F423052

General Info

Members Datasets Scaffolds Average Seq Length
363 240 726 140

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0712127|Ga0451577_0712127_99_551
Length 150
Sequence MLMPKRVKYRKQMRGRMTGKAYRGSTVAFGEYGLQAQEPIWLTSRQIEAARRTMVRYIKRRGKIWIRVFPDKPFTKRAAETRMGKGKGPVEYWVAVIRPGRVLFEMGGIPEEEAMEALRLAAFKLPIKTKIIKRIDPISGQVLTSGQEGG

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.08
Metatranscriptomes 9.64
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 2.48
Rhizosphere 95.87
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0712127 3300042876 Bacteria 909
2 MBSR1b_contig_8547064 2162886012 Bacteria 909
3 JGI26145J50221_1012397 3300003371 Bacteria 766
4 Ga0058858_1438110 3300004785 Bacteria 1464
5 Ga0058859_10095900 3300004798 Bacteria 3509
6 Ga0058860_10184843 3300004801 Unclassified 1327
7 Ga0065715_10095918 3300005293 Bacteria 3979
8 Ga0065707_10955294 3300005295 Bacteria 551
9 Ga0070658_11360741 3300005327 Bacteria 616
10 Ga0070683_100209967 3300005329 Bacteria 1849
11 Ga0070670_100800702 3300005331 Bacteria 851
12 Ga0068869_100015378 3300005334 Bacteria 5132
13 Ga0070682_100856917 3300005337 Bacteria 743
14 Ga0068868_100290081 3300005338 Bacteria 1387
15 Ga0070689_100089113 3300005340 Bacteria 2430
16 Ga0070691_10334711 3300005341 Bacteria 836
17 Ga0070687_100583765 3300005343 Bacteria 765
18 Ga0070692_10001104 3300005345 Bacteria 9415
19 Ga0070692_10137797 3300005345 Bacteria 1378
20 Ga0070668_100129416 3300005347 Unclassified 2025
21 Ga0070675_100774789 3300005354 Bacteria 876
22 Ga0070667_100794873 3300005367 Bacteria 878
23 Ga0070700_100070367 3300005441 Bacteria 2231
24 Ga0070700_101010953 3300005441 Bacteria 684
25 Ga0070694_100004904 3300005444 Bacteria 8062
26 Ga0070708_101152738 3300005445 Bacteria 725
27 Ga0068867_100685882 3300005459 Bacteria 902
28 Ga0070706_100435455 3300005467 Bacteria 1220
29 Ga0070707_100327509 3300005468 Bacteria 1488
30 Ga0070707_101014115 3300005468 Bacteria 795
31 Ga0070698_100022395 3300005471 Bacteria 6610
32 Ga0070698_100664745 3300005471 Bacteria 983
33 Ga0070684_100808253 3300005535 Bacteria 877
34 Ga0070697_100050503 3300005536 Bacteria 3376
35 Ga0070697_100141343 3300005536 Bacteria 2025
36 Ga0068853_100742151 3300005539 Bacteria 938
37 Ga0070672_100057049 3300005543 Bacteria 3065
38 Ga0070686_100163369 3300005544 Bacteria 1570
39 Ga0070686_100816757 3300005544 Bacteria 753
40 Ga0070695_100077276 3300005545 Bacteria 2194
41 Ga0070696_100068104 3300005546 Bacteria 2498
42 Ga0070704_100104724 3300005549 Unclassified 2140
43 Ga0070704_100135631 3300005549 Bacteria 1914
44 Ga0068855_100573847 3300005563 Bacteria 1219
45 Ga0068855_101897879 3300005563 Bacteria 603
46 Ga0070664_101147314 3300005564 Bacteria 732
47 Ga0068859_100104154 3300005617 Unclassified 2896
48 Ga0068866_10302854 3300005718 Bacteria 999
49 Ga0068861_100525415 3300005719 Bacteria 1074
50 Ga0068863_100375924 3300005841 Bacteria 1387
51 Ga0068863_100408185 3300005841 Unclassified 1329
52 Ga0068858_100270976 3300005842 Bacteria 1615
53 Ga0068858_100456769 3300005842 Bacteria 1231
54 Ga0068858_100891187 3300005842 Bacteria 870
55 Ga0068860_100042506 3300005843 Bacteria 4339
56 Ga0068860_101042497 3300005843 Bacteria 836
57 Ga0068862_100003143 3300005844 Bacteria 14358
58 Ga0068862_100139213 3300005844 Bacteria 2153
59 Ga0081539_10000317 3300005985 Bacteria 107746
60 Ga0081539_10031106 3300005985 Bacteria 3297
61 Ga0081539_10140549 3300005985 Bacteria 1174
