F423044

General Info

Members Datasets Scaffolds Average Seq Length
363 268 726 115

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_0893642|Ga0451843_0893642_56_454
Length 132
Sequence VSETTRSASTDSFVRVCSLDELPSVGAAAADIGGRMVSIVRTADGDVHAVDDTCTHANVSLSEGELDGCTLECWLHGSRFDLRTGAPTGLPATQPIDVYPVTVQDDVVLVDVSAPLTSGAGTSDTFTSSKEH

Samples

Sample ID Description Type Environment
1 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
134 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
135 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
153 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
156 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
165 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
241 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2501939600 Micromonospora sp. L5 Isolate Unclassified
251 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
252 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
253 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
254 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
255 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
256 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
257 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
258 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
259 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
260 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
261 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
262 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
263 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
264 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
265 649633069 Micromonospora sp. L5 Isolate Unclassified
266 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
267 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
268 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.37
Metatranscriptomes 12.4
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0.28
Rhizoplane 7.44
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451843_0893642 3300041509 Bacteria 555
2 ARcpr5oldR_c004220 3300000041 Bacteria 1255
3 JGI24740J21852_10008107 3300001979 Bacteria 4215
4 JGI24740J21852_10019328 3300001979 Bacteria 2402
5 JGI24739J22299_10054660 3300001989 Bacteria 1278
6 JGI24735J21928_10024183 3300002067 Bacteria 1840
7 Ga0007410J51695_1055882 3300003574 Bacteria 904
8 Ga0058863_11222898 3300004799 Bacteria 514
9 Ga0070658_10389884 3300005327 Bacteria 1195
10 Ga0070683_100234711 3300005329 Bacteria 1744
11 Ga0070683_100590543 3300005329 Bacteria 1063
12 Ga0070690_100773512 3300005330 Bacteria 743
13 Ga0070670_101001679 3300005331 Bacteria 760
14 Ga0070677_10484201 3300005333 Bacteria 668
15 Ga0070682_101320570 3300005337 Bacteria 614
16 Ga0070660_100200212 3300005339 Bacteria 1620
17 Ga0070661_100052538 3300005344 Bacteria 2983
18 Ga0070668_100293049 3300005347 Bacteria 1362
19 Ga0070668_101464237 3300005347 Bacteria 624
20 Ga0070671_101919502 3300005355 Bacteria 527
21 Ga0070673_101319635 3300005364 Bacteria 678
22 Ga0070659_100432774 3300005366 Bacteria 1114
23 Ga0070659_100773977 3300005366 Bacteria 833
24 Ga0070667_100904583 3300005367 Bacteria 822
25 Ga0070694_100287345 3300005444 Bacteria 1256
26 Ga0070663_100811923 3300005455 Bacteria 803
27 Ga0070663_101086555 3300005455 Bacteria 699
28 Ga0070678_101373633 3300005456 Bacteria 659
29 Ga0070678_101675445 3300005456 Bacteria 598
30 Ga0070698_100640725 3300005471 Bacteria 1004
31 Ga0070679_100068333 3300005530 Bacteria 3545
32 Ga0070684_101210971 3300005535 Bacteria 710
33 Ga0070684_101687748 3300005535 Bacteria 598
