614 Ga0068856_100195852 Ga0068856_1001958522 181
129 3300005614 Ga0068856_100561010 Ga0068856_1005610102 181
130 3300005616 Ga0068852_100095808 Ga0068852_1000958083 181
131 3300005618 Ga0068864_100000250 Ga0068864_10000025044 181
132 3300005841 Ga0068863_100000019 Ga0068863_10000001933 181
133 3300005842 Ga0068858_100000479 Ga0068858_10000047936 181
134 3300006844 Ga0075428_100071588 Ga0075428_1000715884 181
135 3300006846 Ga0075430_100731381 Ga0075430_1007313812 181
136 3300006880 Ga0075429_100969356 Ga0075429_1009693561 181
137 3300009092 Ga0105250_10011442 Ga0105250_100114424 181
138 3300009092 Ga0105250_10195951 Ga0105250_101959512 181
139 3300009093 Ga0105240_10000953 Ga0105240_1000095324 181
140 3300009093 Ga0105240_10053213 Ga0105240_100532134 181
141 3300009094 Ga0111539_10053118 Ga0111539_100531183 181
142 3300009147 Ga0114129_10002596 Ga0114129_1000259621 181
143 3300009545 Ga0105237_10810940 Ga0105237_108109401 181
144 3300009545 Ga0105237_10849496 Ga0105237_108494962 181
145 3300009551 Ga0105238_10071877 Ga0105238_100718773 181
146 3300010375 Ga0105239_10272500 Ga0105239_102725002 181
147 3300010375 Ga0105239_11761499 Ga0105239_117614991 181
148 3300013102 Ga0157371_10002598 Ga0157371_1000259817 181
149 3300013102 Ga0157371_10431401 Ga0157371_104314012 181
150 3300013105 Ga0157369_10030606 Ga0157369_100306062 181
151 3300013105 Ga0157369_10103817 Ga0157369_101038174 181
152 3300014968 Ga0157379_10057510 Ga0157379_100575102 181
153 3300014969 Ga0157376_10411089 Ga0157376_104110892 181
154 3300021358 Ga0213873_10186188 Ga0213873_101861881 181
155 3300021441 Ga0213871_10094445 Ga0213871_100944451 181
156 3300025711 Ga0207696_1019948 Ga0207696_10199482 181
157 3300025904 Ga0207647_10015219 Ga0207647_100152192 181
158 3300025906 Ga0207699_10394646 Ga0207699_103946461 181
159 3300025909 Ga0207705_10017495 Ga0207705_100174952 181
160 3300025913 Ga0207695_10001392 Ga0207695_1000139229 181
161 3300025913 Ga0207695_10012565 Ga0207695_100125654 181
162 3300025919 Ga0207657_10011155 Ga0207657_100111559 181
163 3300025920 Ga0207649_10156647 Ga0207649_101566472 181
164 3300025921 Ga0207652_10376380 Ga0207652_103763802 181
165 3300025924 Ga0207694_10028930 Ga0207694_100289304 181
166 3300025932 Ga0207690_10082906 Ga0207690_100829062 181
167 3300025949 Ga0207667_10043428 Ga0207667_100434282 181
168 3300025949 Ga0207667_10219969 Ga0207667_102199692 181
169 3300026035 Ga0207703_10000138 Ga0207703_1000013848 181
170 3300026041 Ga0207639_11235656 Ga0207639_112356561 181
171 3300026078 Ga0207702_10010005 Ga0207702_100100055 181
172 3300026078 Ga0207702_10024619 Ga0207702_100246193 181
173 3300026088 Ga0207641_10000005 Ga0207641_10000005184 181
174 3300026095 Ga0207676_10000049 Ga0207676_1000004944 181
175 3300026142 Ga0207698_10032443 Ga0207698_100324433 181
176 3300027907 Ga0207428_10398056 Ga0207428_103980562 181
177 3300028379 Ga0268266_10013344 Ga0268266_100133443 181