62 Ga0075428_100019323 3300006844 Bacteria 7541
63 Ga0075430_100016755 3300006846 Bacteria 6242
64 Ga0075430_100958411 3300006846 Bacteria 705
65 Ga0075431_100290777 3300006847 Bacteria 1653
66 Ga0075431_100743024 3300006847 Bacteria 957
67 Ga0075431_101436243 3300006847 Bacteria 649
68 Ga0075433_10064935 3300006852 Bacteria 3201
69 Ga0075434_100014841 3300006871 Bacteria 7452
70 Ga0075434_100093657 3300006871 Bacteria 3008
71 Ga0075434_100102552 3300006871 Bacteria 2869
72 Ga0075429_100717159 3300006880 Bacteria 876
73 Ga0097620_100104149 3300006931 Unclassified 2896
74 Ga0075435_100138684 3300007076 Bacteria 2039
75 Ga0075435_100236973 3300007076 Bacteria 1551
76 Ga0105240_10393363 3300009093 Bacteria 1563
77 Ga0111539_10008334 3300009094 Bacteria 13193
78 Ga0111539_10011707 3300009094 Bacteria 11007
79 Ga0111539_10658427 3300009094 Bacteria 1219
80 Ga0111539_11494336 3300009094 Bacteria 783
81 Ga0105245_10432155 3300009098 Bacteria 1322
82 Ga0105247_10018582 3300009101 Bacteria 4171
83 Ga0114129_10001417 3300009147 Bacteria 32326
84 Ga0114129_10046019 3300009147 Bacteria 6133
85 Ga0114129_10248021 3300009147 Bacteria 2391
86 Ga0114129_10580000 3300009147 Bacteria 1455
87 Ga0114129_10904380 3300009147 Bacteria 1118
88 Ga0105243_11835148 3300009148 Bacteria 638
89 Ga0105241_10480371 3300009174 Bacteria 1104
90 Ga0105242_10159357 3300009176 Bacteria 1974
91 Ga0105237_10008233 3300009545 Bacteria 11320
92 Ga0105249_10026603 3300009553 Bacteria 5216
93 Ga0105249_10073443 3300009553 Bacteria 3164
94 Ga0105249_11291246 3300009553 Bacteria 801
95 Ga0105239_10004307 3300010375 Bacteria 17061
96 Ga0105239_11004870 3300010375 Unclassified 959
97 Ga0105246_10363800 3300011119 Bacteria 1189
98 Ga0157371_10415432 3300013102 Bacteria 986
99 Ga0157378_10102290 3300013297 Bacteria 2617
100 Ga0163162_10044755 3300013306 Unclassified 4434
101 Ga0163162_10382443 3300013306 Bacteria 1541
102 Ga0163162_12258166 3300013306 Bacteria 625
103 Ga0157372_12256549 3300013307 Unclassified 625
104 Ga0157375_11130554 3300013308 Bacteria 917
105 Ga0157380_10060751 3300014326 Unclassified 3021
106 Ga0157380_11263522 3300014326 Bacteria 784
107 Ga0157379_10138032 3300014968 Bacteria 2197
108 Ga0157379_10478492 3300014968 Bacteria 1152
109 Ga0163161_10093365 3300017792 Bacteria 2229
110 Ga0207642_10512167 3300025899 Bacteria 736
111 Ga0207684_10216457 3300025910 Bacteria 1653
112 Ga0207684_11233010 3300025910 Bacteria 618
113 Ga0207654_10858928 3300025911 Bacteria 657
114 Ga0207695_10253334 3300025913 Bacteria 1659
115 Ga0207671_10020309 3300025914 Bacteria 5060
116 Ga0207662_10999260 3300025918 Bacteria 594
117 Ga0207649_11370958 3300025920 Bacteria 559
118 Ga0207646_10080346 3300025922 Bacteria 2915
119 Ga0207646_10564666 3300025922 Bacteria 1022
120 Ga0207687_10546821 3300025927 Bacteria 971
121 Ga0207690_10552052 3300025932 Bacteria 937
122 Ga0207706_10399083 3300025933 Bacteria 1192
123 Ga0207670_10097549 3300025936 Bacteria 2092
124 Ga0207704_10987083 3300025938 Bacteria 712
125 Ga0207691_10002644 3300025940 Bacteria 17504
126 Ga0207689_10009503 3300025942 Bacteria 8397
127 Ga0207661_10029676 3300025944 Bacteria 4204
128 Ga0207667_10943731 3300025949 Bacteria 852
129 Ga0207712_10042658 3300025961 Bacteria 3126
130 Ga0207712_10351966 3300025961 Bacteria 1225
131 Ga0207712_10529270 3300025961 Bacteria 1011
132 Ga0207668_10140250 3300025972 Bacteria 1858
133 Ga0207668_10472150 3300025972 Bacteria 1074
134 Ga0207640_10107477 3300025981 Bacteria 1970
