F423045

General Info

Members Datasets Scaffolds Average Seq Length
363 164 726 132

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0191430|Ga0439448_0191430_13_462
Length 149
Sequence MRSATVTTVLDATPRAVFEYLSDIENLPEWANEFARELRREGNDFKVVNGLGEFYFTIEAEPATGVIDMFAGPTKDSMAVFPTRSLALPDGRTAYTFTMFQGPDMPDELFEAQHASLRREFANIERLLNAIATIGDGAPVENGRGTAGD

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
87 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
88 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
89 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
90 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
91 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
92 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 6.61
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 22.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0191430 3300042005 Bacteria 716
2 Ga0070683_100483374 3300005329 Bacteria 1182
3 Ga0070670_100124664 3300005331 Bacteria 2223
4 Ga0070668_100183517 3300005347 Bacteria 1710
5 Ga0070675_100566467 3300005354 Unclassified 1028
6 Ga0070674_100439914 3300005356 Bacteria 1074
7 Ga0070674_101995861 3300005356 Bacteria 528
8 Ga0070659_101038119 3300005366 Bacteria 721
9 Ga0070713_100387431 3300005436 Bacteria 1303
10 Ga0070710_10011366 3300005437 Bacteria 4398
11 Ga0070701_10688583 3300005438 Bacteria 686
12 Ga0070700_100837343 3300005441 Bacteria 744
13 Ga0070700_101100865 3300005441 Unclassified 658
14 Ga0070708_100011066 3300005445 Bacteria 7330
15 Ga0070663_100250235 3300005455 Bacteria 1402
16 Ga0070678_100381841 3300005456 Bacteria 1219
17 Ga0070678_100791809 3300005456 Unclassified 860
18 Ga0070662_100493778 3300005457 Bacteria 1020
19 Ga0070681_11547823 3300005458 Bacteria 588
20 Ga0070685_10625406 3300005466 Bacteria 777
21 Ga0070706_100010553 3300005467 Bacteria 8574
22 Ga0070707_100011776 3300005468 Bacteria 8163
23 Ga0070707_100533060 3300005468 Bacteria 1136
24 Ga0070698_100015175 3300005471 Bacteria 8146
25 Ga0070698_101295491 3300005471 Unclassified 679
26 Ga0070684_100201551 3300005535 Bacteria 1812
27 Ga0070684_101425327 3300005535 Unclassified 652
28 Ga0070697_100036819 3300005536 Bacteria 3952
29 Ga0070686_100946215 3300005544 Bacteria 703
30 Ga0070695_100275406 3300005545 Bacteria 1234
31 Ga0070704_100707653 3300005549 Unclassified 894
32 Ga0070664_100995288 3300005564 Bacteria 788
33 Ga0068870_10975215 3300005840 Bacteria 603
34 Ga0081455_10254689 3300005937 Bacteria 1282
35 Ga0081455_10302968 3300005937 Bacteria 1146
36 Ga0081538_10000068 3300005981 Bacteria 97659
37 Ga0081538_10000824 3300005981 Bacteria 33659
38 Ga0070717_10017253 3300006028 Bacteria 5613
39 Ga0070717_10078967 3300006028 Bacteria 2758
40 Ga0075432_10243572 3300006058 Unclassified 727
41 Ga0070716_100380782 3300006173 Bacteria 1008
42 Ga0075428_100036333 3300006844 Bacteria 5426
43 Ga0075428_100104499 3300006844 Bacteria 3089
44 Ga0075428_100214274 3300006844 Unclassified 2081
45 Ga0075428_100373246 3300006844 Bacteria 1529
46 Ga0075428_100797738 3300006844 Unclassified 1004
47 Ga0075428_101751475 3300006844 Bacteria 647
48 Ga0075430_100074241 3300006846 Bacteria 2852
49 Ga0075430_100135322 3300006846 Bacteria 2053
50 Ga0075431_100039996 3300006847 Bacteria 4831
51 Ga0075431_100130352 3300006847 Bacteria 2594
52 Ga0075431_100157796 3300006847 Bacteria 2334
53 Ga0075431_100191152 3300006847 Bacteria 2097
54 Ga0075431_100454835 3300006847 Unclassified 1276
55 Ga0075431_101049041 3300006847 Bacteria 781
56 Ga0075431_101343937 3300006847 Unclassified 675