178 3300039438 Ga0436360_0840185 Ga0436360_0840185_3600_4157 181
179 3300039447 Ga0436361_0765742 Ga0436361_0765742_168_725 181
180 3300039453 Ga0436362_0327678 Ga0436362_0327678_2395_2952 181
181 3300048919 Ga0496116_0000032 Ga0496116_0000032_30059_30613 181
182 3300048920 Ga0496117_0140304 Ga0496117_0140304_774_1328 181
183 3300048921 Ga0496118_0080015 Ga0496118_0080015_1008_1562 181
184 3300048922 Ga0496119_0267097 Ga0496119_0267097_136_687 181
185 3300048927 Ga0496124_0022773 Ga0496124_0022773_1710_2264 181
186 3300048928 Ga0496125_0000059 Ga0496125_0000059_27960_28514 181
187 3300048929 Ga0496126_0021156 Ga0496126_0021156_5716_6270 181
188 3300050507 nmdc:mga05p37_488_c1 nmdc:mga05p37_488_c1_27182_27736 181
189 3300050508 nmdc:mga09592_357476_c1 nmdc:mga09592_357476_c1_235_789 181
190 3300050509 nmdc:mga0qj67_644618_c1 nmdc:mga0qj67_644618_c1_123_677 181
191 3300050510 nmdc:mga06r32_533134_c1 nmdc:mga06r32_533134_c1_368_922 181
192 3300050515 nmdc:mga0a205_102825_c1 nmdc:mga0a205_102825_c1_1170_1724 181
193 3300005843 Ga0068860_100703815 Ga0068860_1007038152 182
194 3300031711 Ga0265314_10225731 Ga0265314_102257312 182
195 iso_pu_bacteria 2508501123 2509115760 182
196 iso_pu_bacteria 2510065059 2510314978 182
197 iso_pu_bacteria 2512875016 2512933913 182
198 iso_pu_bacteria 2512875024 2512962168 182
199 iso_pu_bacteria 2513237164 2514037166 182
200 iso_pu_bacteria 2588253730 2588520022 182
201 iso_pu_bacteria 2643221595 2643983545 182
202 iso_pu_bacteria 2643221627 2644157186 182
203 iso_pu_bacteria 2756170246 2756675036 182
204 iso_pu_bacteria 2791355123 2792747138 182
205 iso_pu_bacteria 2844002411 2844003478 182
206 iso_pu_bacteria 2844009547 2844010759 182
207 iso_pu_bacteria 2856320880 2856321008 182
208 iso_pu_bacteria 2856328259 2856332571 182
209 iso_pu_bacteria 2856334872 2856338419 182
210 iso_pu_bacteria 2857367948 2857369805 182
211 iso_pu_bacteria 2869169390 2869170075 182
212 iso_pu_bacteria 2869242130 2869247577 182
213 iso_pu_bacteria 2869256925 2869262854 182
214 iso_pu_bacteria 2869271264 2869277185 182
215 iso_pu_bacteria 2869278585 2869280759 182
216 iso_pu_bacteria 2871451962 2871454378 182
217 iso_pu_bacteria 2871466892 2871474331 182
218 iso_pu_bacteria 2871481445 2871487996 182
219 iso_pu_bacteria 2874116593 2874122795 182
220 iso_pu_bacteria 2874162495 2874165873 182
221 iso_pu_bacteria 2876363079 2876363832 182
222 iso_pu_bacteria 2876386047 2876389819 182
223 iso_pu_bacteria 2876399893 2876400072 182
224 iso_pu_bacteria 2876406927 2876407382 182
225 iso_pu_bacteria 2876420981 2876426808 182
226 iso_pu_bacteria 2878774303 2878777774 182
227 iso_pu_bacteria 2888337043 2888343110 182
228 iso_pu_bacteria 2903448605 2903454084 182
229 iso_pu_bacteria 2903521522 2903526009 182
230 iso_pu_bacteria 2903528002 2903532445 182
231 iso_pu_bacteria 2906378014 2906381495 182
232 iso_pu_bacteria 2906386501 2906386938 182
233 iso_pu_bacteria 2906401398 2906408202 182
234 iso_pu_bacteria 2906408224 2906413334 182