34 Ga0068853_101435809 3300005539 Bacteria 668
35 Ga0068853_101947825 3300005539 Bacteria 570
36 Ga0070672_100611834 3300005543 Bacteria 950
37 Ga0070686_100706498 3300005544 Bacteria 805
38 Ga0070693_101438674 3300005547 Bacteria 537
39 Ga0068855_101659647 3300005563 Bacteria 653
40 Ga0070664_101206698 3300005564 Bacteria 714
41 Ga0068857_100241006 3300005577 Bacteria 1656
42 Ga0068857_100242703 3300005577 Bacteria 1650
43 Ga0068857_100725181 3300005577 Bacteria 946
44 Ga0068854_101069128 3300005578 Bacteria 718
45 Ga0068856_100241767 3300005614 Bacteria 1820
46 Ga0070702_100686269 3300005615 Bacteria 779
47 Ga0070702_100859101 3300005615 Bacteria 707
48 Ga0068852_100115354 3300005616 Bacteria 2449
49 Ga0068852_100973331 3300005616 Bacteria 867
50 Ga0068851_10171141 3300005834 Bacteria 1199
51 Ga0068870_10091466 3300005840 Bacteria 1702
52 Ga0068870_10586233 3300005840 Bacteria 756
53 Ga0081540_1010608 3300005983 Bacteria 6222
54 Ga0075364_10222929 3300006051 Bacteria 1280
55 Ga0075367_10523103 3300006178 Bacteria 753
56 Ga0075366_10368962 3300006195 Unclassified 882
57 Ga0105245_11073415 3300009098 Bacteria 851
58 Ga0105245_12308186 3300009098 Bacteria 592
59 Ga0105243_10389736 3300009148 Bacteria 1291
60 Ga0105242_11233470 3300009176 Bacteria 768
61 Ga0105248_11972892 3300009177 Bacteria 663
62 Ga0105238_11353001 3300009551 Bacteria 739
63 Ga0105238_11540457 3300009551 Bacteria 694
64 Ga0105249_11248487 3300009553 Bacteria 814
65 Ga0105239_12114997 3300010375 Bacteria 654
66 Ga0105246_10392285 3300011119 Bacteria 1150
67 Ga0105246_11551029 3300011119 Bacteria 624
68 Ga0157373_10999970 3300013100 Bacteria 624
69 Ga0157370_10204618 3300013104 Bacteria 1831
70 Ga0157369_11303828 3300013105 Bacteria 740
71 Ga0157374_11108289 3300013296 Bacteria 812
72 Ga0163162_10660650 3300013306 Bacteria 1168
73 Ga0157372_10262491 3300013307 Bacteria 2006
74 Ga0157372_10620435 3300013307 Bacteria 1260
75 Ga0157375_11034500 3300013308 Bacteria 959
76 Ga0157375_11124060 3300013308 Bacteria 920
77 Ga0157375_11452559 3300013308 Bacteria 809
78 Ga0157375_12509440 3300013308 Bacteria 615
79 Ga0163163_10731829 3300014325 Bacteria 1053
80 Ga0163163_11466128 3300014325 Bacteria 744
81 Ga0157380_10539690 3300014326 Bacteria 1142
82 Ga0157380_11334090 3300014326 Bacteria 766
83 Ga0157377_10298428 3300014745 Bacteria 1062
84 Ga0157379_10591482 3300014968 Bacteria 1035
85 Ga0157376_12792555 3300014969 Bacteria 528
86 Ga0197907_10086896 3300020069 Bacteria 1223
87 Ga0197907_11168761 3300020069 Bacteria 653
88 Ga0197907_11490032 3300020069 Bacteria 929
89 Ga0206356_10733820 3300020070 Bacteria 927
90 Ga0206356_11178926 3300020070 Bacteria 4852
91 Ga0206356_11535123 3300020070 Bacteria 1145
92 Ga0206349_1167205 3300020075 Bacteria 922
93 Ga0206349_1748348 3300020075 Bacteria 699
94 Ga0206355_1146480 3300020076 Bacteria 501
95 Ga0206355_1610779 3300020076 Bacteria 1255
96 Ga0206351_10226801 3300020077 Bacteria 694
97 Ga0206352_10682292 3300020078 Bacteria 672
98 Ga0206350_10458848 3300020080 Bacteria 1222
99 Ga0206350_10873579 3300020080 Bacteria 1635
100 Ga0206350_10933944 3300020080 Bacteria 1212
101 Ga0206354_11132065 3300020081 Bacteria 1888
102 Ga0206354_11563025 3300020081 Bacteria 927
103 Ga0206353_10933190 3300020082 Bacteria 1293
104 Ga0206353_11359165 3300020082 Bacteria 757
105 Ga0206353_12006516 3300020082 Bacteria 3255
106 Ga0154015_1222564 3300020610 Bacteria 824
107 Ga0224712_10012246 3300022467 Bacteria 2692
108 Ga0224712_10015722 3300022467 Bacteria 2468
109 Ga0224712_10031275 3300022467 Bacteria 1930