57 Ga0075433_10076070 3300006852 Bacteria 2956
58 Ga0075433_10548687 3300006852 Bacteria 1016
59 Ga0075433_11235453 3300006852 Bacteria 648
60 Ga0075434_100040091 3300006871 Plasmid 4639
61 Ga0075434_100041188 3300006871 Bacteria 4575
62 Ga0075429_100601280 3300006880 Bacteria 964
63 Ga0075429_101340305 3300006880 Unclassified 624
64 Ga0075436_100008770 3300006914 Bacteria 6915
65 Ga0075435_100089824 3300007076 Unclassified 2533
66 Ga0099795_10492755 3300007788 Bacteria 570
67 Ga0111539_10006293 3300009094 Bacteria 15323
68 Ga0111539_10371795 3300009094 Bacteria 1664
69 Ga0111539_10509256 3300009094 Bacteria 1402
70 Ga0111539_12012096 3300009094 Unclassified 670
71 Ga0114129_10104685 3300009147 Bacteria 3911
72 Ga0114129_10249288 3300009147 Bacteria 2384
73 Ga0114129_10301540 3300009147 Bacteria 2135
74 Ga0114129_10434097 3300009147 Unclassified 1725
75 Ga0114129_10873561 3300009147 Archaea 1141
76 Ga0114129_11302849 3300009147 Bacteria 900
77 Ga0114129_11311299 3300009147 Bacteria 897
78 Ga0114129_11888795 3300009147 Bacteria 724
79 Ga0114129_12727136 3300009147 Unclassified 588
80 Ga0114129_12914262 3300009147 Bacteria 565
81 Ga0105239_10671088 3300010375 Unclassified 1184
82 Ga0105246_11871480 3300011119 Unclassified 575
83 Ga0157375_12710610 3300013308 Bacteria 593
84 Ga0163163_11079271 3300014325 Bacteria 866
85 Ga0157380_10541913 3300014326 Bacteria 1140
86 Ga0157377_10650169 3300014745 Bacteria 759
87 Ga0157376_10337425 3300014969 Bacteria 1438
88 Ga0207699_10123572 3300025906 Bacteria 1677
89 Ga0207684_10002267 3300025910 Bacteria 19589
90 Ga0207707_10257197 3300025912 Unclassified 1516
91 Ga0207693_10001039 3300025915 Bacteria 24856
92 Ga0207646_10002906 3300025922 Bacteria 19878
93 Ga0207664_10727770 3300025929 Bacteria 892
94 Ga0207706_10097877 3300025933 Bacteria 2580
95 Ga0207669_10095398 3300025937 Unclassified 1950
96 Ga0207665_10025223 3300025939 Bacteria 3921
97 Ga0207661_10468069 3300025944 Bacteria 1149
98 Ga0207661_10569041 3300025944 Unclassified 1039
99 Ga0207668_11984738 3300025972 Unclassified 524
100 Ga0207678_10286838 3300026067 Bacteria 1413
101 Ga0207708_10602109 3300026075 Bacteria 931
102 Ga0207648_10844096 3300026089 Unclassified 854
103 Ga0207428_10007915 3300027907 Bacteria 9659
104 Ga0207428_10087269 3300027907 Bacteria 2427
105 Ga0207428_11073325 3300027907 Unclassified 564
106 Ga0307408_100348641 3300031548 Bacteria 1256
107 Ga0307408_100826550 3300031548 Unclassified 843
108 Ga0307408_102504412 3300031548 Bacteria 502
109 Ga0307405_10077807 3300031731 Unclassified 2157
110 Ga0307405_10802257 3300031731 Bacteria 789
111 Ga0307405_11531312 3300031731 Bacteria 587
112 Ga0307413_10053888 3300031824 Bacteria 2437
113 Ga0307413_10252454 3300031824 Bacteria 1309
114 Ga0307413_10374487 3300031824 Bacteria 1107
115 Ga0307413_10616919 3300031824 Bacteria 890
116 Ga0307410_10111273 3300031852 Bacteria 1982
117 Ga0307410_10166803 3300031852 Bacteria 1655
118 Ga0307410_10442633 3300031852 Bacteria 1058
119 Ga0307410_11260961 3300031852 Bacteria 645
120 Ga0307410_11271162 3300031852 Bacteria 643
121 Ga0307410_11697013 3300031852 Unclassified 560
122 Ga0326468_10022035 3300031889 Bacteria 771
123 Ga0307406_10153376 3300031901 Bacteria 1646
124 Ga0307406_10356127 3300031901 Bacteria 1145
125 Ga0307406_10397841 3300031901 Bacteria 1091
126 Ga0307406_10615413 3300031901 Bacteria 897
127 Ga0307406_10894907 3300031901 Unclassified 755
128 Ga0307406_10942032 3300031901 Bacteria 737
129 Ga0307406_11589604 3300031901 Bacteria 577
