F423234

General Info

Members Datasets Scaffolds Average Seq Length
364 214 364 270

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100008875|Ga0070706_1000088753
Length 326
Sequence MTHPLPRVVLTSHSMSALRSCTVCVNLNPCPGFGTINQMPKTFADLITLMDRLRSPDGCPWDREQTYATLAPMLLEEAYEAFDXXXXAREGRPEALREELGDLLFQITFFARVAKERGEFNIDDVIEQVHEKMVRRHPHVFGETKAGDSAEVLRNWEAIKAEEKRAARKGEAKPADTSILDGVSTKAPALMEAHQISTKVARVGFDWTRIKDIFEKLQEEVQELHGAIEQHQNSSAETDHAHIREEIGDLLFVVTNIARRLNVEPEAALKLSNRKFRRRFAYIESKLREQNRKFDETTLDQLEELWQEAKSVEIKPQKGTRSAKME

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000017 3300002074 Bacteria 133780
2 JGI24034J26672_10000017 3300002239 Bacteria 133784
3 Ga0065707_10102612 3300005295 Bacteria 2795
4 Ga0065707_10206499 3300005295 Bacteria 1286
5 Ga0070683_100110381 3300005329 Bacteria 2594
6 Ga0070677_10079796 3300005333 Unclassified 1397
7 Ga0068869_100024450 3300005334 Bacteria 4184
8 Ga0070671_100206050 3300005355 Bacteria 1668
9 Ga0070688_100058074 3300005365 Bacteria 2435
10 Ga0070667_100184723 3300005367 Bacteria 1845
11 Ga0070703_10000150 3300005406 Bacteria 35810
12 Ga0070703_10008668 3300005406 Bacteria 2861
13 Ga0070709_10215134 3300005434 Unclassified 1368
14 Ga0070710_10073830 3300005437 Bacteria 1973
15 Ga0070710_10105610 3300005437 Bacteria 1684
16 Ga0070711_100101808 3300005439 Bacteria 2091
17 Ga0070705_100139542 3300005440 Unclassified 1593
18 Ga0070705_100306265 3300005440 Unclassified 1141
19 Ga0070700_100001463 3300005441 Bacteria 11748
20 Ga0070694_100000814 3300005444 Bacteria 17486
21 Ga0070708_100126469 3300005445 Bacteria 2363
22 Ga0070708_100195173 3300005445 Bacteria 1894
23 Ga0070663_100371062 3300005455 Bacteria 1163
24 Ga0070678_100044013 3300005456 Bacteria 3185
25 Ga0070681_10004452 3300005458 Bacteria 13341
26 Ga0068867_100022106 3300005459 Bacteria 4545
27 Ga0068867_100137963 3300005459 Bacteria 1903
28 Ga0070706_100008875 3300005467 Bacteria 9363
29 Ga0070706_100011763 3300005467 Bacteria 8121
30 Ga0070706_100023774 3300005467 Bacteria 5641
31 Ga0070706_100102795 3300005467 Bacteria 2657
32 Ga0070706_100300393 3300005467 Unclassified 1498
33 Ga0070707_100000676 3300005468 Bacteria 33797
34 Ga0070707_100098695 3300005468 Bacteria 2829
35 Ga0070707_100347290 3300005468 Bacteria 1441
36 Ga0070698_100000005 3300005471 Bacteria 131348
37 Ga0070698_100051209 3300005471 Bacteria 4207
38 Ga0070698_100070050 3300005471 Bacteria 3519
39 Ga0070698_100109329 3300005471 Bacteria 2731
40 Ga0070699_100498635 3300005518 Unclassified 1106
41 Ga0070699_100550612 3300005518 Bacteria 1050
42 Ga0070684_100002126 3300005535 Bacteria 14619
43 Ga0070684_100084303 3300005535 Bacteria 2817
44 Ga0070697_100008998 3300005536 Bacteria 7800
45 Ga0070697_100015603 3300005536 Bacteria 5965
46 Ga0070697_100040714 3300005536 Unclassified 3760
47 Ga0070697_100046311 3300005536 Unclassified 3525
48 Ga0070686_100045273 3300005544 Bacteria 2771
49 Ga0070695_100064414 3300005545 Bacteria 2384
50 Ga0070695_100122240 3300005545 Bacteria 1783
51 Ga0070695_100470133 3300005545 Bacteria 967
52 Ga0070693_100044696 3300005547 Unclassified 2506
53 Ga0070704_100005711 3300005549 Bacteria 7271
54 Ga0070704_100642715 3300005549 Bacteria 936
55 Ga0070664_100182484 3300005564 Bacteria 1866
56 Ga0068857_100076976 3300005577 Bacteria 2976
57 Ga0070702_100044850 3300005615 Bacteria 2498
58 Ga0070702_100363347 3300005615 Bacteria 1024
59 Ga0068859_100006581 3300005617 Bacteria 11793
60 Ga0068864_100087013 3300005618 Unclassified 2750
61 Ga0068858_100000146 3300005842 Bacteria 75219
62 Ga0068858_100087480 3300005842 Bacteria 2898
63 Ga0068858_100448998 3300005842 Bacteria 1242
64 Ga0068860_100105657 3300005843 Bacteria 2689
65 Ga0068860_100215502 3300005843 Bacteria 1863
66 Ga0068860_100494721 3300005843 Bacteria 1220
67 Ga0068862_100014630 3300005844 Bacteria 6517
68 Ga0081538_10005452 3300005981 Bacteria 11423
69 Ga0081538_10030013 3300005981 Bacteria 3700
70 Ga0081540_1004199 3300005983 Bacteria 11072
71 Ga0081539_10000216 3300005985 Bacteria 134976
72 Ga0081539_10042555 3300005985 Bacteria 2644
73 Ga0070717_10030221 3300006028 Bacteria 4352
74 Ga0075365_10015014 3300006038 Bacteria 4673
75 Ga0075368_10152646 3300006042 Bacteria 965
76 Ga0070715_10000004 3300006163 Bacteria 305411
77 Ga0070716_100000006 3300006173 Bacteria 268067
78 Ga0070716_100120143 3300006173 Unclassified 1644
79 Ga0070716_100171460 3300006173 Bacteria 1416
80 Ga0070716_100287173 3300006173 Unclassified 1138
81 Ga0070712_100024161 3300006175 Bacteria 4023
82 Ga0097621_100019955 3300006237 Bacteria 5157
83 Ga0075428_100134149 3300006844 Bacteria 2692
84 Ga0075433_10024957 3300006852 Bacteria 5050
85 Ga0075433_10059461 3300006852 Bacteria 3344
86 Ga0075434_100408325 3300006871 Bacteria 1379
87 Ga0075429_100109877 3300006880 Bacteria 2410
88 Ga0075436_100000115 3300006914 Bacteria 47382
89 Ga0075436_100347725 3300006914 Bacteria 1068
90 Ga0097620_100006580 3300006931 Bacteria 11793
91 Ga0075435_100008004 3300007076 Bacteria 7566
92 Ga0075435_100199046 3300007076 Bacteria 1697
93 Ga0099794_10023010 3300007265 Bacteria 2845
94 Ga0099795_10067730 3300007788 Bacteria 1340
95 Ga0105240_10038727 3300009093 Bacteria 6113
96 Ga0105245_10027435 3300009098 Bacteria 5017
97 Ga0105247_10000004 3300009101 Bacteria 455497
98 Ga0105247_10062216 3300009101 Unclassified 2315
99 Ga0105247_10251181 3300009101 Unclassified 1209
100 Ga0114129_10003551 3300009147 Bacteria 21951
101 Ga0114129_10012333 3300009147 Bacteria 12164
102 Ga0114129_10327575 3300009147 Bacteria 2035
103 Ga0114129_11122214 3300009147 Bacteria 983
104 Ga0105243_10000063 3300009148 Bacteria 127358
105 Ga0105243_10000882 3300009148 Bacteria 28260
106 Ga0105243_10027710 3300009148 Bacteria 4343
107 Ga0105243_10317831 3300009148 Bacteria 1418
108 Ga0105243_10489145 3300009148 Bacteria 1163