135 Ga0207658_11065336 3300025986 Bacteria 738
136 Ga0207703_10067927 3300026035 Unclassified 2935
137 Ga0207703_10158055 3300026035 Bacteria 1983
138 Ga0207703_11363577 3300026035 Bacteria 682
139 Ga0207639_10677067 3300026041 Bacteria 956
140 Ga0207678_10023205 3300026067 Bacteria 5428
141 Ga0207708_10019176 3300026075 Bacteria 5152
142 Ga0207641_10359632 3300026088 Unclassified 1389
143 Ga0207641_11669276 3300026088 Bacteria 639
144 Ga0207648_10322273 3300026089 Bacteria 1389
145 Ga0207674_11480150 3300026116 Bacteria 648
146 Ga0207675_100060186 3300026118 Bacteria 3545
147 Ga0207675_100309836 3300026118 Bacteria 1539
148 Ga0207675_100377268 3300026118 Bacteria 1394
149 Ga0207675_100934187 3300026118 Bacteria 884
150 Ga0207675_101743230 3300026118 Bacteria 642
151 Ga0207698_10354824 3300026142 Bacteria 1386
152 Ga0210000_1031073 3300027462 Bacteria 835
153 Ga0209968_1002058 3300027526 Bacteria 3059
154 Ga0209970_1000972 3300027614 Bacteria 5087
155 Ga0210002_1008728 3300027617 Bacteria 1545
156 Ga0209983_1000280 3300027665 Bacteria 10618
157 Ga0209971_1001755 3300027682 Bacteria 5320
158 Ga0209998_10002827 3300027717 Bacteria 3904
159 Ga0209974_10004420 3300027876 Bacteria 5002
160 Ga0207428_10011482 3300027907 Bacteria 7829
161 Ga0207428_10079627 3300027907 Unclassified 2561
162 Ga0268265_10009861 3300028380 Bacteria 6450
163 Ga0268264_10238482 3300028381 Bacteria 1683
164 Ga0265320_10044977 3300031240 Bacteria 2171
165 Ga0316575_10033456 3300031665 Bacteria 2016
166 Ga0316579_10083289 3300031691 Bacteria 1524
167 Ga0316576_10006114 3300031727 Bacteria 7454
168 Ga0316576_10378684 3300031727 Bacteria 1051
169 Ga0316576_10641453 3300031727 Unclassified 773
170 Ga0316576_10775411 3300031727 Bacteria 691
171 Ga0316578_10025873 3300031728 Bacteria 3304
172 Ga0316577_10042943 3300031733 Bacteria 2530
173 Ga0316577_10089995 3300031733 Bacteria 1718
174 Ga0307413_10002665 3300031824 Bacteria 7313
175 Ga0307413_10780523 3300031824 Bacteria 801
176 Ga0307410_10005858 3300031852 Bacteria 6561
177 Ga0307407_10005051 3300031903 Bacteria 5687
178 Ga0307409_100154528 3300031995 Bacteria 1997
179 Ga0307409_101342148 3300031995 Unclassified 741
180 Ga0307411_10192261 3300032005 Bacteria 1559
181 Ga0307415_100387849 3300032126 Bacteria 1188
182 Ga0307415_100781489 3300032126 Bacteria 870
183 Ga0316583_10127772 3300032133 Bacteria 886
184 Ga0316593_10000039 3300032168 Bacteria 14170
185 Ga0316593_10000330 3300032168 Bacteria 8167
186 Ga0316593_10003181 3300032168 Bacteria 4032
187 Ga0316593_10005072 3300032168 Bacteria 3442
188 Ga0316593_10032466 3300032168 Bacteria 1705
189 Ga0316593_10045521 3300032168 Bacteria 1471
190 Ga0316593_10074081 3300032168 Bacteria 1181
191 Ga0316593_10144706 3300032168 Bacteria 862
192 Ga0316593_10152807 3300032168 Bacteria 840
193 Ga0316592_1000226 3300033524 Bacteria 6883
194 Ga0316592_1000660 3300033524 Bacteria 5025
195 Ga0316592_1001535 3300033524 Bacteria 3746
196 Ga0316592_1039806 3300033524 Bacteria 1039
197 Ga0316592_1085467 3300033524 Bacteria 719
198 Ga0316588_1019648 3300033528 Unclassified 1523
199 Ga0316596_1000884 3300033541 Bacteria 5644
200 Ga0316596_1048978 3300033541 Bacteria 1117
201 Ga0373948_0016433 3300034817 Bacteria 1368
202 Ga0373928_0137683 3300035084 Bacteria 667
203 Ga0373923_0220390 3300035111 Bacteria 882
204 Ga0373939_0520519 3300035114 Bacteria 510
205 Ga0373945_0186026 3300035116 Bacteria 857
206 Ga0373943_0079334 3300035170 Bacteria 1680
207 Ga0373946_0006543 3300035171 Bacteria 4228