110 Ga0224712_10222053 3300022467 Bacteria 865
111 Ga0207656_10058761 3300025321 Bacteria 1681
112 Ga0207647_10013131 3300025904 Bacteria 5754
113 Ga0207699_10663337 3300025906 Bacteria 762
114 Ga0207645_10513347 3300025907 Bacteria 812
115 Ga0207643_10147809 3300025908 Bacteria 1407
116 Ga0207705_10872366 3300025909 Bacteria 697
117 Ga0207707_11341222 3300025912 Bacteria 573
118 Ga0207663_11001336 3300025916 Bacteria 670
119 Ga0207660_10742925 3300025917 Bacteria 801
120 Ga0207660_10874710 3300025917 Bacteria 733
121 Ga0207657_10305993 3300025919 Bacteria 1258
122 Ga0207649_10451027 3300025920 Bacteria 971
123 Ga0207649_10764077 3300025920 Bacteria 753
124 Ga0207652_10596698 3300025921 Bacteria 990
125 Ga0207652_11457945 3300025921 Bacteria 588
126 Ga0207650_11240211 3300025925 Bacteria 635
127 Ga0207687_10147514 3300025927 Bacteria 1791
128 Ga0207690_10212844 3300025932 Bacteria 1475
129 Ga0207709_10414389 3300025935 Bacteria 1033
130 Ga0207670_10251710 3300025936 Bacteria 1365
131 Ga0207691_10253165 3300025940 Bacteria 1520
132 Ga0207661_10580678 3300025944 Bacteria 1028
133 Ga0207661_11718515 3300025944 Bacteria 573
134 Ga0207679_10516421 3300025945 Bacteria 1068
135 Ga0207667_11061453 3300025949 Bacteria 795
136 Ga0207668_10170523 3300025972 Bacteria 1706
137 Ga0207640_10216067 3300025981 Bacteria 1464
138 Ga0207658_10463191 3300025986 Bacteria 1124
139 Ga0207703_10248006 3300026035 Bacteria 1604
140 Ga0207639_10233342 3300026041 Bacteria 1596
141 Ga0207678_10167264 3300026067 Bacteria 1878
142 Ga0207708_11001890 3300026075 Bacteria 726
143 Ga0207674_10024665 3300026116 Bacteria 6421
144 Ga0207674_10182530 3300026116 Bacteria 2049
145 Ga0207675_101594606 3300026118 Bacteria 673
146 Ga0207675_101710208 3300026118 Bacteria 649
147 Ga0207683_10324349 3300026121 Bacteria 1411
148 Ga0207683_11092660 3300026121 Bacteria 740
149 Ga0207698_10267117 3300026142 Bacteria 1575
150 Ga0207698_10969248 3300026142 Bacteria 860
151 Ga0268266_11044292 3300028379 Bacteria 791
152 Ga0268264_10201057 3300028381 Bacteria 1823
153 Ga0268264_10939250 3300028381 Bacteria 870
154 Ga0307515_10029747 3300028794 Bacteria 9213
155 Ga0307515_10255837 3300028794 Bacteria 1496
156 Ga0265338_10027231 3300028800 Bacteria 5739
157 Ga0265338_10181893 3300028800 Bacteria 1602
158 Ga0265338_10978038 3300028800 Unclassified 574
159 Ga0265340_10014263 3300031247 Bacteria 4155
160 Ga0307513_10611768 3300031456 Bacteria 798
161 Ga0307408_100121550 3300031548 Bacteria 2024
162 Ga0265313_10159629 3300031595 Bacteria 958
163 Ga0265313_10311820 3300031595 Bacteria 630
164 Ga0307508_10281693 3300031616 Bacteria 1256
165 Ga0316575_10019903 3300031665 Bacteria 2570
166 Ga0316575_10036371 3300031665 Bacteria 1936
167 Ga0316579_10001009 3300031691 Bacteria 9893
168 Ga0316579_10023296 3300031691 Bacteria 2777
169 Ga0265314_10141891 3300031711 Bacteria 1484
170 Ga0316576_10036915 3300031727 Bacteria 3494
171 Ga0316576_10104613 3300031727 Bacteria 2118
172 Ga0316578_10000341 3300031728 Bacteria 14701
173 Ga0316578_10079490 3300031728 Bacteria 1950
174 Ga0307405_10526691 3300031731 Bacteria 952
175 Ga0316577_10003307 3300031733 Bacteria 8123
176 Ga0316577_10161406 3300031733 Bacteria 1264
177 Ga0307413_10304506 3300031824 Bacteria 1210
178 Ga0307410_10013953 3300031852 Bacteria 4708
179 Ga0307406_10158554 3300031901 Bacteria 1624
180 Ga0307406_10401496 3300031901 Bacteria 1087
181 Ga0307407_10072744 3300031903 Bacteria 2051
182 Ga0307412_10162307 3300031911 Bacteria 1662
183 Ga0307409_100017334 3300031995 Bacteria 4796
184 Ga0307409_100807479 3300031995 Bacteria 946