130 Ga0307406_11620914 3300031901 Unclassified 572
131 Ga0307407_10042618 3300031903 Bacteria 2546
132 Ga0307407_10253086 3300031903 Bacteria 1208
133 Ga0307407_10374619 3300031903 Bacteria 1015
134 Ga0307407_10398236 3300031903 Bacteria 987
135 Ga0307407_10496263 3300031903 Bacteria 894
136 Ga0307407_10507791 3300031903 Bacteria 885
137 Ga0307407_10541204 3300031903 Unclassified 859
138 Ga0307407_10866993 3300031903 Bacteria 691
139 Ga0307407_11368971 3300031903 Bacteria 557
140 Ga0307412_10018024 3300031911 Bacteria 4238
141 Ga0307412_10121103 3300031911 Bacteria 1884
142 Ga0307409_100006463 3300031995 Bacteria 6890
143 Ga0307409_100246618 3300031995 Bacteria 1630
144 Ga0307409_100328694 3300031995 Unclassified 1434
145 Ga0307409_100366150 3300031995 Unclassified 1365
146 Ga0307409_100412325 3300031995 Bacteria 1293
147 Ga0307409_100516557 3300031995 Bacteria 1166
148 Ga0307409_100681407 3300031995 Bacteria 1025
149 Ga0307409_101178158 3300031995 Unclassified 789
150 Ga0307409_101435126 3300031995 Bacteria 717
151 Ga0307409_101505996 3300031995 Bacteria 700
152 Ga0307409_101902403 3300031995 Bacteria 624
153 Ga0307409_102756509 3300031995 Unclassified 519
154 Ga0307416_100013586 3300032002 Bacteria 5543
155 Ga0307416_100039369 3300032002 Bacteria 3659
156 Ga0307416_100120864 3300032002 Bacteria 2334
157 Ga0307416_100152092 3300032002 Bacteria 2124
158 Ga0307416_100213727 3300032002 Bacteria 1842
159 Ga0307416_100317874 3300032002 Bacteria 1557
160 Ga0307416_100527981 3300032002 Bacteria 1250
161 Ga0307416_100586105 3300032002 Unclassified 1193
162 Ga0307416_100740120 3300032002 Unclassified 1075
163 Ga0307416_101006618 3300032002 Unclassified 936
164 Ga0307416_101138369 3300032002 Unclassified 885
165 Ga0307416_101232241 3300032002 Unclassified 854
166 Ga0307416_101868484 3300032002 Bacteria 704
167 Ga0307414_10042562 3300032004 Bacteria 3087
168 Ga0307414_10178623 3300032004 Unclassified 1705
169 Ga0307414_10187180 3300032004 Bacteria 1671
170 Ga0307414_10475808 3300032004 Bacteria 1101
171 Ga0307414_10669970 3300032004 Unclassified 937
172 Ga0307414_11702835 3300032004 Unclassified 588
173 Ga0307414_11919913 3300032004 Bacteria 553
174 Ga0307411_10081794 3300032005 Bacteria 2225
175 Ga0307411_10217213 3300032005 Bacteria 1481
176 Ga0307411_10763333 3300032005 Bacteria 848
177 Ga0307411_10952830 3300032005 Bacteria 766
178 Ga0307411_11053471 3300032005 Bacteria 731
179 Ga0307415_100000399 3300032126 Bacteria 18493
180 Ga0307415_100078249 3300032126 Unclassified 2352
181 Ga0307415_100086431 3300032126 Bacteria 2256
182 Ga0307415_100161207 3300032126 Bacteria 1739
183 Ga0307415_100190472 3300032126 Bacteria 1618
184 Ga0307415_100445115 3300032126 Unclassified 1118
185 Ga0307415_100534606 3300032126 Bacteria 1031
186 Ga0307415_100571803 3300032126 Bacteria 1001
187 Ga0307415_100923862 3300032126 Bacteria 806
188 Ga0307415_100925500 3300032126 Unclassified 805
189 Ga0307415_101279227 3300032126 Bacteria 694
190 Ga0395899_0204446 3300037312 Bacteria 1375
191 Ga0395900_0090169 3300037418 Bacteria 3151
192 Ga0395900_0204188 3300037418 Bacteria 1998
193 Ga0395900_0801441 3300037418 Bacteria 870
194 Ga0395900_0813695 3300037418 Unclassified 861
195 Ga0395900_1241469 3300037418 Unclassified 660
196 Ga0395898_0002030 3300037466 Bacteria 25361
197 Ga0395898_0095569 3300037466 Bacteria 2855
198 Ga0395898_0149340 3300037466 Bacteria 2236
199 Ga0395898_0895984 3300037466 Bacteria 825
200 Ga0395905_0424105 3300037471 Unclassified 1226
201 Ga0395905_1228743 3300037471 Unclassified 653