109 Ga0105242_10000004 3300009176 Bacteria 224767
110 Ga0105242_10002586 3300009176 Bacteria 14179
111 Ga0105242_10020195 3300009176 Bacteria 5222
112 Ga0105242_10117732 3300009176 Bacteria 2275
113 Ga0105248_10076836 3300009177 Unclassified 3753
114 Ga0105248_10278265 3300009177 Bacteria 1884
115 Ga0105238_10627335 3300009551 Bacteria 1084
116 Ga0105249_10000003 3300009553 Bacteria 370855
117 Ga0105249_10033092 3300009553 Bacteria 4680
118 Ga0105249_10036713 3300009553 Bacteria 4445
119 Ga0105249_10061857 3300009553 Bacteria 3436
120 Ga0105246_10035277 3300011119 Bacteria 3342
121 Ga0157378_10000032 3300013297 Bacteria 122562
122 Ga0157378_10010412 3300013297 Bacteria 8119
123 Ga0157378_10039856 3300013297 Bacteria 4166
124 Ga0157378_10120134 3300013297 Bacteria 2421
125 Ga0157378_10251370 3300013297 Unclassified 1692
126 Ga0157378_10284727 3300013297 Unclassified 1594
127 Ga0157378_10540382 3300013297 Bacteria 1169
128 Ga0163162_10000033 3300013306 Bacteria 150185
129 Ga0163162_10036872 3300013306 Bacteria 4876
130 Ga0157375_10014702 3300013308 Bacteria 6993
131 Ga0157380_10050160 3300014326 Bacteria 3295
132 Ga0157379_10055952 3300014968 Bacteria 3525
133 Ga0157376_10000004 3300014969 Bacteria 508493
134 Ga0157376_10081856 3300014969 Bacteria 2772
135 Ga0163161_10082594 3300017792 Bacteria 2367
136 Ga0207672_1000411 3300025223 Bacteria 5434
137 Ga0207653_10000014 3300025885 Bacteria 152002
138 Ga0207710_10000002 3300025900 Bacteria 1251998
139 Ga0207688_10052647 3300025901 Bacteria 2281
140 Ga0207685_10000004 3300025905 Bacteria 305368
141 Ga0207699_10099281 3300025906 Bacteria 1844
142 Ga0207699_10117614 3300025906 Unclassified 1714
143 Ga0207643_10112652 3300025908 Archaea 1604
144 Ga0207684_10006838 3300025910 Bacteria 10331
145 Ga0207684_10045520 3300025910 Bacteria 3721
146 Ga0207684_10080600 3300025910 Bacteria 2769
147 Ga0207684_10094946 3300025910 Bacteria 2544
148 Ga0207695_10058334 3300025913 Bacteria 4007
149 Ga0207693_10027989 3300025915 Bacteria 4455
150 Ga0207663_10068184 3300025916 Bacteria 2284
151 Ga0207663_10298955 3300025916 Bacteria 1202
152 Ga0207646_10000329 3300025922 Bacteria 64353
153 Ga0207646_10005620 3300025922 Bacteria 13167
154 Ga0207646_10051333 3300025922 Bacteria 3690
155 Ga0207646_10071427 3300025922 Bacteria 3100
156 Ga0207646_10305653 3300025922 Bacteria 1437
157 Ga0207646_10467764 3300025922 Unclassified 1137
158 Ga0207659_10578765 3300025926 Bacteria 956
159 Ga0207687_10123359 3300025927 Bacteria 1941
160 Ga0207644_10000717 3300025931 Bacteria 20994
161 Ga0207644_10167677 3300025931 Bacteria 1712
162 Ga0207686_10000005 3300025934 Bacteria 260873
163 Ga0207686_10008298 3300025934 Bacteria 5605
164 Ga0207686_10024738 3300025934 Bacteria 3484
165 Ga0207686_10067289 3300025934 Bacteria 2291
166 Ga0207709_10000088 3300025935 Bacteria 152210
167 Ga0207709_10000339 3300025935 Bacteria 48683
168 Ga0207709_10241025 3300025935 Bacteria 1315
169 Ga0207704_10008221 3300025938 Bacteria 4974
170 Ga0207704_10043115 3300025938 Unclassified 2661
171 Ga0207665_10000005 3300025939 Bacteria 194919
172 Ga0207691_10268608 3300025940 Bacteria 1469
173 Ga0207711_10068558 3300025941 Unclassified 3072
174 Ga0207711_10104485 3300025941 Bacteria 2510
175 Ga0207689_10040589 3300025942 Bacteria 3852
176 Ga0207689_10117771 3300025942 Unclassified 2184
177 Ga0207661_10035854 3300025944 Bacteria 3868
178 Ga0207661_10051197 3300025944 Bacteria 3294
179 Ga0207712_10000060 3300025961 Bacteria 136248
180 Ga0207712_10017386 3300025961 Bacteria 4669
181 Ga0207658_10038239 3300025986 Bacteria 3455
182 Ga0207677_10123626 3300026023 Bacteria 1951
183 Ga0207703_10000120 3300026035 Bacteria 94585
184 Ga0207703_10046888 3300026035 Bacteria 3483
185 Ga0207703_10418441 3300026035 Unclassified 1246
186 Ga0207708_10026184 3300026075 Bacteria 4412
187 Ga0207708_10315429 3300026075 Bacteria 1275
188 Ga0207648_10082135 3300026089 Bacteria 2810
189 Ga0207648_10185481 3300026089 Bacteria 1842
190 Ga0207676_10066687 3300026095 Unclassified 2872
191 Ga0207674_10085056 3300026116 Bacteria 3160
192 Ga0207428_10011059 3300027907 Bacteria 8019
193 Ga0265354_1000015 3300028016 Bacteria 26137
194 Ga0268266_10001048 3300028379 Bacteria 34678
195 Ga0268265_10569642 3300028380 Bacteria 1078
196 Ga0268265_10635262 3300028380 Bacteria 1024
197 Ga0268264_10066008 3300028381 Bacteria 3051
198 Ga0268264_10200426 3300028381 Unclassified 1826
199 Ga0265770_1000754 3300030878 Bacteria 4518
200 Ga0265760_10004795 3300031090 Unclassified 3874
201 Ga0265313_10021963 3300031595 Bacteria 3477
202 Ga0307415_100396650 3300032126 Bacteria 1177
203 Ga0373934_0023322 3300035086 Bacteria 2391
204 Ga0373955_0015594 3300035172 Bacteria 3724
205 Ga0373935_0497411 3300035692 Unclassified 885
206 Ga0373933_0000656 3300035724 Bacteria 21491
207 Ga0373937_0000214 3300036401 Bacteria 55908
208 Ga0395899_0024491 3300037312 Bacteria 4563
209 Ga0395899_0045306 3300037312 Bacteria 3277
210 Ga0395899_0054326 3300037312 Bacteria 2964
211 Ga0395900_0014254 3300037418 Bacteria 8113
212 Ga0395900_0017090 3300037418 Bacteria 7406
213 Ga0395900_0113989 3300037418 Bacteria 2774
214 Ga0395900_0448702 3300037418 Bacteria 1246
215 Ga0395898_0009330 3300037466 Bacteria 10310
216 Ga0395898_0015180 3300037466 Bacteria 7906
217 Ga0395898_0035473 3300037466 Bacteria 4958
218 Ga0395898_0122355 3300037466 Bacteria 2493
219 Ga0395898_0239282 3300037466 Bacteria 1731
220 Ga0395905_0006666 3300037471 Bacteria 11576
221 Ga0395905_0012801 3300037471 Bacteria 8067
222 Ga0395905_0013003 3300037471 Bacteria 7998
223 Ga0395905_0109031 3300037471 Bacteria 2599
224 Ga0395901_0004354 3300038443 Bacteria 14285
225 Ga0395901_0023584 3300038443 Bacteria 6308
226 Ga0395901_0025968 3300038443 Bacteria 6014
227 Ga0395901_0060213 3300038443 Bacteria 3950
228 Ga0395901_0065212 3300038443 Bacteria 3791