185 Ga0307416_101487980 3300032002 Bacteria 783
186 Ga0307414_10650501 3300032004 Bacteria 950
187 Ga0307411_10432020 3300032005 Bacteria 1097
188 Ga0307415_100341911 3300032126 Bacteria 1256
189 Ga0316585_10003099 3300032137 Bacteria 4538
190 Ga0316585_10004322 3300032137 Bacteria 3949
191 Ga0316580_10015366 3300032139 Bacteria 2342
192 Ga0316593_10005028 3300032168 Bacteria 3452
193 Ga0316593_10018365 3300032168 Bacteria 2148
194 Ga0307507_10339612 3300033179 Bacteria 891
195 Ga0316592_1041410 3300033524 Bacteria 1020
196 Ga0316586_1007102 3300033527 Bacteria 1624
197 Ga0316588_1010370 3300033528 Bacteria 1963
198 Ga0316596_1001821 3300033541 Bacteria 4430
199 Ga0316596_1001886 3300033541 Bacteria 4382
200 Ga0373932_0154807 3300035112 Bacteria 789
201 Ga0373960_0377068 3300035121 Bacteria 543
202 Ga0316574_0006776 3300035398 Bacteria 6225
203 Ga0316574_0008045 3300035398 Bacteria 5829
204 Ga0316574_0013214 3300035398 Bacteria 4741
205 Ga0316582_0000594 3300036647 Bacteria 14012
206 Ga0316582_0096847 3300036647 Bacteria 1949
207 Ga0316584_0006293 3300036712 Bacteria 8038
208 Ga0316584_0020236 3300036712 Bacteria 4821
209 Ga0395900_0189332 3300037418 Bacteria 2088
210 Ga0395898_0003367 3300037466 Bacteria 17922
211 Ga0395898_0970399 3300037466 Bacteria 786
212 Ga0395901_0007218 3300038443 Bacteria 11205
213 Ga0395901_0062513 3300038443 Bacteria 3874
214 Ga0395901_0576049 3300038443 Bacteria 1138
215 Ga0439436_0149195 3300041404 Bacteria 659
216 Ga0439466_0157132 3300041411 Bacteria 696
217 Ga0439465_0112014 3300041413 Bacteria 951
218 Ga0451787_216762 3300041441 Bacteria 623
219 Ga0451791_0852220 3300041451 Bacteria 565
220 Ga0451791_1159925 3300041451 Bacteria 633
221 Ga0451793_0062814 3300041452 Bacteria 1040
222 Ga0451797_0681803 3300041453 Bacteria 1365
223 Ga0451797_1390582 3300041453 Bacteria 1359
224 Ga0451833_0761900 3300041491 Bacteria 857
225 Ga0451841_1206216 3300041498 Bacteria 974
226 Ga0451847_0961603 3300041503 Bacteria 502
227 Ga0451849_0084467 3300041505 Bacteria 668
228 Ga0451843_1059338 3300041509 Bacteria 813
229 Ga0451843_1461214 3300041509 Bacteria 1012
230 Ga0451853_2620363 3300041512 Bacteria 942
231 Ga0439433_0021685 3300041999 Bacteria 1438
232 Ga0439449_0245795 3300042007 Bacteria 672
233 Ga0439457_047541 3300042014 Bacteria 961
234 Ga0450905_029310 3300042142 Bacteria 843
235 Ga0450909_024392 3300042185 Bacteria 908
236 Ga0466972_0143189 3300044658 Bacteria 1125
237 Ga0466965_0332420 3300044683 Bacteria 829
238 Ga0466961_0085197 3300044693 Bacteria 1998
239 Ga0466963_0084934 3300044694 Bacteria 2148
240 Ga0466963_0484002 3300044694 Bacteria 874
241 Ga0466964_0071290 3300044706 Bacteria 1470
242 Ga0466970_0019209 3300044765 Bacteria 3541
243 Ga0466970_0684683 3300044765 Bacteria 597
244 Ga0466957_0044871 3300044842 Bacteria 2680
245 Ga0466957_0056037 3300044842 Bacteria 2409
246 Ga0466960_0114812 3300044901 Bacteria 1403
247 Ga0466959_0062760 3300045049 Bacteria 2700
248 Ga0466967_0043439 3300045976 Bacteria 3891
249 Ga0495582_0155176 3300046473 Bacteria 1301
250 Ga0495585_0059392 3300046492 Bacteria 2107
251 Ga0495594_0053583 3300046499 Bacteria 2222
252 Ga0495596_0229566 3300046500 Bacteria 721
253 Ga0495643_0418746 3300046522 Bacteria 588
254 Ga0495609_0365500 3300046538 Bacteria 581
255 Ga0495611_0177042 3300046648 Bacteria 997
256 Ga0495623_0517122 3300046679 Bacteria 628
257 Ga0495670_0168327 3300046691 Bacteria 1153
258 Ga0495581_0288051 3300047315 Bacteria 960
259 Ga0495676_0841024 3300047321 Bacteria 590
260 Ga0495602_0428943 3300048088 Bacteria 937
261 Ga0496101_0255103 3300048904 Bacteria 1367