235 iso_pu_bacteria 2906427513 2906433582 182
236 iso_pu_bacteria 2922172374 2922174335 182
237 iso_pu_bacteria 2922178524 2922178998 182
238 iso_pu_bacteria 2924718760 2924722263 182
239 iso_pu_bacteria 2924741084 2924748051 182
240 iso_pu_bacteria 2924748358 2924748864 182
241 iso_pu_bacteria 2924762789 2924768317 182
242 iso_pu_bacteria 2937877337 2937878232 182
243 iso_pu_bacteria 2937980651 2937987747 182
244 iso_pu_bacteria 2958034702 2958036632 182
245 iso_pu_bacteria 2958041894 2958046479 182
246 iso_pu_bacteria 2958084443 2958085347 182
247 iso_pu_bacteria 2958108152 2958109132 182
248 iso_pu_bacteria 2958122699 2958125552 182
249 iso_pu_bacteria 2958137437 2958138700 182
250 iso_pu_bacteria 2958144490 2958146100 182
251 iso_pu_bacteria 2958158011 2958159214 182
252 iso_pu_bacteria 2961136820 2961139102 182
253 iso_pu_bacteria 2961183825 2961185598 182
254 iso_pu_bacteria 2963644680 2963645291 182
255 iso_pu_bacteria 2965025482 2965030019 182
256 iso_pu_bacteria 2965032056 2965036338 182
257 iso_pu_bacteria 2965047637 2965052310 182
258 iso_pu_bacteria 2965102966 2965108316 182
259 iso_pu_bacteria 2968016561 2968023179 182
260 iso_pu_bacteria 2968083720 2968089810 182
261 iso_pu_bacteria 2968138860 2968146946 182
262 iso_pu_bacteria 2970469710 2970475763 182
263 iso_pu_bacteria 2970489779 2970492005 182
264 iso_pu_bacteria 2970547951 2970553319 182
265 iso_pu_bacteria 2970593180 2970595373 182
266 iso_pu_bacteria 2970619444 2970623223 182
267 iso_pu_bacteria 2970627176 2970633984 182
268 iso_pu_bacteria 2977851361 2977855754 182
269 iso_pu_bacteria 2977872689 2977876589 182
270 iso_pu_bacteria 2977898635 2977905266 182
271 iso_pu_bacteria 2977907340 2977912928 182
272 iso_pu_bacteria 2977935797 2977941058 182
273 iso_pu_bacteria 2977957713 2977960802 182
274 iso_pu_bacteria 2979764755 2979765184 182
275 iso_pu_bacteria 2979772303 2979774882 182
276 iso_pu_bacteria 2987645492 2987648230 182
277 iso_pu_bacteria 2987666974 2987671938 182
278 iso_pu_bacteria 3004211236 3004217064 182
279 iso_pu_bacteria 3004218560 3004225343 182
280 iso_pu_bacteria 3004248173 3004250299 182
281 iso_pu_bacteria 3004268573 3004269231 182
282 iso_pu_bacteria 637000159 637077067 182
283 iso_pu_bacteria 8004300914 8004301893 182
284 iso_pu_bacteria 8004312739 8004317007 182
285 3300005355 Ga0070671_100386287 Ga0070671_1003862871 183
286 3300005436 Ga0070713_100505446 Ga0070713_1005054461 183
287 3300005459 Ga0068867_100029318 Ga0068867_1000293183 183
288 3300005548 Ga0070665_100178074 Ga0070665_1001780742 183
289 3300006195 Ga0075366_10073792 Ga0075366_100737921 183
290 3300006237 Ga0097621_100477374 Ga0097621_1004773742 183
291 3300010375 Ga0105239_10505961 Ga0105239_105059611 183
292 3300013102 Ga0157371_10080458 Ga0157371_100804582 183
293 3300013297 Ga0157378_10002116 Ga0157378_100021169 183
294 3300014969 Ga0157376_11578698 Ga0157376_115786982 183
295 3300021384 Ga0213876_10258390 Ga0213876_102583901 183