208 Ga0373962_0047358 3300035242 Bacteria 1230
209 Ga0373947_0119332 3300035725 Bacteria 1674
210 Ga0373937_0505678 3300036401 Bacteria 1148
211 Ga0316582_0001483 3300036647 Bacteria 10344
212 Ga0316582_0092038 3300036647 Bacteria 1997
213 Ga0316584_0003646 3300036712 Bacteria 10079
214 Ga0316584_0757050 3300036712 Bacteria 662
215 Ga0373925_0002179 3300037068 Bacteria 15930
216 Ga0395899_0936302 3300037312 Bacteria 526
217 Ga0395900_0531194 3300037418 Bacteria 1123
218 Ga0395900_1245142 3300037418 Bacteria 659
219 Ga0395905_0250843 3300037471 Bacteria 1653
220 Ga0395901_0340292 3300038443 Bacteria 1550
221 Ga0395901_1060263 3300038443 Bacteria 783
222 Ga0395901_2103143 3300038443 Bacteria 510
223 Ga0439465_0121845 3300041413 Bacteria 915
224 Ga0439431_0074987 3300041997 Bacteria 906
225 Ga0439442_047611 3300042002 Bacteria 904
226 Ga0450889_011694 3300042144 Bacteria 915
227 Ga0439446_0039765 3300042156 Bacteria 1382
228 Ga0439459_0015953 3300042438 Bacteria 1383
229 Ga0451577_0033756 3300042876 Bacteria 4614
230 Ga0453683_0026403 3300044673 Bacteria 3688
231 Ga0453684_0000266 3300044712 Bacteria 225447
232 Ga0453684_0269082 3300044712 Bacteria 1948
233 Ga0453684_0363034 3300044712 Bacteria 1630
234 Ga0453684_0597394 3300044712 Bacteria 1210
235 Ga0453684_0625665 3300044712 Bacteria 1177
236 Ga0453684_1418680 3300044712 Bacteria 719
237 Ga0451576_0137895 3300045051 Bacteria 2544
238 Ga0495603_0058319 3300046455 Bacteria 2283
239 Ga0495629_0000007 3300046459 Bacteria 358693
240 Ga0495582_0292279 3300046473 Bacteria 936
241 Ga0495639_0000121 3300046475 Bacteria 39571
242 Ga0495618_0057913 3300046514 Bacteria 2454
243 Ga0495630_0056679 3300046517 Bacteria 2936
244 Ga0495644_0218342 3300046523 Bacteria 737
245 Ga0495666_0007118 3300046526 Bacteria 5621
246 Ga0495666_0110010 3300046526 Bacteria 1294
247 Ga0495640_0026693 3300046533 Bacteria 4169
248 Ga0495586_0000999 3300046535 Bacteria 16016
249 Ga0495622_0084829 3300046557 Bacteria 1457
250 Ga0495635_0002736 3300046663 Bacteria 12086
251 Ga0495647_0039302 3300046681 Bacteria 1793
252 Ga0495658_0145042 3300046683 Bacteria 1454
253 Ga0495658_0355451 3300046683 Bacteria 931
254 Ga0495613_0145116 3300046689 Bacteria 1694
255 Ga0495613_0670239 3300046689 Bacteria 685
256 Ga0495624_0140551 3300046690 Bacteria 1479
257 Ga0495600_0003709 3300046809 Bacteria 9031
258 Ga0495676_0010415 3300047321 Bacteria 8435
259 Ga0495680_0022317 3300047322 Bacteria 5278
260 Ga0495684_0014852 3300047471 Bacteria 5996
261 Ga0496102_0018905 3300048905 Bacteria 6062
262 Ga0496102_0443050 3300048905 Bacteria 1219
263 Ga0496103_0155563 3300048906 Bacteria 1465
264 Ga0496106_0087377 3300048909 Bacteria 2402
265 Ga0496107_0067376 3300048910 Bacteria 2597
266 Ga0496108_0783959 3300048911 Bacteria 823
267 Ga0496110_0137054 3300048913 Bacteria 2212
268 Ga0496111_0058773 3300048914 Bacteria 2784
269 Ga0496113_0017877 3300048916 Bacteria 4929
270 Ga0501308_020060 3300049128 Unclassified 830
271 Ga0501305_016611 3300049161 Bacteria 1051
272 Ga0501307_000961 3300049162 Bacteria 2245
273 Ga0501311_014267 3300049527 Unclassified 1012
274 Ga0501315_087278 3300049531 Bacteria 537
275 Ga0501317_011367 3300049533 Bacteria 1081
276 Ga0501318_009853 3300049534 Bacteria 1050
277 Ga0501319_003399 3300049535 Bacteria 1062
278 Ga0501320_002786 3300049536 Bacteria 1430
279 Ga0501323_031610 3300049539 Bacteria 746
280 Ga0501324_008871 3300049540 Bacteria 893
281 Ga0501325_003153 3300049541 Unclassified 1182