262 Ga0496101_1113022 3300048904 Bacteria 620
263 Ga0496102_0014513 3300048905 Bacteria 6845
264 Ga0496102_0542116 3300048905 Bacteria 1086
265 Ga0496103_0974957 3300048906 Bacteria 529
266 Ga0496104_0279772 3300048907 Bacteria 1582
267 Ga0496105_0324672 3300048908 Bacteria 1233
268 Ga0496108_0507276 3300048911 Bacteria 1053
269 Ga0496108_0675671 3300048911 Bacteria 897
270 Ga0496109_0096332 3300048912 Bacteria 2741
271 Ga0496109_1938225 3300048912 Bacteria 521
272 Ga0496110_0130007 3300048913 Bacteria 2273
273 Ga0496110_1293720 3300048913 Bacteria 638
274 Ga0496111_0023696 3300048914 Bacteria 4311
275 Ga0496111_0620079 3300048914 Bacteria 791
276 Ga0496111_1337259 3300048914 Bacteria 504
277 Ga0496113_0092501 3300048916 Bacteria 2333
278 Ga0496114_0096479 3300048917 Bacteria 2517
279 Ga0496114_0101375 3300048917 Bacteria 2458
280 Ga0496114_0119229 3300048917 Bacteria 2268
281 Ga0496114_0308467 3300048917 Bacteria 1397
282 Ga0496124_0515653 3300048927 Bacteria 798
283 Ga0501308_058431 3300049128 Bacteria 578
284 Ga0501305_055484 3300049161 Bacteria 673
285 Ga0501311_037926 3300049527 Bacteria 721
286 Ga0501316_060074 3300049532 Bacteria 561
287 Ga0501318_023476 3300049534 Bacteria 797
288 Ga0501321_032585 3300049537 Bacteria 703
289 Ga0501031_0015334 3300049568 Bacteria 4978
290 Ga0501031_0360966 3300049568 Bacteria 940
291 Ga0501031_0850501 3300049568 Bacteria 584
292 Ga0501032_0233966 3300049569 Bacteria 1194
293 Ga0501033_0181398 3300049570 Bacteria 1509
294 Ga0501036_0095318 3300049572 Bacteria 2515
295 Ga0501037_0089939 3300049573 Bacteria 2221
296 Ga0501038_0032635 3300049574 Bacteria 4593
297 Ga0501039_0005642 3300049575 Bacteria 9475
298 Ga0501041_0071282 3300049577 Bacteria 2133
299 Ga0501042_0273583 3300049578 Bacteria 1219
300 Ga0501042_0320088 3300049578 Bacteria 1121
301 Ga0501043_0011920 3300049579 Bacteria 6803
302 Ga0501046_0017168 3300049580 Bacteria 6048
303 Ga0501048_0015674 3300049582 Bacteria 5592
304 Ga0501067_0324845 3300049583 Bacteria 857
305 Ga0501068_0040578 3300049584 Bacteria 2795
306 Ga0501069_0267265 3300049585 Bacteria 999
307 Ga0501071_0042130 3300049587 Bacteria 3270
308 Ga0501071_1410281 3300049587 Bacteria 538
309 Ga0501072_0076778 3300049588 Bacteria 2643
310 Ga0501073_0381155 3300049589 Bacteria 974
311 Ga0501075_0027404 3300049591 Bacteria 4199
312 Ga0501076_0002309 3300049592 Bacteria 13060
313 Ga0501076_0185280 3300049592 Bacteria 1698
314 Ga0501077_0019351 3300049593 Bacteria 4307
315 Ga0501079_0007404 3300049741 Bacteria 8303
316 Ga0501079_0342298 3300049741 Bacteria 1172
317 Ga0501080_0039354 3300049742 Bacteria 4413
318 Ga0501081_0002713 3300049743 Bacteria 11205
319 Ga0501083_0233415 3300049744 Bacteria 1198
320 Ga0501035_0118397 3300049822 Bacteria 2317
321 Ga0501035_1406128 3300049822 Bacteria 535
322 Ga0501044_0095889 3300049823 Bacteria 2989
323 Ga0501044_0329988 3300049823 Bacteria 1449
324 Ga0501045_0003932 3300049824 Bacteria 10236
325 Ga0501045_0679970 3300049824 Bacteria 760
326 Ga0501045_0687368 3300049824 Bacteria 755
327 nmdc:mga00v17_394804_c1 3300050491 Bacteria 899
328 nmdc:mga00v17_589986_c1 3300050491 Bacteria 717
329 nmdc:mga0yw44_547876_c1 3300050492 Bacteria 785
330 nmdc:mga0k408_413295_c1 3300050493 Unclassified 802
331 nmdc:mga07m45_503895_c1 3300050496 Bacteria 701
332 Ga0495595_0483112 3300053084 Bacteria 631
333 Ga0495619_0947323 3300053085 Bacteria 578
334 Ga0500654_041746 3300053099 Bacteria 2595
335 Ga0500628_106040 3300053129 Bacteria 749
336 Ga0501084_0140756 3300054114 Bacteria 2031
337 Ga0587090_008826 3300059510 Bacteria 1362