296 3300025925 Ga0207650_10393233 Ga0207650_103932332 183
297 3300025931 Ga0207644_10242645 Ga0207644_102426452 183
298 3300025972 Ga0207668_10299255 Ga0207668_102992552 183
299 3300026023 Ga0207677_10092312 Ga0207677_100923123 183
300 3300026089 Ga0207648_10006384 Ga0207648_100063848 183
301 3300026118 Ga0207675_100198955 Ga0207675_1001989552 183
302 3300028379 Ga0268266_10138823 Ga0268266_101388233 183
303 3300028380 Ga0268265_10119220 Ga0268265_101192203 183
304 3300039437 Ga0436365_0174155 Ga0436365_0174155_4378_4950 183
305 3300039447 Ga0436361_0095125 Ga0436361_0095125_2885_3454 183
306 3300041463 Ga0451804_0618468 Ga0451804_0618468_44_613 183
307 3300005356 Ga0070674_100039640 Ga0070674_1000396404 184
308 3300005459 Ga0068867_100112766 Ga0068867_1001127662 184
309 3300005548 Ga0070665_100060842 Ga0070665_1000608424 184
310 3300013102 Ga0157371_10017165 Ga0157371_100171655 184
311 3300013297 Ga0157378_10718668 Ga0157378_107186682 184
312 3300025937 Ga0207669_10042585 Ga0207669_100425853 184
313 3300025949 Ga0207667_10438315 Ga0207667_104383152 184
314 3300026089 Ga0207648_10155316 Ga0207648_101553163 184
315 3300028379 Ga0268266_10087447 Ga0268266_100874472 184
316 3300038443 Ga0395901_0805136 Ga0395901_0805136_116_673 184
317 3300050492 nmdc:mga0yw44_286864_c1 nmdc:mga0yw44_286864_c1_204_758 184
318 3300014325 Ga0163163_10599090 Ga0163163_105990902 185
319 3300001989 JGI24739J22299_10078180 JGI24739J22299_100781802 186
320 3300005327 Ga0070658_10083846 Ga0070658_100838462 186
321 3300005339 Ga0070660_100041993 Ga0070660_1000419933 186
322 3300005563 Ga0068855_100617355 Ga0068855_1006173551 186
323 3300005578 Ga0068854_100674711 Ga0068854_1006747112 186
324 3300005616 Ga0068852_100462818 Ga0068852_1004628182 186
325 3300006038 Ga0075365_10007879 Ga0075365_100078794 186
326 3300006048 Ga0075363_100137531 Ga0075363_1001375312 186
327 3300006051 Ga0075364_10032130 Ga0075364_100321302 186
328 3300006178 Ga0075367_10001418 Ga0075367_1000141810 186
329 3300006353 Ga0075370_10076854 Ga0075370_100768542 186
330 3300009093 Ga0105240_11842243 Ga0105240_118422431 186
331 3300009551 Ga0105238_10571035 Ga0105238_105710351 186
332 3300010375 Ga0105239_10275517 Ga0105239_102755172 186
333 3300010375 Ga0105239_10652635 Ga0105239_106526351 186
334 3300013104 Ga0157370_10214606 Ga0157370_102146062 186
335 3300013104 Ga0157370_11123743 Ga0157370_111237431 186
336 3300013105 Ga0157369_10094577 Ga0157369_100945772 186
337 3300014497 Ga0182008_10070181 Ga0182008_100701813 186
338 3300025254 Ga0209148_1000136 Ga0209148_100013691 186
339 3300025254 Ga0209148_1014516 Ga0209148_10145161 186
340 3300025272 Ga0209455_1000085 Ga0209455_100008530 186
341 3300025904 Ga0207647_10068329 Ga0207647_100683292 186
342 3300025909 Ga0207705_10204011 Ga0207705_102040111 186
343 3300025919 Ga0207657_10192998 Ga0207657_101929982 186
344 3300025986 Ga0207658_10622662 Ga0207658_106226621 186