229 Ga0395901_0154419 3300038443 Bacteria 2411
230 Ga0395901_0166254 3300038443 Bacteria 2316
231 Ga0395901_0174889 3300038443 Bacteria 2252
232 Ga0439448_0037828 3300042005 Bacteria 1552
233 Ga0451577_0000110 3300042876 Bacteria 181039
234 Ga0451577_0001313 3300042876 Bacteria 34000
235 Ga0451577_0003752 3300042876 Bacteria 16565
236 Ga0451577_0039225 3300042876 Bacteria 4256
237 Ga0451577_0470161 3300042876 Unclassified 1142
238 Ga0466969_0004678 3300044656 Bacteria 7291
239 Ga0466969_0013814 3300044656 Bacteria 4251
240 Ga0466965_0091904 3300044683 Bacteria 1545
241 Ga0466966_0000227 3300044684 Bacteria 37516
242 Ga0466961_0001393 3300044693 Bacteria 14971
243 Ga0466961_0019694 3300044693 Bacteria 4341
244 Ga0453684_0000152 3300044712 Bacteria 305949
245 Ga0453684_0000327 3300044712 Bacteria 200341
246 Ga0453684_0017467 3300044712 Bacteria 11112
247 Ga0453684_0025179 3300044712 Bacteria 8649
248 Ga0453684_0108233 3300044712 Bacteria 3383
249 Ga0466971_0006340 3300044719 Bacteria 5135
250 Ga0466971_0008797 3300044719 Bacteria 4406
251 Ga0466970_0000417 3300044765 Bacteria 20826
252 Ga0466957_0002749 3300044842 Bacteria 9522
253 Ga0466957_0003013 3300044842 Bacteria 9146
254 Ga0466959_0001227 3300045049 Bacteria 15480
255 Ga0466959_0019781 3300045049 Bacteria 4954
256 Ga0451576_0025470 3300045051 Bacteria 6372
257 Ga0451576_0770456 3300045051 Unclassified 1011
258 Ga0466958_0007285 3300045836 Bacteria 6073
259 Ga0495603_0046941 3300046455 Bacteria 2573
260 Ga0495651_0004025 3300046462 Bacteria 11236
261 Ga0495651_0087388 3300046462 Bacteria 2344
262 Ga0495653_0103879 3300046463 Bacteria 2054
263 Ga0495653_0234548 3300046463 Bacteria 1226
264 Ga0495608_0193781 3300046511 Bacteria 1282
265 Ga0495628_0027063 3300046516 Bacteria 4668
266 Ga0495630_0037978 3300046517 Bacteria 3601
267 Ga0495637_0068872 3300046520 Bacteria 1433
268 Ga0495644_0038214 3300046523 Bacteria 1811
269 Ga0495666_0123708 3300046526 Bacteria 1210
270 Ga0495652_0151776 3300046529 Bacteria 1809
271 Ga0495665_0373075 3300046531 Unclassified 725
272 Ga0495587_0000401 3300046536 Bacteria 30655
273 Ga0495587_0099048 3300046536 Bacteria 1680
274 Ga0495633_0078621 3300046558 Bacteria 1536
275 Ga0495667_0081546 3300046559 Bacteria 2102
276 Ga0495656_0096069 3300046615 Unclassified 1363
277 Ga0495635_0217972 3300046663 Bacteria 1291
278 Ga0495659_0014776 3300046664 Bacteria 2561
279 Ga0495659_0023046 3300046664 Bacteria 2112
280 Ga0495659_0072820 3300046664 Bacteria 1290
281 Ga0495657_0024808 3300046675 Bacteria 4265
282 Ga0495657_0167696 3300046675 Bacteria 1354
283 Ga0495657_0239470 3300046675 Bacteria 1095
284 Ga0495599_0019608 3300046678 Bacteria 4215
285 Ga0495599_0130163 3300046678 Bacteria 1563
286 Ga0495623_0025444 3300046679 Bacteria 3813
287 Ga0495658_0030054 3300046683 Bacteria 2947
288 Ga0495613_0040611 3300046689 Bacteria 3447
289 Ga0495600_0080543 3300046809 Bacteria 2126
290 Ga0495581_0010785 3300047315 Bacteria 5286
291 Ga0495674_0143599 3300047319 Bacteria 2005
292 Ga0495683_0180742 3300047323 Bacteria 964
293 Ga0495675_0001963 3300047444 Bacteria 12267
294 Ga0495677_0029261 3300047445 Bacteria 2003
295 Ga0495602_0000216 3300048088 Bacteria 53347
296 Ga0495602_0039637 3300048088 Bacteria 4335
297 Ga0495602_0136244 3300048088 Bacteria 1950
298 Ga0496104_0269002 3300048907 Bacteria 1617
299 Ga0496106_0000607 3300048909 Bacteria 25590
300 Ga0496108_0122124 3300048911 Bacteria 2235
301 Ga0496108_0180122 3300048911 Bacteria 1830
302 Ga0496109_0121890 3300048912 Bacteria 2429
303 Ga0496110_0136824 3300048913 Bacteria 2214
304 Ga0496110_0303565 3300048913 Bacteria 1454
305 Ga0496111_0042496 3300048914 Bacteria 3264
306 Ga0496112_0597456 3300048915 Archaea 1036
307 Ga0496114_0009417 3300048917 Bacteria 7754
308 Ga0501031_0001667 3300049568 Bacteria 13942
309 Ga0501031_0003071 3300049568 Bacteria 10684
310 Ga0501032_0010949 3300049569 Bacteria 6522
311 Ga0501033_0096514 3300049570 Bacteria 2160
312 Ga0501036_0003429 3300049572 Bacteria 12666
313 Ga0501037_0015697 3300049573 Bacteria 5572
314 Ga0501039_0032416 3300049575 Bacteria 4028
315 Ga0501041_0001403 3300049577 Bacteria 13324
316 Ga0501041_0011549 3300049577 Bacteria 5222
317 Ga0501042_0005138 3300049578 Bacteria 8400
318 Ga0501043_0002468 3300049579 Bacteria 15647
319 Ga0501043_0169623 3300049579 Bacteria 1703
320 Ga0501046_0001657 3300049580 Bacteria 21287
321 Ga0501046_0009819 3300049580 Bacteria 8253
322 Ga0501048_0001556 3300049582 Bacteria 17438
323 Ga0501068_0001015 3300049584 Bacteria 14807
324 Ga0501068_0071530 3300049584 Bacteria 2117
325 Ga0501069_0009126 3300049585 Bacteria 5235
326 Ga0501069_0023354 3300049585 Bacteria 3372
327 Ga0501070_0002518 3300049586 Bacteria 16063
328 Ga0501070_0009833 3300049586 Bacteria 8086
329 Ga0501071_0002752 3300049587 Bacteria 10790
330 Ga0501071_0073525 3300049587 Bacteria 2493
331 Ga0501072_0002233 3300049588 Bacteria 14465
332 Ga0501073_0002371 3300049589 Bacteria 14107
333 Ga0501074_0004019 3300049590 Bacteria 10488
334 Ga0501075_0020472 3300049591 Bacteria 4814
335 Ga0501076_0006264 3300049592 Bacteria 8618
336 Ga0501077_0002996 3300049593 Bacteria 10123
337 Ga0501077_0003607 3300049593 Bacteria 9311
338 Ga0501079_0034205 3300049741 Bacteria 3910
339 Ga0501080_0008766 3300049742 Bacteria 9189
340 Ga0501081_0001790 3300049743 Bacteria 13320
341 Ga0501081_0003061 3300049743 Bacteria 10611
342 Ga0501035_0005619 3300049822 Bacteria 11840
343 Ga0501035_0017348 3300049822 Bacteria 6638
344 Ga0501045_0001730 3300049824 Bacteria 14699
345 Ga0501045_0147951 3300049824 Bacteria 1747
346 nmdc:mga0yw44_56742_c1 3300050492 Bacteria 2387
347 nmdc:mga04h51_123366_c1 3300050495 Bacteria 967
348 nmdc:mga05p37_11057_c1 3300050507 Bacteria 10723
349 nmdc:mga05p37_144302_c1 3300050507 Bacteria 2916