282 Ga0501329_03017 3300049545 Bacteria 837
283 Ga0501335_001489 3300049551 Bacteria 1805
284 Ga0501336_008456 3300049552 Bacteria 797
285 Ga0501032_0738484 3300049569 Bacteria 623
286 Ga0501033_0282204 3300049570 Bacteria 1172
287 Ga0501034_0143230 3300049571 Bacteria 2369
288 Ga0501034_0205570 3300049571 Bacteria 1925
289 Ga0501036_0634737 3300049572 Bacteria 885
290 Ga0501037_0626378 3300049573 Bacteria 721
291 Ga0501038_0328376 3300049574 Bacteria 1195
292 Ga0501038_0394914 3300049574 Bacteria 1071
293 Ga0501039_0905605 3300049575 Bacteria 686
294 Ga0501039_1027716 3300049575 Bacteria 640
295 Ga0501040_0114192 3300049576 Bacteria 1890
296 Ga0501040_0119817 3300049576 Bacteria 1846
297 Ga0501041_0588284 3300049577 Bacteria 710
298 Ga0501042_0349545 3300049578 Bacteria 1069
299 Ga0501042_0448151 3300049578 Bacteria 936
300 Ga0501046_1140964 3300049580 Bacteria 537
301 Ga0501048_0218364 3300049582 Bacteria 1352
302 Ga0501068_0054881 3300049584 Bacteria 2414
303 Ga0501068_0261069 3300049584 Bacteria 1105
304 Ga0501070_0222680 3300049586 Bacteria 1547
305 Ga0501073_0039344 3300049589 Bacteria 3350
306 Ga0501073_0166545 3300049589 Bacteria 1526
307 Ga0501073_0223909 3300049589 Bacteria 1299
308 Ga0501074_0730190 3300049590 Bacteria 699
309 Ga0501075_0258695 3300049591 Bacteria 1327
310 Ga0501075_1044516 3300049591 Bacteria 621
311 Ga0501076_0006442 3300049592 Bacteria 8516
312 Ga0501076_0019380 3300049592 Bacteria 5201
313 Ga0501076_0395798 3300049592 Bacteria 1136
314 Ga0501077_0002603 3300049593 Bacteria 10813
315 Ga0501077_0867347 3300049593 Bacteria 581
316 Ga0501079_0161582 3300049741 Bacteria 1747
317 Ga0501079_0376095 3300049741 Bacteria 1114
318 Ga0501080_0027324 3300049742 Bacteria 5305
319 Ga0501080_0102344 3300049742 Bacteria 2657
320 Ga0501080_0212338 3300049742 Bacteria 1773
321 Ga0501081_0251508 3300049743 Bacteria 1290
322 Ga0501081_0555699 3300049743 Bacteria 858
323 Ga0501083_0914583 3300049744 Bacteria 571
324 Ga0501045_0251367 3300049824 Bacteria 1316
325 Ga0501045_0837844 3300049824 Bacteria 677
326 nmdc:mga05p37_1701_c1 3300050507 Bacteria 25630
327 nmdc:mga05p37_19752_c1 3300050507 Bacteria 8151
328 nmdc:mga05p37_197694_c1 3300050507 Bacteria 2437
329 nmdc:mga05p37_205215_c1 3300050507 Unclassified 2384
330 nmdc:mga05p37_28557_c1 3300050507 Bacteria 6803
331 nmdc:mga05p37_644480_c1 3300050507 Bacteria 1187
332 nmdc:mga09592_1044669_c1 3300050508 Bacteria 681
333 nmdc:mga09592_11243_c1 3300050508 Bacteria 7282
334 nmdc:mga0qj67_143611_c1 3300050509 Bacteria 1935
335 nmdc:mga0qj67_28984_c1 3300050509 Bacteria 4298
336 nmdc:mga06r32_156580_c1 3300050510 Unclassified 2259
337 nmdc:mga06r32_1926893_c1 3300050510 Bacteria 525
338 nmdc:mga08y16_106450_c1 3300050511 Bacteria 2919
339 nmdc:mga08y16_1325165_c1 3300050511 Bacteria 686
340 nmdc:mga08y16_6604_c1 3300050511 Bacteria 12165
341 nmdc:mga08y16_90438_c1 3300050511 Bacteria 3191
342 nmdc:mga0n895_101222_c1 3300050512 Bacteria 2891
343 nmdc:mga0n895_15345_c1 3300050512 Bacteria 6981
344 nmdc:mga0n895_241165_c1 3300050512 Bacteria 1834
345 nmdc:mga0n895_93096_c1 3300050512 Bacteria 3017
346 nmdc:mga0rr50_295896_c1 3300050513 Bacteria 1353
347 nmdc:mga0a205_137179_c1 3300050515 Bacteria 2347
348 nmdc:mga0a205_260474_c1 3300050515 Bacteria 1612
349 nmdc:mga0a205_8807_c1 3300050515 Bacteria 9192
350 Ga0495619_0052850 3300053085 Bacteria 2686
351 Ga0495619_0072252 3300053085 Bacteria 2310
352 Ga0500566_0035936 3300053094 Bacteria 2877