338 Ga0587106_008995 3300059605 Bacteria 1260
339 Ga0587106_051486 3300059605 Bacteria 731
340 Ga0587101_018183 3300059623 Bacteria 983
341 Ga0587128_046708 3300059630 Bacteria 777
342 Ga0501082_0005620 3300060353 Bacteria 10881
343 Ga0466962_0010540 3300061719 Bacteria 4447
344 Ga0530510_0012324 3300061734 Bacteria 6004
345 2501939970 2501939600 Bacteria 6907073
346 2515722235 2515154129 Bacteria 5584369
347 2516085373 2515154202 Bacteria 5471270
348 2643849789 2643221567 Bacteria 4163945
349 2644135791 2643221624 Bacteria 4384879
350 2808874366 2808606365 Bacteria 4301966
351 2816426180 2816332119 Bacteria 8120218
352 2832008209 2832004796 Bacteria 6538017
353 2856864314 2856858025 Bacteria 7255264
354 2858906650 2858902515 Bacteria 7086037
355 2861522063 2861520306 Bacteria 8348283
356 2866070009 2866065130 Bacteria 6518152
357 2867303692 2867302475 Bacteria 7087181
358 2919450477 2919446982 Bacteria 3994487
359 3001891517 3001889506 Bacteria 2975194
360 649814158 649633069 Bacteria 6962533
361 8003861601 8003856774 Bacteria 7675274
362 8055418326 8055412473 Bacteria 6257500
363 8057572187 8057568493 Bacteria 7221719
364 Ga0451843_0893642
365 ARcpr5oldR_c004220
366 JGI24740J21852_10008107
367 JGI24740J21852_10019328
368 JGI24739J22299_10054660
369 JGI24735J21928_10024183
370 Ga0007410J51695_1055882
371 Ga0058863_11222898
372 Ga0070658_10389884
373 Ga0070683_100234711
374 Ga0070683_100590543
375 Ga0070690_100773512
376 Ga0070670_101001679
377 Ga0070677_10484201
378 Ga0070682_101320570
379 Ga0070660_100200212
380 Ga0070661_100052538
381 Ga0070668_100293049
382 Ga0070668_101464237
383 Ga0070671_101919502
384 Ga0070673_101319635
385 Ga0070659_100432774
386 Ga0070659_100773977
387 Ga0070667_100904583
388 Ga0070694_100287345
389 Ga0070663_100811923
390 Ga0070663_101086555
391 Ga0070678_101373633
392 Ga0070678_101675445
393 Ga0070698_100640725
394 Ga0070679_100068333
395 Ga0070684_101210971
396 Ga0070684_101687748
397 Ga0068853_101435809
398 Ga0068853_101947825
399 Ga0070672_100611834
400 Ga0070686_100706498
401 Ga0070693_101438674
402 Ga0068855_101659647
403 Ga0070664_101206698
404 Ga0068857_100241006
405 Ga0068857_100242703
406 Ga0068857_100725181
407 Ga0068854_101069128
408 Ga0068856_100241767
409 Ga0070702_100686269
410 Ga0070702_100859101
411 Ga0068852_100115354
412 Ga0068852_100973331
413 Ga0068851_10171141
414 Ga0068870_10091466
415 Ga0068870_10586233
416 Ga0081540_1010608
417 Ga0075364_10222929
418 Ga0075367_10523103
419 Ga0075366_10368962
420 Ga0105245_11073415
421 Ga0105245_12308186
422 Ga0105243_10389736
423 Ga0105242_11233470
424 Ga0105248_11972892
425 Ga0105238_11353001
426 Ga0105238_11540457
427 Ga0105249_11248487
428 Ga0105239_12114997
429 Ga0105246_10392285
430 Ga0105246_11551029
431 Ga0157373_10999970
432 Ga0157370_10204618
433 Ga0157369_11303828
434 Ga0157374_11108289
435 Ga0163162_10660650
436 Ga0157372_10262491
437 Ga0157372_10620435
438 Ga0157375_11034500
439 Ga0157375_11124060
440 Ga0157375_11452559
441 Ga0157375_12509440
442 Ga0163163_10731829
443 Ga0163163_11466128
444 Ga0157380_10539690
445 Ga0157380_11334090
446 Ga0157377_10298428
447 Ga0157379_10591482
448 Ga0157376_12792555
449 Ga0197907_10086896
450 Ga0197907_11168761
451 Ga0197907_11490032
452 Ga0206356_10733820
453 Ga0206356_11178926
454 Ga0206356_11535123
455 Ga0206349_1167205
456 Ga0206349_1748348
457 Ga0206355_1146480
458 Ga0206355_1610779
459 Ga0206351_10226801
460 Ga0206352_10682292
461 Ga0206350_10458848
462 Ga0206350_10873579
463 Ga0206350_10933944
464 Ga0206354_11132065
465 Ga0206354_11563025
466 Ga0206353_10933190