202 Ga0395901_0007853 3300038443 Bacteria 10761
203 Ga0395901_0111348 3300038443 Bacteria 2875
204 Ga0395901_0176957 3300038443 Unclassified 2237
205 Ga0395901_0455119 3300038443 Bacteria 1308
206 Ga0395901_0652287 3300038443 Bacteria 1056
207 Ga0395901_1357574 3300038443 Bacteria 671
208 Ga0395901_1923274 3300038443 Unclassified 539
209 Ga0439466_0064335 3300041411 Bacteria 1176
210 Ga0451853_2348334 3300041512 Bacteria 766
211 Ga0439433_0163378 3300041999 Unclassified 577
212 Ga0439441_012713 3300042001 Unclassified 1450
213 Ga0439442_072875 3300042002 Unclassified 732
214 Ga0439450_099477 3300042008 Bacteria 737
215 Ga0439463_029484 3300042016 Bacteria 1382
216 Ga0450888_009010 3300042126 Bacteria 1134
217 Ga0450905_030340 3300042142 Bacteria 832
218 Ga0439446_0286623 3300042156 Unclassified 575
219 Ga0439434_0031750 3300042435 Unclassified 1606
220 Ga0439434_0147055 3300042435 Unclassified 779
221 Ga0453684_1538677 3300044712 Bacteria 685
222 Ga0466960_0220078 3300044901 Bacteria 1044
223 Ga0466960_0251560 3300044901 Bacteria 982
224 Ga0466960_0268169 3300044901 Bacteria 953
225 Ga0466960_0475934 3300044901 Bacteria 729
226 Ga0466960_0488047 3300044901 Bacteria 720
227 Ga0466967_0020501 3300045976 Bacteria 5347
228 Ga0466967_0467511 3300045976 Bacteria 1234
229 Ga0466967_2522889 3300045976 Bacteria 509
230 Ga0495590_0181184 3300046457 Bacteria 770
231 Ga0495584_0048737 3300046491 Bacteria 2135
232 Ga0495631_0261398 3300046518 Bacteria 737
233 Ga0495631_0470010 3300046518 Unclassified 536
234 Ga0495656_0024052 3300046615 Bacteria 2402
235 Ga0495658_0848471 3300046683 Unclassified 584
236 Ga0495670_0395621 3300046691 Bacteria 746
237 Ga0495589_0198318 3300046794 Bacteria 948
238 Ga0496101_0233146 3300048904 Unclassified 1431
239 Ga0496102_0692506 3300048905 Unclassified 942
240 Ga0496104_0087208 3300048907 Bacteria 2980
241 Ga0496104_0270757 3300048907 Bacteria 1611
242 Ga0496104_1680403 3300048907 Unclassified 537
243 Ga0496105_0105179 3300048908 Bacteria 2330
244 Ga0496105_0463766 3300048908 Bacteria 998
245 Ga0496106_0761944 3300048909 Unclassified 769
246 Ga0496107_0776269 3300048910 Unclassified 702
247 Ga0496108_0697954 3300048911 Bacteria 880
248 Ga0496109_0022605 3300048912 Bacteria 5570
249 Ga0496109_0073810 3300048912 Unclassified 3135
250 Ga0496109_0146218 3300048912 Bacteria 2212
251 Ga0496109_1890659 3300048912 Unclassified 529
252 Ga0496110_0382101 3300048913 Unclassified 1283
253 Ga0496110_0415023 3300048913 Unclassified 1227
254 Ga0496111_0159897 3300048914 Bacteria 1672
255 Ga0496111_0222350 3300048914 Unclassified 1403
256 Ga0496112_0097668 3300048915 Unclassified 2907
257 Ga0496112_0342873 3300048915 Bacteria 1437
258 Ga0496113_0156800 3300048916 Bacteria 1798
259 Ga0496114_0177572 3300048917 Bacteria 1858
260 Ga0496114_0293787 3300048917 Bacteria 1434
261 Ga0496115_0128560 3300048918 Bacteria 2087
262 Ga0501321_008662 3300049537 Bacteria 1084
263 Ga0501031_0000671 3300049568 Bacteria 20378
264 Ga0501031_0091161 3300049568 Unclassified 1988
265 Ga0501031_0091340 3300049568 Bacteria 1986
266 Ga0501032_0000289 3300049569 Bacteria 42315
267 Ga0501033_0001004 3300049570 Bacteria 25689
268 Ga0501033_0219281 3300049570 Bacteria 1355
269 Ga0501034_0133273 3300049571 Bacteria 2467
270 Ga0501036_0001436 3300049572 Bacteria 18313
271 Ga0501036_0634324 3300049572 Bacteria 885
272 Ga0501037_0014999 3300049573 Bacteria 5699
273 Ga0501037_0407423 3300049573 Bacteria 932
274 Ga0501038_0001405 3300049574 Bacteria 22037