353 Ga0500608_000568 3300053122 Bacteria 13787
354 Ga0501084_0002468 3300054114 Bacteria 14896
355 Ga0501084_0055496 3300054114 Bacteria 3314
356 Ga0501084_0448413 3300054114 Bacteria 1091
357 Ga0501082_0061602 3300060353 Bacteria 3230
358 Ga0501082_0116707 3300060353 Bacteria 2312
359 Ga0501082_0202643 3300060353 Bacteria 1726
360 Ga0501082_0204128 3300060353 Bacteria 1720
361 Ga0501082_1239613 3300060353 Bacteria 652
362 Ga0530510_0194648 3300061734 Bacteria 1505
363 2881635251 2881633906 Bacteria 2972201
364 Ga0451577_0712127
365 MBSR1b_contig_8547064
366 JGI26145J50221_1012397
367 Ga0058858_1438110
368 Ga0058859_10095900
369 Ga0058860_10184843
370 Ga0065715_10095918
371 Ga0065707_10955294
372 Ga0070658_11360741
373 Ga0070683_100209967
374 Ga0070670_100800702
375 Ga0068869_100015378
376 Ga0070682_100856917
377 Ga0068868_100290081
378 Ga0070689_100089113
379 Ga0070691_10334711
380 Ga0070687_100583765
381 Ga0070692_10001104
382 Ga0070692_10137797
383 Ga0070668_100129416
384 Ga0070675_100774789
385 Ga0070667_100794873
386 Ga0070700_100070367
387 Ga0070700_101010953
388 Ga0070694_100004904
389 Ga0070708_101152738
390 Ga0068867_100685882
391 Ga0070706_100435455
392 Ga0070707_100327509
393 Ga0070707_101014115
394 Ga0070698_100022395
395 Ga0070698_100664745
396 Ga0070684_100808253
397 Ga0070697_100050503
398 Ga0070697_100141343
399 Ga0068853_100742151
400 Ga0070672_100057049
401 Ga0070686_100163369
402 Ga0070686_100816757
403 Ga0070695_100077276
404 Ga0070696_100068104
405 Ga0070704_100104724
406 Ga0070704_100135631
407 Ga0068855_100573847
408 Ga0068855_101897879
409 Ga0070664_101147314
410 Ga0068859_100104154
411 Ga0068866_10302854
412 Ga0068861_100525415
413 Ga0068863_100375924
414 Ga0068863_100408185
415 Ga0068858_100270976
416 Ga0068858_100456769
417 Ga0068858_100891187
418 Ga0068860_100042506
419 Ga0068860_101042497
420 Ga0068862_100003143
421 Ga0068862_100139213
422 Ga0081539_10000317
423 Ga0081539_10031106
424 Ga0081539_10140549
425 Ga0075428_100019323
426 Ga0075430_100016755
427 Ga0075430_100958411
428 Ga0075431_100290777
429 Ga0075431_100743024
430 Ga0075431_101436243
431 Ga0075433_10064935
432 Ga0075434_100014841
433 Ga0075434_100093657
434 Ga0075434_100102552
435 Ga0075429_100717159
436 Ga0097620_100104149
437 Ga0075435_100138684
438 Ga0075435_100236973
439 Ga0105240_10393363
440 Ga0111539_10008334
441 Ga0111539_10011707
442 Ga0111539_10658427
443 Ga0111539_11494336
444 Ga0105245_10432155
445 Ga0105247_10018582
446 Ga0114129_10001417
447 Ga0114129_10046019
448 Ga0114129_10248021
449 Ga0114129_10580000
450 Ga0114129_10904380
451 Ga0105243_11835148
452 Ga0105241_10480371
453 Ga0105242_10159357
454 Ga0105237_10008233
455 Ga0105249_10026603
456 Ga0105249_10073443
457 Ga0105249_11291246
458 Ga0105239_10004307
459 Ga0105239_11004870
460 Ga0105246_10363800
461 Ga0157371_10415432
462 Ga0157378_10102290
463 Ga0163162_10044755
464 Ga0163162_10382443
465 Ga0163162_12258166
466 Ga0157372_12256549
467 Ga0157375_11130554
468 Ga0157380_10060751
469 Ga0157380_11263522
470 Ga0157379_10138032
471 Ga0157379_10478492
472 Ga0163161_10093365
473 Ga0207642_10512167
474 Ga0207684_10216457
475 Ga0207684_11233010
476 Ga0207654_10858928
477 Ga0207695_10253334
478 Ga0207671_10020309
479 Ga0207662_10999260
480 Ga0207649_11370958
481 Ga0207646_10080346
482 Ga0207646_10564666
483 Ga0207687_10546821
484 Ga0207690_10552052
485 Ga0207706_10399083
486 Ga0207670_10097549
487 Ga0207704_10987083
488 Ga0207691_10002644
489 Ga0207689_10009503
490 Ga0207661_10029676