350 nmdc:mga09592_295170_c1 3300050508 Bacteria 1405
351 nmdc:mga0n895_471707_c1 3300050512 Bacteria 1266
352 nmdc:mga0rr50_251313_c1 3300050513 Bacteria 1468
353 nmdc:mga0rr50_59398_c1 3300050513 Unclassified 2871
354 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
355 nmdc:mga0a205_31366_c1 3300050515 Bacteria 5092
356 nmdc:mga0a205_32191_c1 3300050515 Bacteria 5028
357 Ga0495601_0201174 3300053077 Bacteria 1301
358 Ga0495595_0061921 3300053084 Bacteria 1753
359 Ga0495595_0088905 3300053084 Bacteria 1480
360 Ga0495595_0113140 3300053084 Bacteria 1317
361 Ga0501084_0004298 3300054114 Bacteria 11601
362 Ga0466962_0001067 3300061719 Bacteria 12610
363 Ga0466962_0001486 3300061719 Bacteria 10935
364 Ga0530510_0039179 3300061734 Bacteria 3420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0001667 Ga0501031_0001667_11428_12081 213
2 3300049569 Ga0501032_0010949 Ga0501032_0010949_4129_4782 213
3 3300049573 Ga0501037_0015697 Ga0501037_0015697_2584_3237 213
4 3300049577 Ga0501041_0001403 Ga0501041_0001403_10327_10980 213
5 3300049578 Ga0501042_0005138 Ga0501042_0005138_6014_6667 213
6 3300049579 Ga0501043_0002468 Ga0501043_0002468_5790_6443 213
7 3300049580 Ga0501046_0001657 Ga0501046_0001657_15630_16283 213
8 3300049582 Ga0501048_0001556 Ga0501048_0001556_6541_7194 213
9 3300049584 Ga0501068_0001015 Ga0501068_0001015_4808_5461 213
10 3300049585 Ga0501069_0009126 Ga0501069_0009126_3805_4458 213
11 3300049586 Ga0501070_0002518 Ga0501070_0002518_3473_4126 213
12 3300049587 Ga0501071_0002752 Ga0501071_0002752_6332_6985 213
13 3300049589 Ga0501073_0002371 Ga0501073_0002371_1396_2049 213
14 3300049590 Ga0501074_0004019 Ga0501074_0004019_1734_2387 213
15 3300049593 Ga0501077_0003607 Ga0501077_0003607_3255_3908 213
16 3300049741 Ga0501079_0034205 Ga0501079_0034205_1396_2049 213
17 3300049743 Ga0501081_0001790 Ga0501081_0001790_3806_4459 213
18 3300049822 Ga0501035_0017348 Ga0501035_0017348_1305_1958 213
19 3300049824 Ga0501045_0001730 Ga0501045_0001730_4588_5241 213
20 3300061734 Ga0530510_0039179 Ga0530510_0039179_906_1559 213
21 3300031595 Ga0265313_10021963 Ga0265313_100219633 217
22 3300048088 Ga0495602_0136244 Ga0495602_0136244_86_838 217
23 3300005981 Ga0081538_10030013 Ga0081538_100300133 221
24 3300046531 Ga0495665_0373075 Ga0495665_0373075_13_711 228
25 3300035692 Ga0373935_0497411 Ga0373935_0497411_44_814 237
26 3300042876 Ga0451577_0000110 Ga0451577_0000110_54277_55071 240
27 3300044712 Ga0453684_0000152 Ga0453684_0000152_152288_153082 240
28 3300044693 Ga0466961_0019694 Ga0466961_0019694_2689_3450 243
29 3300044719 Ga0466971_0006340 Ga0466971_0006340_4073_4834 243
30 3300044842 Ga0466957_0002749 Ga0466957_0002749_6053_6814 243
31 3300045836 Ga0466958_0007285 Ga0466958_0007285_3997_4758 243
32 3300053084 Ga0495595_0113140 Ga0495595_0113140_168_995 243
33 3300061719 Ga0466962_0001067 Ga0466962_0001067_8317_9078 243
34 3300046462 Ga0495651_0087388 Ga0495651_0087388_183_944 244
35 3300046463 Ga0495653_0103879 Ga0495653_0103879_1124_1885 244
36 3300046463 Ga0495653_0234548 Ga0495653_0234548_281_1108 244
37 3300046511 Ga0495608_0193781 Ga0495608_0193781_346_1107 244
38 3300046516 Ga0495628_0027063 Ga0495628_0027063_3315_4076 244
39 3300046529 Ga0495652_0151776 Ga0495652_0151776_237_998 244
40 3300046536 Ga0495587_0099048 Ga0495587_0099048_200_961 244
41 3300046559 Ga0495667_0081546 Ga0495667_0081546_648_1475 244
42 3300046663 Ga0495635_0217972 Ga0495635_0217972_418_1179 244
43 3300046675 Ga0495657_0024808 Ga0495657_0024808_2534_3361 244
44 3300046675 Ga0495657_0239470 Ga0495657_0239470_224_985 244
45 3300046678 Ga0495599_0019608 Ga0495599_0019608_1538_2299 244
46 3300046679 Ga0495623_0025444 Ga0495623_0025444_975_1736 244
47 3300046809 Ga0495600_0080543 Ga0495600_0080543_415_1176 244
48 3300047319 Ga0495674_0143599 Ga0495674_0143599_144_905 244
49 3300048088 Ga0495602_0039637 Ga0495602_0039637_2344_3105 244
50 3300053077 Ga0495601_0201174 Ga0495601_0201174_445_1206 244
51 3300053084 Ga0495595_0061921 Ga0495595_0061921_823_1584 244
52 3300053084 Ga0495595_0088905 Ga0495595_0088905_92_853 244
53 3300006844 Ga0075428_100134149 Ga0075428_1001341493 246
54 3300042005 Ga0439448_0037828 Ga0439448_0037828_386_1180 247
55 3300005439 Ga0070711_100101808 Ga0070711_1001018081 252
56 3300025916 Ga0207663_10068184 Ga0207663_100681843 252
57 3300035086 Ga0373934_0023322 Ga0373934_0023322_501_1445 253
58 3300035172 Ga0373955_0015594 Ga0373955_0015594_2538_3482 253
59 3300035724 Ga0373933_0000656 Ga0373933_0000656_8286_9230 253
60 3300036401 Ga0373937_0000214 Ga0373937_0000214_42191_43135 253
61 3300046462 Ga0495651_0004025 Ga0495651_0004025_6386_7330 253
62 3300046536 Ga0495587_0000401 Ga0495587_0000401_514_1458 253
63 3300046675 Ga0495657_0167696 Ga0495657_0167696_94_1038 253
64 3300046678 Ga0495599_0130163 Ga0495599_0130163_29_973 253
65 3300047444 Ga0495675_0001963 Ga0495675_0001963_317_1261 253
66 3300048088 Ga0495602_0000216 Ga0495602_0000216_51887_52831 253
67 3300005329 Ga0070683_100110381 Ga0070683_1001103812 255
68 3300005437 Ga0070710_10105610 Ga0070710_101056102 255
69 3300005445 Ga0070708_100195173 Ga0070708_1001951732 255
70 3300005467 Ga0070706_100023774 Ga0070706_1000237742 255
71 3300005471 Ga0070698_100070050 Ga0070698_1000700502 255
72 3300005535 Ga0070684_100002126 Ga0070684_10000212613 255
73 3300005564 Ga0070664_100182484 Ga0070664_1001824842 255
74 3300005577 Ga0068857_100076976 Ga0068857_1000769763 255
75 3300005981 Ga0081538_10005452 Ga0081538_100054527 255
76 3300005983 Ga0081540_1004199 Ga0081540_100419911 255
77 3300005985 Ga0081539_10000216 Ga0081539_1000021629 255
78 3300005985 Ga0081539_10042555 Ga0081539_100425552 255
79 3300006028 Ga0070717_10030221 Ga0070717_100302213 255
80 3300006038 Ga0075365_10015014 Ga0075365_100150143 255
81 3300006042 Ga0075368_10152646 Ga0075368_101526461 255