345 3300026142 Ga0207698_10793737 Ga0207698_107937372 186
346 3300028794 Ga0307515_10155219 Ga0307515_101552191 186
347 3300041494 Ga0451837_0844656 Ga0451837_0844656_2966_3544 186
348 3300044684 Ga0466966_0476674 Ga0466966_0476674_127_705 186
349 3300045049 Ga0466959_0039411 Ga0466959_0039411_2295_2873 186
350 3300048905 Ga0496102_0556653 Ga0496102_0556653_178_738 186
351 3300048906 Ga0496103_0449480 Ga0496103_0449480_151_711 186
352 3300048915 Ga0496112_0297615 Ga0496112_0297615_458_1018 186
353 3300048921 Ga0496118_0143530 Ga0496118_0143530_773_1333 186
354 3300048922 Ga0496119_0055647 Ga0496119_0055647_1037_1597 186
355 3300048923 Ga0496120_0028760 Ga0496120_0028760_2301_2861 186
356 3300048928 Ga0496125_0543767 Ga0496125_0543767_60_620 186
357 3300048929 Ga0496126_0486236 Ga0496126_0486236_302_862 186
358 3300049592 Ga0501076_0816377 Ga0501076_0816377_103_684 186
359 3300050491 nmdc:mga00v17_17081_c1 nmdc:mga00v17_17081_c1_3150_3710 186
360 3300050492 nmdc:mga0yw44_539_c1 nmdc:mga0yw44_539_c1_3132_3692 186
361 3300050494 nmdc:mga06z11_24918_c1 nmdc:mga06z11_24918_c1_396_956 186
362 3300050496 nmdc:mga07m45_43756_c1 nmdc:mga07m45_43756_c1_1748_2308 186
363 3300053119 Ga0500595_085356 Ga0500595_085356_37_597 186
364 3300061719 Ga0466962_0118456 Ga0466962_0118456_258_836 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02469

Fasciclin

Fasciclin domain

73

208

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yjh-assembly1.cif.gz_A-2 structural insights into periostin functions 0.9346 37 185
6tjv-assembly1.cif.gz_Q structure of the ndh-1ms complex from thermosynechococcus elongatus 0.9313 41 186
7asg-assembly1.cif.gz_A tgfbip mutant r555w 0.928 37 183
7asc-assembly1.cif.gz_A tgfbip mutant a546t 0.9269 37 183
5nv6-assembly2.cif.gz_B structure of human transforming growth factor beta-induced protein (tgfbip). 0.914 39 186
ID Description Score Start End Superfamily
af_A0A0R4IS83_231_368_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.9378 37 186 2.30.180.10
af_F6P8Y7_1588_1717_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.9252 41 186 2.30.180.10
af_A0A0R4IS83_231_368_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.9248 37 186 2.30.180.10
af_Q503K1_495_625_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.9233 39 183 2.30.180.10
af_Q503K1_495_625_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.9166 39 183 2.30.180.10
ID Description Score Start End GO Terms
AF-A0A2N3KZH6-F1-model_v4 Fasciclin 1 28 186 GO:0005615
AF-A0A1G5D3L6-F1-model_v4 Uncaracterized surface protein containing fasciclin (FAS1) repeats 0.9978 27 186 GO:0005615
AF-A0A7W1HVK8-F1-model_v4 Fasciclin domain-containing protein 0.9966 27 186 GO:0005615
AF-A0A7W1HG19-F1-model_v4 Fasciclin domain-containing protein 0.996 28 186 GO:0005615
AF-A0A4S3LZN9-F1-model_v4 Fasciclin domain-containing protein 0.9957 41 185 GO:0005615

Feature Viewer

pLDDT pTM Quality
78.05 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map