491 Ga0207667_10943731
492 Ga0207712_10042658
493 Ga0207712_10351966
494 Ga0207712_10529270
495 Ga0207668_10140250
496 Ga0207668_10472150
497 Ga0207640_10107477
498 Ga0207658_11065336
499 Ga0207703_10067927
500 Ga0207703_10158055
501 Ga0207703_11363577
502 Ga0207639_10677067
503 Ga0207678_10023205
504 Ga0207708_10019176
505 Ga0207641_10359632
506 Ga0207641_11669276
507 Ga0207648_10322273
508 Ga0207674_11480150
509 Ga0207675_100060186
510 Ga0207675_100309836
511 Ga0207675_100377268
512 Ga0207675_100934187
513 Ga0207675_101743230
514 Ga0207698_10354824
515 Ga0210000_1031073
516 Ga0209968_1002058
517 Ga0209970_1000972
518 Ga0210002_1008728
519 Ga0209983_1000280
520 Ga0209971_1001755
521 Ga0209998_10002827
522 Ga0209974_10004420
523 Ga0207428_10011482
524 Ga0207428_10079627
525 Ga0268265_10009861
526 Ga0268264_10238482
527 Ga0265320_10044977
528 Ga0316575_10033456
529 Ga0316579_10083289
530 Ga0316576_10006114
531 Ga0316576_10378684
532 Ga0316576_10641453
533 Ga0316576_10775411
534 Ga0316578_10025873
535 Ga0316577_10042943
536 Ga0316577_10089995
537 Ga0307413_10002665
538 Ga0307413_10780523
539 Ga0307410_10005858
540 Ga0307407_10005051
541 Ga0307409_100154528
542 Ga0307409_101342148
543 Ga0307411_10192261
544 Ga0307415_100387849
545 Ga0307415_100781489
546 Ga0316583_10127772
547 Ga0316593_10000039
548 Ga0316593_10000330
549 Ga0316593_10003181
550 Ga0316593_10005072
551 Ga0316593_10032466
552 Ga0316593_10045521
553 Ga0316593_10074081
554 Ga0316593_10144706
555 Ga0316593_10152807
556 Ga0316592_1000226
557 Ga0316592_1000660
558 Ga0316592_1001535
559 Ga0316592_1039806
560 Ga0316592_1085467
561 Ga0316588_1019648
562 Ga0316596_1000884
563 Ga0316596_1048978
564 Ga0373948_0016433
565 Ga0373928_0137683
566 Ga0373923_0220390
567 Ga0373939_0520519
568 Ga0373945_0186026
569 Ga0373943_0079334
570 Ga0373946_0006543
571 Ga0373962_0047358
572 Ga0373947_0119332
573 Ga0373937_0505678
574 Ga0316582_0001483
575 Ga0316582_0092038
576 Ga0316584_0003646
577 Ga0316584_0757050
578 Ga0373925_0002179
579 Ga0395899_0936302
580 Ga0395900_0531194
581 Ga0395900_1245142
582 Ga0395905_0250843
583 Ga0395901_0340292
584 Ga0395901_1060263
585 Ga0395901_2103143
586 Ga0439465_0121845
587 Ga0439431_0074987
588 Ga0439442_047611
589 Ga0450889_011694
590 Ga0439446_0039765
591 Ga0439459_0015953
592 Ga0451577_0033756
593 Ga0453683_0026403
594 Ga0453684_0000266
595 Ga0453684_0269082
596 Ga0453684_0363034
597 Ga0453684_0597394
598 Ga0453684_0625665
599 Ga0453684_1418680
600 Ga0451576_0137895
601 Ga0495603_0058319
602 Ga0495629_0000007
603 Ga0495582_0292279
604 Ga0495639_0000121
605 Ga0495618_0057913
606 Ga0495630_0056679
607 Ga0495644_0218342
608 Ga0495666_0007118
609 Ga0495666_0110010
610 Ga0495640_0026693
611 Ga0495586_0000999
612 Ga0495622_0084829
613 Ga0495635_0002736
614 Ga0495647_0039302
615 Ga0495658_0145042
616 Ga0495658_0355451
617 Ga0495613_0145116
618 Ga0495613_0670239
619 Ga0495624_0140551
620 Ga0495600_0003709
621 Ga0495676_0010415
622 Ga0495680_0022317
623 Ga0495684_0014852
624 Ga0496102_0018905
625 Ga0496102_0443050
626 Ga0496103_0155563
627 Ga0496106_0087377
628 Ga0496107_0067376
629 Ga0496108_0783959
630 Ga0496110_0137054
631 Ga0496111_0058773
632 Ga0496113_0017877
633 Ga0501308_020060
634 Ga0501305_016611
635 Ga0501307_000961
636 Ga0501311_014267
637 Ga0501315_087278
638 Ga0501317_011367
639 Ga0501318_009853
640 Ga0501319_003399
641 Ga0501320_002786
642 Ga0501323_031610
643 Ga0501324_008871
644 Ga0501325_003153
645 Ga0501329_03017