82 3300006175 Ga0070712_100024161 Ga0070712_1000241614 255
83 3300009098 Ga0105245_10027435 Ga0105245_100274355 255
84 3300009147 Ga0114129_10003551 Ga0114129_1000355121 255
85 3300009147 Ga0114129_10327575 Ga0114129_103275751 255
86 3300009147 Ga0114129_11122214 Ga0114129_111222141 255
87 3300009148 Ga0105243_10489145 Ga0105243_104891451 255
88 3300009176 Ga0105242_10117732 Ga0105242_101177322 255
89 3300025908 Ga0207643_10112652 Ga0207643_101126522 255
90 3300025910 Ga0207684_10045520 Ga0207684_100455202 255
91 3300025915 Ga0207693_10027989 Ga0207693_100279892 255
92 3300025926 Ga0207659_10578765 Ga0207659_105787652 255
93 3300025934 Ga0207686_10067289 Ga0207686_100672892 255
94 3300025944 Ga0207661_10035854 Ga0207661_100358542 255
95 3300025944 Ga0207661_10051197 Ga0207661_100511973 255
96 3300026023 Ga0207677_10123626 Ga0207677_101236261 255
97 3300026116 Ga0207674_10085056 Ga0207674_100850563 255
98 3300028380 Ga0268265_10569642 Ga0268265_105696422 255
99 3300032126 Ga0307415_100396650 Ga0307415_1003966502 255
100 3300037312 Ga0395899_0024491 Ga0395899_0024491_2416_3213 255
101 3300037312 Ga0395899_0045306 Ga0395899_0045306_1775_2572 255
102 3300037312 Ga0395899_0054326 Ga0395899_0054326_1173_1967 255
103 3300037418 Ga0395900_0014254 Ga0395900_0014254_5481_6275 255
104 3300037418 Ga0395900_0017090 Ga0395900_0017090_3913_4707 255
105 3300037418 Ga0395900_0113989 Ga0395900_0113989_536_1330 255
106 3300037418 Ga0395900_0448702 Ga0395900_0448702_362_1156 255
107 3300037466 Ga0395898_0009330 Ga0395898_0009330_6141_6935 255
108 3300037466 Ga0395898_0015180 Ga0395898_0015180_5239_6036 255
109 3300037466 Ga0395898_0035473 Ga0395898_0035473_1956_2750 255
110 3300037466 Ga0395898_0122355 Ga0395898_0122355_1480_2274 255
111 3300037466 Ga0395898_0239282 Ga0395898_0239282_361_1155 255
112 3300037471 Ga0395905_0006666 Ga0395905_0006666_7738_8535 255
113 3300037471 Ga0395905_0012801 Ga0395905_0012801_3738_4532 255
114 3300037471 Ga0395905_0013003 Ga0395905_0013003_3785_4579 255
115 3300037471 Ga0395905_0109031 Ga0395905_0109031_1568_2362 255
116 3300038443 Ga0395901_0004354 Ga0395901_0004354_12254_13051 255
117 3300038443 Ga0395901_0023584 Ga0395901_0023584_1095_1889 255
118 3300038443 Ga0395901_0025968 Ga0395901_0025968_3146_3940 255
119 3300038443 Ga0395901_0060213 Ga0395901_0060213_307_1104 255
120 3300038443 Ga0395901_0065212 Ga0395901_0065212_1590_2384 255
121 3300038443 Ga0395901_0154419 Ga0395901_0154419_418_1212 255
122 3300038443 Ga0395901_0166254 Ga0395901_0166254_866_1660 255
123 3300038443 Ga0395901_0174889 Ga0395901_0174889_875_1669 255
124 3300042876 Ga0451577_0001313 Ga0451577_0001313_7366_8175 255
125 3300042876 Ga0451577_0003752 Ga0451577_0003752_8946_9740 255
126 3300042876 Ga0451577_0039225 Ga0451577_0039225_2510_3304 255
127 3300044712 Ga0453684_0000327 Ga0453684_0000327_76492_77301 255
128 3300044712 Ga0453684_0017467 Ga0453684_0017467_9310_10104 255
129 3300044712 Ga0453684_0025179 Ga0453684_0025179_1116_1910 255
130 3300044712 Ga0453684_0108233 Ga0453684_0108233_1750_2571 255
131 3300046455 Ga0495603_0046941 Ga0495603_0046941_438_1232 255
132 3300046520 Ga0495637_0068872 Ga0495637_0068872_326_1120 255
133 3300046526 Ga0495666_0123708 Ga0495666_0123708_327_1121 255
134 3300046558 Ga0495633_0078621 Ga0495633_0078621_58_852 255
135 3300046664 Ga0495659_0014776 Ga0495659_0014776_204_998 255
136 3300046664 Ga0495659_0072820 Ga0495659_0072820_214_1008 255
137 3300046683 Ga0495658_0030054 Ga0495658_0030054_17_811 255
138 3300046689 Ga0495613_0040611 Ga0495613_0040611_246_1040 255
139 3300047315 Ga0495581_0010785 Ga0495581_0010785_2749_3543 255
140 3300047323 Ga0495683_0180742 Ga0495683_0180742_62_856 255
141 3300047445 Ga0495677_0029261 Ga0495677_0029261_798_1592 255
142 3300048911 Ga0496108_0122124 Ga0496108_0122124_1174_1968 255
143 3300048912 Ga0496109_0121890 Ga0496109_0121890_745_1539 255
144 3300048913 Ga0496110_0136824 Ga0496110_0136824_413_1207 255
145 3300048913 Ga0496110_0303565 Ga0496110_0303565_510_1304 255
146 3300048914 Ga0496111_0042496 Ga0496111_0042496_700_1494 255
147 3300048915 Ga0496112_0597456 Ga0496112_0597456_144_938 255
148 3300049568 Ga0501031_0003071 Ga0501031_0003071_4828_5622 255
149 3300049570 Ga0501033_0096514 Ga0501033_0096514_989_1783 255
150 3300049572 Ga0501036_0003429 Ga0501036_0003429_9981_10775 255
151 3300049575 Ga0501039_0032416 Ga0501039_0032416_2414_3208 255
152 3300049577 Ga0501041_0011549 Ga0501041_0011549_1935_2729 255
153 3300049579 Ga0501043_0169623 Ga0501043_0169623_765_1559 255
154 3300049580 Ga0501046_0009819 Ga0501046_0009819_4966_5760 255
155 3300049584 Ga0501068_0071530 Ga0501068_0071530_1056_1850 255
156 3300049585 Ga0501069_0023354 Ga0501069_0023354_1457_2251 255
157 3300049586 Ga0501070_0009833 Ga0501070_0009833_6325_7119 255
158 3300049587 Ga0501071_0073525 Ga0501071_0073525_1270_2064 255
159 3300049588 Ga0501072_0002233 Ga0501072_0002233_2024_2818 255
160 3300049591 Ga0501075_0020472 Ga0501075_0020472_922_1716 255
161 3300049592 Ga0501076_0006264 Ga0501076_0006264_1140_1934 255
162 3300049593 Ga0501077_0002996 Ga0501077_0002996_6708_7502 255
163 3300049742 Ga0501080_0008766 Ga0501080_0008766_2221_3015 255
164 3300049743 Ga0501081_0003061 Ga0501081_0003061_922_1716 255
165 3300049822 Ga0501035_0005619 Ga0501035_0005619_1562_2356 255
166 3300049824 Ga0501045_0147951 Ga0501045_0147951_251_1045 255
167 3300050492 nmdc:mga0yw44_56742_c1 nmdc:mga0yw44_56742_c1_1317_2111 255
168 3300050495 nmdc:mga04h51_123366_c1 nmdc:mga04h51_123366_c1_99_893 255
169 3300050507 nmdc:mga05p37_11057_c1 nmdc:mga05p37_11057_c1_8911_9708 255
170 3300054114 Ga0501084_0004298 Ga0501084_0004298_5966_6760 255
171 3300005355 Ga0070671_100206050 Ga0070671_1002060502 256
172 3300005367 Ga0070667_100184723 Ga0070667_1001847232 256
173 3300005455 Ga0070663_100371062 Ga0070663_1003710622 256