467 Ga0206353_11359165
468 Ga0206353_12006516
469 Ga0154015_1222564
470 Ga0224712_10012246
471 Ga0224712_10015722
472 Ga0224712_10031275
473 Ga0224712_10222053
474 Ga0207656_10058761
475 Ga0207647_10013131
476 Ga0207699_10663337
477 Ga0207645_10513347
478 Ga0207643_10147809
479 Ga0207705_10872366
480 Ga0207707_11341222
481 Ga0207663_11001336
482 Ga0207660_10742925
483 Ga0207660_10874710
484 Ga0207657_10305993
485 Ga0207649_10451027
486 Ga0207649_10764077
487 Ga0207652_10596698
488 Ga0207652_11457945
489 Ga0207650_11240211
490 Ga0207687_10147514
491 Ga0207690_10212844
492 Ga0207709_10414389
493 Ga0207670_10251710
494 Ga0207691_10253165
495 Ga0207661_10580678
496 Ga0207661_11718515
497 Ga0207679_10516421
498 Ga0207667_11061453
499 Ga0207668_10170523
500 Ga0207640_10216067
501 Ga0207658_10463191
502 Ga0207703_10248006
503 Ga0207639_10233342
504 Ga0207678_10167264
505 Ga0207708_11001890
506 Ga0207674_10024665
507 Ga0207674_10182530
508 Ga0207675_101594606
509 Ga0207675_101710208
510 Ga0207683_10324349
511 Ga0207683_11092660
512 Ga0207698_10267117
513 Ga0207698_10969248
514 Ga0268266_11044292
515 Ga0268264_10201057
516 Ga0268264_10939250
517 Ga0307515_10029747
518 Ga0307515_10255837
519 Ga0265338_10027231
520 Ga0265338_10181893
521 Ga0265338_10978038
522 Ga0265340_10014263
523 Ga0307513_10611768
524 Ga0307408_100121550
525 Ga0265313_10159629
526 Ga0265313_10311820
527 Ga0307508_10281693
528 Ga0316575_10019903
529 Ga0316575_10036371
530 Ga0316579_10001009
531 Ga0316579_10023296
532 Ga0265314_10141891
533 Ga0316576_10036915
534 Ga0316576_10104613
535 Ga0316578_10000341
536 Ga0316578_10079490
537 Ga0307405_10526691
538 Ga0316577_10003307
539 Ga0316577_10161406
540 Ga0307413_10304506
541 Ga0307410_10013953
542 Ga0307406_10158554
543 Ga0307406_10401496
544 Ga0307407_10072744
545 Ga0307412_10162307
546 Ga0307409_100017334
547 Ga0307409_100807479
548 Ga0307416_101487980
549 Ga0307414_10650501
550 Ga0307411_10432020
551 Ga0307415_100341911
552 Ga0316585_10003099
553 Ga0316585_10004322
554 Ga0316580_10015366
555 Ga0316593_10005028
556 Ga0316593_10018365
557 Ga0307507_10339612
558 Ga0316592_1041410
559 Ga0316586_1007102
560 Ga0316588_1010370
561 Ga0316596_1001821
562 Ga0316596_1001886
563 Ga0373932_0154807
564 Ga0373960_0377068
565 Ga0316574_0006776
566 Ga0316574_0008045
567 Ga0316574_0013214
568 Ga0316582_0000594
569 Ga0316582_0096847
570 Ga0316584_0006293
571 Ga0316584_0020236
572 Ga0395900_0189332
573 Ga0395898_0003367
574 Ga0395898_0970399
575 Ga0395901_0007218
576 Ga0395901_0062513
577 Ga0395901_0576049
578 Ga0439436_0149195
579 Ga0439466_0157132
580 Ga0439465_0112014
581 Ga0451787_216762
582 Ga0451791_0852220
583 Ga0451791_1159925
584 Ga0451793_0062814
585 Ga0451797_0681803
586 Ga0451797_1390582
587 Ga0451833_0761900
588 Ga0451841_1206216
589 Ga0451847_0961603
590 Ga0451849_0084467
591 Ga0451843_1059338
592 Ga0451843_1461214
593 Ga0451853_2620363
594 Ga0439433_0021685
595 Ga0439449_0245795
596 Ga0439457_047541
597 Ga0450905_029310
598 Ga0450909_024392
599 Ga0466972_0143189
600 Ga0466965_0332420
601 Ga0466961_0085197
602 Ga0466963_0084934
603 Ga0466963_0484002
604 Ga0466964_0071290
605 Ga0466970_0019209
606 Ga0466970_0684683
607 Ga0466957_0044871
608 Ga0466957_0056037
609 Ga0466960_0114812
610 Ga0466959_0062760
611 Ga0466967_0043439
612 Ga0495582_0155176
613 Ga0495585_0059392
614 Ga0495594_0053583
615 Ga0495596_0229566
616 Ga0495643_0418746
617 Ga0495609_0365500
618 Ga0495611_0177042
619 Ga0495623_0517122
620 Ga0495670_0168327
621 Ga0495581_0288051
622 Ga0495676_0841024
623 Ga0495602_0428943
624 Ga0496101_0255103
625 Ga0496101_1113022