646 Ga0501335_001489
647 Ga0501336_008456
648 Ga0501032_0738484
649 Ga0501033_0282204
650 Ga0501034_0143230
651 Ga0501034_0205570
652 Ga0501036_0634737
653 Ga0501037_0626378
654 Ga0501038_0328376
655 Ga0501038_0394914
656 Ga0501039_0905605
657 Ga0501039_1027716
658 Ga0501040_0114192
659 Ga0501040_0119817
660 Ga0501041_0588284
661 Ga0501042_0349545
662 Ga0501042_0448151
663 Ga0501046_1140964
664 Ga0501048_0218364
665 Ga0501068_0054881
666 Ga0501068_0261069
667 Ga0501070_0222680
668 Ga0501073_0039344
669 Ga0501073_0166545
670 Ga0501073_0223909
671 Ga0501074_0730190
672 Ga0501075_0258695
673 Ga0501075_1044516
674 Ga0501076_0006442
675 Ga0501076_0019380
676 Ga0501076_0395798
677 Ga0501077_0002603
678 Ga0501077_0867347
679 Ga0501079_0161582
680 Ga0501079_0376095
681 Ga0501080_0027324
682 Ga0501080_0102344
683 Ga0501080_0212338
684 Ga0501081_0251508
685 Ga0501081_0555699
686 Ga0501083_0914583
687 Ga0501045_0251367
688 Ga0501045_0837844
689 nmdc:mga05p37_1701_c1
690 nmdc:mga05p37_19752_c1
691 nmdc:mga05p37_197694_c1
692 nmdc:mga05p37_205215_c1
693 nmdc:mga05p37_28557_c1
694 nmdc:mga05p37_644480_c1
695 nmdc:mga09592_1044669_c1
696 nmdc:mga09592_11243_c1
697 nmdc:mga0qj67_143611_c1
698 nmdc:mga0qj67_28984_c1
699 nmdc:mga06r32_156580_c1
700 nmdc:mga06r32_1926893_c1
701 nmdc:mga08y16_106450_c1
702 nmdc:mga08y16_1325165_c1
703 nmdc:mga08y16_6604_c1
704 nmdc:mga08y16_90438_c1
705 nmdc:mga0n895_101222_c1
706 nmdc:mga0n895_15345_c1
707 nmdc:mga0n895_241165_c1
708 nmdc:mga0n895_93096_c1
709 nmdc:mga0rr50_295896_c1
710 nmdc:mga0a205_137179_c1
711 nmdc:mga0a205_260474_c1
712 nmdc:mga0a205_8807_c1
713 Ga0495619_0052850
714 Ga0495619_0072252
715 Ga0500566_0035936
716 Ga0500608_000568
717 Ga0501084_0002468
718 Ga0501084_0055496
719 Ga0501084_0448413
720 Ga0501082_0061602
721 Ga0501082_0116707
722 Ga0501082_0202643
723 Ga0501082_0204128
724 Ga0501082_1239613
725 Ga0530510_0194648
726 2881635251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

4

132

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyc-assembly1.cif.gz_I1 cryo-em structure of the xenopus egg 80s ribosome 0.9418 32 132
3j92-assembly1.cif.gz_I structure and assembly pathway of the ribosome quality control complex 0.9351 32 131
7f5s-assembly1.cif.gz_LI human delta-mettl18 60s ribosome 0.9337 32 133
8b2l-assembly1.cif.gz_g3 cryo-em structure of the plant 80s ribosome 0.9155 32 132
7pkt-assembly1.cif.gz_l large subunit of the chlamydomonas reinhardtii mitoribosome 0.9135 21 133
ID Description Score Start End Superfamily
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9515 23 136 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9515 23 136 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9339 23 136 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9279 23 136 3.90.1170.10
4kbuQ01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9177 24 135 3.90.1170.10
ID Description Score Start End GO Terms
AF-X1PBR5-F1-model_v4 Large ribosomal subunit protein uL5 C-terminal domain-containing protein 0.965 41 134 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6L5C5Y9-F1-model_v4 deleted 0.9647 12 135
AF-Q4AE47-F1-model_v4 50S ribosomal protein L16, chloroplastic 0.9644 27 133 GO:0003735
GO:0005762
GO:0009507
GO:0019843
GO:0032543
AF-A0A2P1AEY8-F1-model_v4 Ribosomal protein L16 0.9634 27 134 GO:0003735
GO:0005762
GO:0019843
GO:0032543
AF-A0A0H4T321-F1-model_v4 50S ribosomal protein L16 0.9632 29 134 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map