174 3300005456 Ga0070678_100044013 Ga0070678_1000440133 256
175 3300005459 Ga0068867_100022106 Ga0068867_1000221062 256
176 3300005535 Ga0070684_100084303 Ga0070684_1000843032 256
177 3300005615 Ga0070702_100363347 Ga0070702_1003633471 256
178 3300005843 Ga0068860_100105657 Ga0068860_1001056572 256
179 3300009148 Ga0105243_10027710 Ga0105243_100277102 256
180 3300009177 Ga0105248_10278265 Ga0105248_102782652 256
181 3300009551 Ga0105238_10627335 Ga0105238_106273352 256
182 3300009553 Ga0105249_10061857 Ga0105249_100618573 256
183 3300011119 Ga0105246_10035277 Ga0105246_100352772 256
184 3300013297 Ga0157378_10540382 Ga0157378_105403822 256
185 3300014326 Ga0157380_10050160 Ga0157380_100501602 256
186 3300014968 Ga0157379_10055952 Ga0157379_100559522 256
187 3300014969 Ga0157376_10081856 Ga0157376_100818562 256
188 3300025927 Ga0207687_10123359 Ga0207687_101233592 256
189 3300025931 Ga0207644_10167677 Ga0207644_101676772 256
190 3300025938 Ga0207704_10008221 Ga0207704_100082214 256
191 3300025940 Ga0207691_10268608 Ga0207691_102686082 256
192 3300025941 Ga0207711_10104485 Ga0207711_101044853 256
193 3300025986 Ga0207658_10038239 Ga0207658_100382392 256
194 3300026089 Ga0207648_10082135 Ga0207648_100821352 256
195 3300046523 Ga0495644_0038214 Ga0495644_0038214_902_1732 256
196 3300048907 Ga0496104_0269002 Ga0496104_0269002_602_1432 256
197 3300048911 Ga0496108_0180122 Ga0496108_0180122_11_844 256
198 3300005406 Ga0070703_10008668 Ga0070703_100086683 257
199 3300005471 Ga0070698_100051209 Ga0070698_1000512094 258
200 3300005536 Ga0070697_100046311 Ga0070697_1000463113 258
201 3300046615 Ga0495656_0096069 Ga0495656_0096069_553_1344 261
202 3300005434 Ga0070709_10215134 Ga0070709_102151342 262
203 3300044656 Ga0466969_0004678 Ga0466969_0004678_2797_3639 262
204 3300045049 Ga0466959_0019781 Ga0466959_0019781_18_860 262
205 3300025916 Ga0207663_10298955 Ga0207663_102989551 263
206 3300046517 Ga0495630_0037978 Ga0495630_0037978_1423_2280 263
207 3300005459 Ga0068867_100137963 Ga0068867_1001379632 265
208 3300005467 Ga0070706_100102795 Ga0070706_1001027952 265
209 3300005842 Ga0068858_100448998 Ga0068858_1004489982 265
210 3300009148 Ga0105243_10000882 Ga0105243_1000088212 265
211 3300009176 Ga0105242_10002586 Ga0105242_1000258610 265
212 3300009553 Ga0105249_10000003 Ga0105249_1000000391 265
213 3300013297 Ga0157378_10000032 Ga0157378_1000003214 265
214 3300013306 Ga0163162_10000033 Ga0163162_1000003333 265
215 3300013308 Ga0157375_10014702 Ga0157375_100147026 265
216 3300025910 Ga0207684_10094946 Ga0207684_100949463 265
217 3300025934 Ga0207686_10008298 Ga0207686_100082983 265
218 3300025935 Ga0207709_10000339 Ga0207709_100003396 265
219 3300025961 Ga0207712_10000060 Ga0207712_1000006085 265
220 3300026035 Ga0207703_10046888 Ga0207703_100468885 265
221 3300026089 Ga0207648_10185481 Ga0207648_101854812 265
222 3300048909 Ga0496106_0000607 Ga0496106_0000607_3247_4095 265
223 3300005458 Ga0070681_10004452 Ga0070681_100044527 267
224 3300005467 Ga0070706_100011763 Ga0070706_1000117634 267
225 3300005468 Ga0070707_100098695 Ga0070707_1000986952 267
226 3300006914 Ga0075436_100000115 Ga0075436_10000011510 267
227 3300009093 Ga0105240_10038727 Ga0105240_100387273 267
228 3300025910 Ga0207684_10080600 Ga0207684_100806002 267
229 3300025913 Ga0207695_10058334 Ga0207695_100583343 267
230 3300025922 Ga0207646_10071427 Ga0207646_100714274 267
231 3300005295 Ga0065707_10206499 Ga0065707_102064992 268
232 3300005471 Ga0070698_100000005 Ga0070698_1000000054 268
233 3300005545 Ga0070695_100064414 Ga0070695_1000644143 268
234 3300005547 Ga0070693_100044696 Ga0070693_1000446962 268
235 3300006173 Ga0070716_100120143 Ga0070716_1001201431 268
236 3300006173 Ga0070716_100171460 Ga0070716_1001714602 268
237 3300006237 Ga0097621_100019955 Ga0097621_1000199555 268
238 3300007265 Ga0099794_10023010 Ga0099794_100230101 268
239 3300007788 Ga0099795_10067730 Ga0099795_100677301 268
240 3300009101 Ga0105247_10251181 Ga0105247_102511812 268
241 3300013297 Ga0157378_10010412 Ga0157378_100104128 268
242 3300014969 Ga0157376_10000004 Ga0157376_10000004190 268
243 3300025906 Ga0207699_10117614 Ga0207699_101176142 268
244 3300028016 Ga0265354_1000015 Ga0265354_10000156 268
245 3300028379 Ga0268266_10001048 Ga0268266_1000104826 268
246 3300030878 Ga0265770_1000754 Ga0265770_10007543 268
247 3300031090 Ga0265760_10004795 Ga0265760_100047953 268
248 3300048917 Ga0496114_0009417 Ga0496114_0009417_3498_4454 268
249 3300005843 Ga0068860_100215502 Ga0068860_1002155022 271
250 3300009176 Ga0105242_10020195 Ga0105242_100201952 271
251 3300013297 Ga0157378_10039856 Ga0157378_100398562 271
252 3300025934 Ga0207686_10024738 Ga0207686_100247383 271
253 3300028381 Ga0268264_10066008 Ga0268264_100660082 271
254 3300042876 Ga0451577_0470161 Ga0451577_0470161_16_831 271
255 3300044656 Ga0466969_0013814 Ga0466969_0013814_3350_4234 271
256 3300044683 Ga0466965_0091904 Ga0466965_0091904_246_1130 271
257 3300044684 Ga0466966_0000227 Ga0466966_0000227_15315_16199 271
258 3300044693 Ga0466961_0001393 Ga0466961_0001393_9673_10557 271
259 3300044719 Ga0466971_0008797 Ga0466971_0008797_17_901 271
260 3300044765 Ga0466970_0000417 Ga0466970_0000417_7594_8478 271
261 3300044842 Ga0466957_0003013 Ga0466957_0003013_202_1086 271
262 3300045049 Ga0466959_0001227 Ga0466959_0001227_11375_12259 271
263 3300045051 Ga0451576_0770456 Ga0451576_0770456_98_913 271
264 3300061719 Ga0466962_0001486 Ga0466962_0001486_9192_10076 271
265 3300046664 Ga0495659_0023046 Ga0495659_0023046_123_947 272
266 3300005333 Ga0070677_10079796 Ga0070677_100797962 273
267 3300005365 Ga0070688_100058074 Ga0070688_1000580742 273
268 3300005437 Ga0070710_10073830 Ga0070710_100738302 273
269 3300005440 Ga0070705_100139542 Ga0070705_1001395422 273