275 Ga0501038_0205349 3300049574 Bacteria 1579
276 Ga0501039_0012227 3300049575 Bacteria 6542
277 Ga0501039_0046069 3300049575 Bacteria 3369
278 Ga0501039_0455745 3300049575 Bacteria 1004
279 Ga0501040_0000317 3300049576 Bacteria 28397
280 Ga0501040_0031064 3300049576 Bacteria 3609
281 Ga0501040_0980058 3300049576 Bacteria 613
282 Ga0501041_0016599 3300049577 Bacteria 4379
283 Ga0501041_0071386 3300049577 Bacteria 2132
284 Ga0501041_0343077 3300049577 Bacteria 943
285 Ga0501042_0000079 3300049578 Bacteria 36581
286 Ga0501042_0061737 3300049578 Bacteria 2677
287 Ga0501042_0119276 3300049578 Bacteria 1899
288 Ga0501043_0030620 3300049579 Bacteria 4229
289 Ga0501043_0187569 3300049579 Bacteria 1609
290 Ga0501046_0000689 3300049580 Bacteria 32787
291 Ga0501046_0468599 3300049580 Bacteria 905
292 Ga0501047_0015718 3300049581 Bacteria 7211
293 Ga0501048_0001176 3300049582 Bacteria 19776
294 Ga0501048_0231858 3300049582 Bacteria 1310
295 Ga0501067_0268591 3300049583 Bacteria 950
296 Ga0501068_0001997 3300049584 Bacteria 10861
297 Ga0501069_0027287 3300049585 Bacteria 3129
298 Ga0501069_0034866 3300049585 Bacteria 2771
299 Ga0501070_0005718 3300049586 Bacteria 10603
300 Ga0501070_0200715 3300049586 Bacteria 1638
301 Ga0501071_0000107 3300049587 Bacteria 32264
302 Ga0501071_0004686 3300049587 Bacteria 8691
303 Ga0501071_0351118 3300049587 Bacteria 1122
304 Ga0501072_0016789 3300049588 Bacteria 5621
305 Ga0501072_0200403 3300049588 Bacteria 1591
306 Ga0501072_0327035 3300049588 Bacteria 1218
307 Ga0501073_0001865 3300049589 Bacteria 15702
308 Ga0501074_0000090 3300049590 Bacteria 43760
309 Ga0501074_0106291 3300049590 Bacteria 2009
310 Ga0501074_0645533 3300049590 Bacteria 748
311 Ga0501075_0000070 3300049591 Bacteria 45029
312 Ga0501075_0067090 3300049591 Bacteria 2709
313 Ga0501076_0011933 3300049592 Bacteria 6489
314 Ga0501076_1641166 3300049592 Unclassified 527
315 Ga0501077_0000737 3300049593 Bacteria 19798
316 Ga0501077_0007982 3300049593 Bacteria 6543
317 Ga0501077_0890982 3300049593 Unclassified 572
318 Ga0501079_0000822 3300049741 Bacteria 21077
319 Ga0501079_0011050 3300049741 Bacteria 6884
320 Ga0501080_0007636 3300049742 Bacteria 9779
321 Ga0501081_0000820 3300049743 Bacteria 18365
322 Ga0501081_0201986 3300049743 Bacteria 1441
323 Ga0501083_0000086 3300049744 Bacteria 63536
324 Ga0501035_0000369 3300049822 Bacteria 51828
325 Ga0501044_0161702 3300049823 Bacteria 2215
326 Ga0501044_0605209 3300049823 Bacteria 989
327 Ga0501045_0003387 3300049824 Bacteria 10915
328 Ga0501045_0025753 3300049824 Bacteria 4229
329 Ga0501045_0644803 3300049824 Unclassified 783
330 nmdc:mga0yw44_651366_c1 3300050492 Bacteria 716
331 nmdc:mga05p37_1442082_c1 3300050507 Bacteria 690
332 nmdc:mga05p37_2806_c1 3300050507 Bacteria 20259
333 nmdc:mga05p37_430446_c1 3300050507 Bacteria 1533
334 nmdc:mga05p37_733726_c1 3300050507 Archaea 1092
335 nmdc:mga0qj67_251492_c1 3300050509 Archaea 1434
336 nmdc:mga06r32_1156403_c1 3300050510 Bacteria 721
337 nmdc:mga06r32_1287722_c1 3300050510 Unclassified 675
338 nmdc:mga06r32_140340_c1 3300050510 Bacteria 2392
339 nmdc:mga06r32_1761657_c1 3300050510 Bacteria 555
340 nmdc:mga06r32_29189_c1 3300050510 Bacteria 5167
341 nmdc:mga06r32_401434_c1 3300050510 Bacteria 1353
342 nmdc:mga06r32_703920_c1 3300050510 Unclassified 976
343 nmdc:mga08y16_151982_c1 3300050511 Bacteria 2406
344 nmdc:mga08y16_1600623_c1 3300050511 Unclassified 609
345 nmdc:mga08y16_241430_c1 3300050511 Unclassified 1868
346 nmdc:mga08y16_3083_c1 3300050511 Bacteria 17230