626 Ga0496102_0014513
627 Ga0496102_0542116
628 Ga0496103_0974957
629 Ga0496104_0279772
630 Ga0496105_0324672
631 Ga0496108_0507276
632 Ga0496108_0675671
633 Ga0496109_0096332
634 Ga0496109_1938225
635 Ga0496110_0130007
636 Ga0496110_1293720
637 Ga0496111_0023696
638 Ga0496111_0620079
639 Ga0496111_1337259
640 Ga0496113_0092501
641 Ga0496114_0096479
642 Ga0496114_0101375
643 Ga0496114_0119229
644 Ga0496114_0308467
645 Ga0496124_0515653
646 Ga0501308_058431
647 Ga0501305_055484
648 Ga0501311_037926
649 Ga0501316_060074
650 Ga0501318_023476
651 Ga0501321_032585
652 Ga0501031_0015334
653 Ga0501031_0360966
654 Ga0501031_0850501
655 Ga0501032_0233966
656 Ga0501033_0181398
657 Ga0501036_0095318
658 Ga0501037_0089939
659 Ga0501038_0032635
660 Ga0501039_0005642
661 Ga0501041_0071282
662 Ga0501042_0273583
663 Ga0501042_0320088
664 Ga0501043_0011920
665 Ga0501046_0017168
666 Ga0501048_0015674
667 Ga0501067_0324845
668 Ga0501068_0040578
669 Ga0501069_0267265
670 Ga0501071_0042130
671 Ga0501071_1410281
672 Ga0501072_0076778
673 Ga0501073_0381155
674 Ga0501075_0027404
675 Ga0501076_0002309
676 Ga0501076_0185280
677 Ga0501077_0019351
678 Ga0501079_0007404
679 Ga0501079_0342298
680 Ga0501080_0039354
681 Ga0501081_0002713
682 Ga0501083_0233415
683 Ga0501035_0118397
684 Ga0501035_1406128
685 Ga0501044_0095889
686 Ga0501044_0329988
687 Ga0501045_0003932
688 Ga0501045_0679970
689 Ga0501045_0687368
690 nmdc:mga00v17_394804_c1
691 nmdc:mga00v17_589986_c1
692 nmdc:mga0yw44_547876_c1
693 nmdc:mga0k408_413295_c1
694 nmdc:mga07m45_503895_c1
695 Ga0495595_0483112
696 Ga0495619_0947323
697 Ga0500654_041746
698 Ga0500628_106040
699 Ga0501084_0140756
700 Ga0587090_008826
701 Ga0587106_008995
702 Ga0587106_051486
703 Ga0587101_018183
704 Ga0587128_046708
705 Ga0501082_0005620
706 Ga0466962_0010540
707 Ga0530510_0012324
708 2501939970
709 2515722235
710 2516085373
711 2643849789
712 2644135791
713 2808874366
714 2816426180
715 2832008209
716 2856864314
717 2858906650
718 2861522063
719 2866070009
720 2867303692
721 2919450477
722 3001891517
723 649814158
724 8003861601
725 8055418326
726 8057572187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

12

100

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

12

111

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9772 5 103
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9697 3 103
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9683 5 106
2i7f-assembly2.cif.gz_B sphingomonas yanoikuyae b1 ferredoxin 0.9552 6 102
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9535 3 101
ID Description Score Start End Superfamily
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9698 3 103 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9614 5 106 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9579 5 103 2.102.10.10
2i7fB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9552 6 102 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9535 3 101 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A2N3YHN1-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin subunit 0.9946 5 103 GO:0046872
GO:0051213
GO:0051537
AF-A0A7W0XWD1-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9936 5 108 GO:0046872
GO:0051537
AF-A0A7Y4L021-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin subunit (Non-heme iron oxygenase ferredoxin subunit) 0.9903 1 112 GO:0046872
GO:0051213
GO:0051537
AF-A0A522B5R3-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9897 6 105 GO:0046872
GO:0051537
AF-A0A0Q8PL80-F1-model_v4 2Fe-2S ferredoxin 0.9892 5 109 GO:0046872
GO:0051537

Map