270 3300005440 Ga0070705_100306265 Ga0070705_1003062652 273
271 3300005467 Ga0070706_100300393 Ga0070706_1003003932 273
272 3300005544 Ga0070686_100045273 Ga0070686_1000452733 273
273 3300005545 Ga0070695_100122240 Ga0070695_1001222403 273
274 3300005545 Ga0070695_100470133 Ga0070695_1004701331 273
275 3300005842 Ga0068858_100087480 Ga0068858_1000874803 273
276 3300006173 Ga0070716_100287173 Ga0070716_1002871731 273
277 3300009101 Ga0105247_10062216 Ga0105247_100622162 273
278 3300009177 Ga0105248_10076836 Ga0105248_100768363 273
279 3300013297 Ga0157378_10251370 Ga0157378_102513702 273
280 3300025906 Ga0207699_10099281 Ga0207699_100992812 273
281 3300025941 Ga0207711_10068558 Ga0207711_100685583 273
282 3300025942 Ga0207689_10117771 Ga0207689_101177711 273
283 3300026035 Ga0207703_10418441 Ga0207703_104184412 273
284 3300026095 Ga0207676_10066687 Ga0207676_100666873 273
285 3300028381 Ga0268264_10200426 Ga0268264_102004261 273
286 3300013297 Ga0157378_10284727 Ga0157378_102847272 274
287 3300017792 Ga0163161_10082594 Ga0163161_100825942 274
288 3300025938 Ga0207704_10043115 Ga0207704_100431153 274
289 3300050508 nmdc:mga09592_295170_c1 nmdc:mga09592_295170_c1_358_1182 274
290 3300005295 Ga0065707_10102612 Ga0065707_101026122 275
291 3300005406 Ga0070703_10000150 Ga0070703_1000015022 275
292 3300005441 Ga0070700_100001463 Ga0070700_1000014632 275
293 3300005444 Ga0070694_100000814 Ga0070694_10000081411 275
294 3300005445 Ga0070708_100126469 Ga0070708_1001264693 275
295 3300005468 Ga0070707_100347290 Ga0070707_1003472902 275
296 3300005518 Ga0070699_100498635 Ga0070699_1004986352 275
297 3300005518 Ga0070699_100550612 Ga0070699_1005506121 275
298 3300005536 Ga0070697_100015603 Ga0070697_1000156033 275
299 3300005536 Ga0070697_100040714 Ga0070697_1000407144 275
300 3300005549 Ga0070704_100642715 Ga0070704_1006427151 275
301 3300005617 Ga0068859_100006581 Ga0068859_1000065817 275
302 3300005618 Ga0068864_100087013 Ga0068864_1000870132 275
303 3300005843 Ga0068860_100494721 Ga0068860_1004947211 275
304 3300005844 Ga0068862_100014630 Ga0068862_1000146305 275
305 3300006163 Ga0070715_10000004 Ga0070715_1000000499 275
306 3300006173 Ga0070716_100000006 Ga0070716_10000000687 275
307 3300006880 Ga0075429_100109877 Ga0075429_1001098772 275
308 3300006914 Ga0075436_100347725 Ga0075436_1003477251 275
309 3300006931 Ga0097620_100006580 Ga0097620_1000065807 275
310 3300007076 Ga0075435_100199046 Ga0075435_1001990462 275
311 3300009553 Ga0105249_10036713 Ga0105249_100367132 275
312 3300025885 Ga0207653_10000014 Ga0207653_1000001422 275
313 3300025905 Ga0207685_10000004 Ga0207685_10000004156 275
314 3300025922 Ga0207646_10051333 Ga0207646_100513332 275
315 3300025922 Ga0207646_10305653 Ga0207646_103056532 275
316 3300025922 Ga0207646_10467764 Ga0207646_104677642 275
317 3300025939 Ga0207665_10000005 Ga0207665_1000000522 275
318 3300025961 Ga0207712_10017386 Ga0207712_100173863 275
319 3300026075 Ga0207708_10026184 Ga0207708_100261845 275
320 3300026075 Ga0207708_10315429 Ga0207708_103154291 275
321 3300027907 Ga0207428_10011059 Ga0207428_100110594 275
322 3300028380 Ga0268265_10635262 Ga0268265_106352621 275
323 3300050507 nmdc:mga05p37_144302_c1 nmdc:mga05p37_144302_c1_1898_2725 275
324 3300050513 nmdc:mga0rr50_251313_c1 nmdc:mga0rr50_251313_c1_392_1219 275
325 3300005468 Ga0070707_100000676 Ga0070707_1000006766 276
326 3300005549 Ga0070704_100005711 Ga0070704_1000057114 276
327 3300009148 Ga0105243_10000063 Ga0105243_1000006310 276
328 3300009148 Ga0105243_10317831 Ga0105243_103178311 276
329 3300009176 Ga0105242_10000004 Ga0105242_1000000494 276
330 3300025922 Ga0207646_10000329 Ga0207646_1000032921 276
331 3300025934 Ga0207686_10000005 Ga0207686_10000005143 276
332 3300025935 Ga0207709_10000088 Ga0207709_1000008897 276
333 3300025935 Ga0207709_10241025 Ga0207709_102410252 276
334 3300005615 Ga0070702_100044850 Ga0070702_1000448502 277
335 3300006852 Ga0075433_10024957 Ga0075433_100249574 277
336 3300006871 Ga0075434_100408325 Ga0075434_1004083252 277
337 3300009147 Ga0114129_10012333 Ga0114129_100123335 277
338 3300025931 Ga0207644_10000717 Ga0207644_100007175 277
339 3300050512 nmdc:mga0n895_471707_c1 nmdc:mga0n895_471707_c1_59_904 277
340 3300050515 nmdc:mga0a205_32191_c1 nmdc:mga0a205_32191_c1_1933_2778 277
341 3300002074 JGI24748J21848_1000017 JGI24748J21848_100001770 278
342 3300002239 JGI24034J26672_10000017 JGI24034J26672_1000001742 278
343 3300005334 Ga0068869_100024450 Ga0068869_1000244504 278
344 3300005467 Ga0070706_100008875 Ga0070706_1000088753 278
345 3300005471 Ga0070698_100109329 Ga0070698_1001093293 278
346 3300005536 Ga0070697_100008998 Ga0070697_1000089983 278
347 3300005842 Ga0068858_100000146 Ga0068858_10000014638 278
348 3300006852 Ga0075433_10059461 Ga0075433_100594612 278
349 3300007076 Ga0075435_100008004 Ga0075435_1000080043 278
350 3300009101 Ga0105247_10000004 Ga0105247_1000000412 278
351 3300009553 Ga0105249_10033092 Ga0105249_100330924 278
352 3300013297 Ga0157378_10120134 Ga0157378_101201342 278
353 3300013306 Ga0163162_10036872 Ga0163162_100368723 278
354 3300025223 Ga0207672_1000411 Ga0207672_10004113 278
355 3300025900 Ga0207710_10000002 Ga0207710_100000021001 278
356 3300025901 Ga0207688_10052647 Ga0207688_100526471 278
357 3300025910 Ga0207684_10006838 Ga0207684_100068383 278
358 3300025922 Ga0207646_10005620 Ga0207646_100056204 278
359 3300025942 Ga0207689_10040589 Ga0207689_100405893 278
360 3300026035 Ga0207703_10000120 Ga0207703_1000012068 278
361 3300045051 Ga0451576_0025470 Ga0451576_0025470_4725_5645 278
362 3300050513 nmdc:mga0rr50_59398_c1 nmdc:mga0rr50_59398_c1_633_1472 278
363 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_286195_287034 278
364 3300050515 nmdc:mga0a205_31366_c1 nmdc:mga0a205_31366_c1_730_1662 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