347 nmdc:mga0n895_131101_c1 3300050512 Bacteria 2532
348 nmdc:mga0n895_39319_c1 3300050512 Bacteria 4590
349 nmdc:mga0n895_94391_c1 3300050512 Bacteria 2995
350 nmdc:mga0rr50_243005_c1 3300050513 Unclassified 1493
351 nmdc:mga0rr50_308180_c1 3300050513 Bacteria 1326
352 nmdc:mga08x19_56465_c1 3300050514 Unclassified 2534
353 nmdc:mga08x19_75405_c1 3300050514 Bacteria 2205
354 nmdc:mga0a205_104822_c1 3300050515 Plasmid 2727
355 nmdc:mga0a205_111735_c1 3300050515 Bacteria 2632
356 nmdc:mga0a205_197045_c1 3300050515 Bacteria 1905
357 Ga0501084_0005710 3300054114 Bacteria 10226
358 Ga0501084_0076125 3300054114 Bacteria 2812
359 Ga0501084_1292733 3300054114 Bacteria 611
360 Ga0501082_0001195 3300060353 Bacteria 22857
361 Ga0501082_0034173 3300060353 Bacteria 4386
362 Ga0530510_0151159 3300061734 Bacteria 1714
363 Ga0530510_0296251 3300061734 Bacteria 1210
364 Ga0439448_0191430
365 Ga0070683_100483374
366 Ga0070670_100124664
367 Ga0070668_100183517
368 Ga0070675_100566467
369 Ga0070674_100439914
370 Ga0070674_101995861
371 Ga0070659_101038119
372 Ga0070713_100387431
373 Ga0070710_10011366
374 Ga0070701_10688583
375 Ga0070700_100837343
376 Ga0070700_101100865
377 Ga0070708_100011066
378 Ga0070663_100250235
379 Ga0070678_100381841
380 Ga0070678_100791809
381 Ga0070662_100493778
382 Ga0070681_11547823
383 Ga0070685_10625406
384 Ga0070706_100010553
385 Ga0070707_100011776
386 Ga0070707_100533060
387 Ga0070698_100015175
388 Ga0070698_101295491
389 Ga0070684_100201551
390 Ga0070684_101425327
391 Ga0070697_100036819
392 Ga0070686_100946215
393 Ga0070695_100275406
394 Ga0070704_100707653
395 Ga0070664_100995288
396 Ga0068870_10975215
397 Ga0081455_10254689
398 Ga0081455_10302968
399 Ga0081538_10000068
400 Ga0081538_10000824
401 Ga0070717_10017253
402 Ga0070717_10078967
403 Ga0075432_10243572
404 Ga0070716_100380782
405 Ga0075428_100036333
406 Ga0075428_100104499
407 Ga0075428_100214274
408 Ga0075428_100373246
409 Ga0075428_100797738
410 Ga0075428_101751475
411 Ga0075430_100074241
412 Ga0075430_100135322
413 Ga0075431_100039996
414 Ga0075431_100130352
415 Ga0075431_100157796
416 Ga0075431_100191152
417 Ga0075431_100454835
418 Ga0075431_101049041
419 Ga0075431_101343937
420 Ga0075433_10076070
421 Ga0075433_10548687
422 Ga0075433_11235453
423 Ga0075434_100040091
424 Ga0075434_100041188
425 Ga0075429_100601280
426 Ga0075429_101340305
427 Ga0075436_100008770
428 Ga0075435_100089824
429 Ga0099795_10492755
430 Ga0111539_10006293
431 Ga0111539_10371795
432 Ga0111539_10509256
433 Ga0111539_12012096
434 Ga0114129_10104685
435 Ga0114129_10249288
436 Ga0114129_10301540
437 Ga0114129_10434097
438 Ga0114129_10873561
439 Ga0114129_11302849
440 Ga0114129_11311299
441 Ga0114129_11888795
442 Ga0114129_12727136
443 Ga0114129_12914262
444 Ga0105239_10671088
445 Ga0105246_11871480
446 Ga0157375_12710610
447 Ga0163163_11079271
448 Ga0157380_10541913
449 Ga0157377_10650169
450 Ga0157376_10337425
451 Ga0207699_10123572
452 Ga0207684_10002267
453 Ga0207707_10257197
454 Ga0207693_10001039
455 Ga0207646_10002906
456 Ga0207664_10727770
457 Ga0207706_10097877
458 Ga0207669_10095398
459 Ga0207665_10025223
460 Ga0207661_10468069
461 Ga0207661_10569041
462 Ga0207668_11984738
463 Ga0207678_10286838
464 Ga0207708_10602109
465 Ga0207648_10844096
466 Ga0207428_10007915
467 Ga0207428_10087269
468 Ga0207428_11073325
469 Ga0307408_100348641
470 Ga0307408_100826550
471 Ga0307408_102504412
472 Ga0307405_10077807
473 Ga0307405_10802257
474 Ga0307405_11531312
475 Ga0307413_10053888
476 Ga0307413_10252454
477 Ga0307413_10374487
478 Ga0307413_10616919
479 Ga0307410_10111273
480 Ga0307410_10166803
481 Ga0307410_10442633
482 Ga0307410_11260961
483 Ga0307410_11271162
484 Ga0307410_11697013
485 Ga0326468_10022035
486 Ga0307406_10153376
487 Ga0307406_10356127
488 Ga0307406_10397841
489 Ga0307406_10615413
490 Ga0307406_10894907
491 Ga0307406_10942032
492 Ga0307406_11589604
493 Ga0307406_11620914
494 Ga0307407_10042618
495 Ga0307407_10253086
496 Ga0307407_10374619
497 Ga0307407_10398236
498 Ga0307407_10496263
499 Ga0307407_10507791
500 Ga0307407_10541204
501 Ga0307407_10866993
502 Ga0307407_11368971
503 Ga0307412_10018024
504 Ga0307412_10121103
505 Ga0307409_100006463
506 Ga0307409_100246618
507 Ga0307409_100328694
508 Ga0307409_100366150
509 Ga0307409_100412325
510 Ga0307409_100516557
511 Ga0307409_100681407
512 Ga0307409_101178158
513 Ga0307409_101435126
514 Ga0307409_101505996
515 Ga0307409_101902403
516 Ga0307409_102756509
517 Ga0307416_100013586
518 Ga0307416_100039369
519 Ga0307416_100120864
520 Ga0307416_100152092
521 Ga0307416_100213727
522 Ga0307416_100317874
523 Ga0307416_100527981
524 Ga0307416_100586105
525 Ga0307416_100740120
526 Ga0307416_101006618
527 Ga0307416_101138369
528 Ga0307416_101232241
529 Ga0307416_101868484
530 Ga0307414_10042562
531 Ga0307414_10178623
532 Ga0307414_10187180
533 Ga0307414_10475808
534 Ga0307414_10669970
535 Ga0307414_11702835
536 Ga0307414_11919913
537 Ga0307411_10081794
538 Ga0307411_10217213
539 Ga0307411_10763333
540 Ga0307411_10952830
541 Ga0307411_11053471
542 Ga0307415_100000399
543 Ga0307415_100078249
544 Ga0307415_100086431
545 Ga0307415_100161207
546 Ga0307415_100190472
547 Ga0307415_100445115
548 Ga0307415_100534606
549 Ga0307415_100571803
550 Ga0307415_100923862
551 Ga0307415_100925500
552 Ga0307415_101279227
553 Ga0395899_0204446
554 Ga0395900_0090169
555 Ga0395900_0204188
556 Ga0395900_0801441
557 Ga0395900_0813695
558 Ga0395900_1241469
559 Ga0395898_0002030
560 Ga0395898_0095569
561 Ga0395898_0149340
562 Ga0395898_0895984
563 Ga0395905_0424105
564 Ga0395905_1228743
565 Ga0395901_0007853
566 Ga0395901_0111348
567 Ga0395901_0176957
568 Ga0395901_0455119
569 Ga0395901_0652287
570 Ga0395901_1357574
571 Ga0395901_1923274
572 Ga0439466_0064335
573 Ga0451853_2348334
574 Ga0439433_0163378
575 Ga0439441_012713
576 Ga0439442_072875
577 Ga0439450_099477
578 Ga0439463_029484
579 Ga0450888_009010
580 Ga0450905_030340
581 Ga0439446_0286623
582 Ga0439434_0031750
583 Ga0439434_0147055
584 Ga0453684_1538677
585 Ga0466960_0220078
586 Ga0466960_0251560
587 Ga0466960_0268169
588 Ga0466960_0475934
589 Ga0466960_0488047
590 Ga0466967_0020501
591 Ga0466967_0467511
592 Ga0466967_2522889
593 Ga0495590_0181184
594 Ga0495584_0048737
595 Ga0495631_0261398
596 Ga0495631_0470010
597 Ga0495656_0024052
598 Ga0495658_0848471
599 Ga0495670_0395621
600 Ga0495589_0198318
601 Ga0496101_0233146
602 Ga0496102_0692506
603 Ga0496104_0087208
604 Ga0496104_0270757
605 Ga0496104_1680403
606 Ga0496105_0105179
607 Ga0496105_0463766
608 Ga0496106_0761944
609 Ga0496107_0776269
610 Ga0496108_0697954
611 Ga0496109_0022605
612 Ga0496109_0073810
613 Ga0496109_0146218
614 Ga0496109_1890659
615 Ga0496110_0382101
616 Ga0496110_0415023
617 Ga0496111_0159897
618 Ga0496111_0222350
619 Ga0496112_0097668
620 Ga0496112_0342873
621 Ga0496113_0156800
622 Ga0496114_0177572
623 Ga0496114_0293787
624 Ga0496115_0128560
625 Ga0501321_008662
626 Ga0501031_0000671
627 Ga0501031_0091161
628 Ga0501031_0091340
629 Ga0501032_0000289
630 Ga0501033_0001004
631 Ga0501033_0219281
632 Ga0501034_0133273