65

141

0.94

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

209

282

0.89

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

192

275

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yh5-assembly2.cif.gz_D mazg(mycobacterium tuberculosis) 0.9175 3 95
7yh5-assembly1.cif.gz_A mazg(mycobacterium tuberculosis) 0.9145 3 95
7yh5-assembly3.cif.gz_F-2 mazg(mycobacterium tuberculosis) 0.8884 9 92
7yh5-assembly3.cif.gz_E mazg(mycobacterium tuberculosis) 0.883 2 95
2yxh-assembly1.cif.gz_B crystal structure of mazg-related protein from thermotoga maritima 0.8698 6 123
ID Description Score Start End Superfamily
af_Q57982_1_74_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9821 179 213 1.10.287.10
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9434 2 127 1.10.287.1080
3craB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9348 3 95 1.10.287.1080
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9289 2 127 1.10.287.1080
af_P96379_86_202_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9071 5 123 1.10.287.1080
ID Description Score Start End GO Terms
AF-A8MK37-F1-model_v4 MazG nucleotide pyrophosphohydrolase 0.9796 6 130 GO:0006203
GO:0008168
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A7C0WQ17-F1-model_v4 MazG family protein 0.975 1 126 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A0F9Z146-F1-model_v4 Tetrapyrrole methyltransferase domain-containing/MazG-like protein domain-containing protein, dITP/XTP pyrophosphatase (EC 3.6.1.19) 0.9748 2 124 GO:0006203
GO:0008168
GO:0032259
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A3D3DDJ4-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9741 3 121 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-Q1NXY8-F1-model_v4 deleted 0.9738 3 127

Feature Viewer

pLDDT pTM Quality
91.22 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map