633 Ga0501036_0001436
634 Ga0501036_0634324
635 Ga0501037_0014999
636 Ga0501037_0407423
637 Ga0501038_0001405
638 Ga0501038_0205349
639 Ga0501039_0012227
640 Ga0501039_0046069
641 Ga0501039_0455745
642 Ga0501040_0000317
643 Ga0501040_0031064
644 Ga0501040_0980058
645 Ga0501041_0016599
646 Ga0501041_0071386
647 Ga0501041_0343077
648 Ga0501042_0000079
649 Ga0501042_0061737
650 Ga0501042_0119276
651 Ga0501043_0030620
652 Ga0501043_0187569
653 Ga0501046_0000689
654 Ga0501046_0468599
655 Ga0501047_0015718
656 Ga0501048_0001176
657 Ga0501048_0231858
658 Ga0501067_0268591
659 Ga0501068_0001997
660 Ga0501069_0027287
661 Ga0501069_0034866
662 Ga0501070_0005718
663 Ga0501070_0200715
664 Ga0501071_0000107
665 Ga0501071_0004686
666 Ga0501071_0351118
667 Ga0501072_0016789
668 Ga0501072_0200403
669 Ga0501072_0327035
670 Ga0501073_0001865
671 Ga0501074_0000090
672 Ga0501074_0106291
673 Ga0501074_0645533
674 Ga0501075_0000070
675 Ga0501075_0067090
676 Ga0501076_0011933
677 Ga0501076_1641166
678 Ga0501077_0000737
679 Ga0501077_0007982
680 Ga0501077_0890982
681 Ga0501079_0000822
682 Ga0501079_0011050
683 Ga0501080_0007636
684 Ga0501081_0000820
685 Ga0501081_0201986
686 Ga0501083_0000086
687 Ga0501035_0000369
688 Ga0501044_0161702
689 Ga0501044_0605209
690 Ga0501045_0003387
691 Ga0501045_0025753
692 Ga0501045_0644803
693 nmdc:mga0yw44_651366_c1
694 nmdc:mga05p37_1442082_c1
695 nmdc:mga05p37_2806_c1
696 nmdc:mga05p37_430446_c1
697 nmdc:mga05p37_733726_c1
698 nmdc:mga0qj67_251492_c1
699 nmdc:mga06r32_1156403_c1
700 nmdc:mga06r32_1287722_c1
701 nmdc:mga06r32_140340_c1
702 nmdc:mga06r32_1761657_c1
703 nmdc:mga06r32_29189_c1
704 nmdc:mga06r32_401434_c1
705 nmdc:mga06r32_703920_c1
706 nmdc:mga08y16_151982_c1
707 nmdc:mga08y16_1600623_c1
708 nmdc:mga08y16_241430_c1
709 nmdc:mga08y16_3083_c1
710 nmdc:mga0n895_131101_c1
711 nmdc:mga0n895_39319_c1
712 nmdc:mga0n895_94391_c1
713 nmdc:mga0rr50_243005_c1
714 nmdc:mga0rr50_308180_c1
715 nmdc:mga08x19_56465_c1
716 nmdc:mga08x19_75405_c1
717 nmdc:mga0a205_104822_c1
718 nmdc:mga0a205_111735_c1
719 nmdc:mga0a205_197045_c1
720 Ga0501084_0005710
721 Ga0501084_0076125
722 Ga0501084_1292733
723 Ga0501082_0001195
724 Ga0501082_0034173
725 Ga0530510_0151159
726 Ga0530510_0296251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

1

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.8695 2 126
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.8153 2 126
3f08-assembly1.cif.gz_A crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153. 0.796 2 129
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.7842 2 128
6ipw-assembly2.cif.gz_D crystal structure of cqsb2 from streptomyces exfoliatus in complex with the product, 1-(2-hydroxypropyl)-2-methyl-carbazole-3,4-dione 0.7834 3 131
ID Description Score Start End Superfamily
2qpvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8653 1 123 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8486 2 129 3.30.530.20
2qpvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8158 1 123 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7922 2 129 3.30.530.20
af_B6SQM0_1_154_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7906 2 130 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A538C4A9-F1-model_v4 SRPBCC family protein 0.9936 1 128
AF-A0A7W1H3C9-F1-model_v4 SCP2 domain-containing protein 0.9893 18 129
AF-A0A7C2KH01-F1-model_v4 SRPBCC family protein 0.9884 1 116
AF-A0A3B1D8X3-F1-model_v4 SRPBCC family protein 0.9727 1 128
AF-A0A7C2KH01-F1-model_v4 SRPBCC family protein 0.9718 1 116

Map