F422943

General Info

Members Datasets Scaffolds Average Seq Length
363 235 726 85

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10781761|Ga0105243_107817612
Length 101
Sequence MLPTDIPSTGGHSIVSDGEDLTGRIRQVIREHGHLPVELESIDDETDLFQAGMTSHASVNLMLGLESEFDVEFPDAMLKRSVFQSVSAIRSALSRLMAAAA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
160 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 6.06
Rhizosphere 85.67
Stem 0
Stem Tuber 0
Unclassified 14.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10781761 3300009148 Bacteria 939
2 LJNas_1041641 3300000546 Bacteria 500
3 rootH1_10027541 3300003316 Bacteria 3037
4 rootL2_10082481 3300003322 Bacteria 1824
5 rootL2_10256422 3300003322 Bacteria 1862
6 Ga0070658_10032668 3300005327 Bacteria 4185
7 Ga0070658_11870657 3300005327 Bacteria 519
8 Ga0070680_100183677 3300005336 Bacteria 1762
9 Ga0068868_100890725 3300005338 Bacteria 808
10 Ga0070660_100929126 3300005339 Bacteria 734
11 Ga0070660_101155735 3300005339 Bacteria 656
12 Ga0070668_101374939 3300005347 Bacteria 643
13 Ga0070669_100261886 3300005353 Unclassified 1380
14 Ga0070671_101131392 3300005355 Bacteria 688
15 Ga0070709_11668072 3300005434 Bacteria 520
16 Ga0070714_101236078 3300005435 Bacteria 729
17 Ga0070701_10356464 3300005438 Bacteria 915
18 Ga0070705_100002944 3300005440 Bacteria 8418
19 Ga0070705_100385169 3300005440 Bacteria 1033
20 Ga0070705_101644655 3300005440 Unclassified 541
21 Ga0070694_100804144 3300005444 Bacteria 771
22 Ga0070708_101373288 3300005445 Unclassified 659
23 Ga0070708_101926268 3300005445 Bacteria 548
24 Ga0070708_101966062 3300005445 Bacteria 542
25 Ga0070663_101905036 3300005455 Bacteria 534
26 Ga0070678_100047155 3300005456 Bacteria 3094
27 Ga0070662_100028438 3300005457 Bacteria 3890
28 Ga0070681_10298129 3300005458 Unclassified 1522
29 Ga0068867_100170522 3300005459 Bacteria 1723
30 Ga0070685_10329649 3300005466 Bacteria 1037
31 Ga0070706_100000262 3300005467 Bacteria 63811
32 Ga0070706_100449464 3300005467 Unclassified 1199
33 Ga0070706_101439376 3300005467 Unclassified 630
34 Ga0070707_100014653 3300005468 Bacteria 7348
35 Ga0070707_100874063 3300005468 Bacteria 863
36 Ga0070679_100002353 3300005530 Bacteria 17120
37 Ga0070679_100446869 3300005530 Bacteria 1237
38 Ga0070679_101734280 3300005530 Bacteria 573
39 Ga0070684_101297026 3300005535 Bacteria 685
40 Ga0070684_101957606 3300005535 Bacteria 553
41 Ga0070697_101798497 3300005536 Bacteria 548
42 Ga0070693_100302879 3300005547 Bacteria 1078
43 Ga0070693_100340162 3300005547 Bacteria 1024
44 Ga0070665_100013341 3300005548 Bacteria 8271
45 Ga0070704_100129224 3300005549 Bacteria 1955
46 Ga0070704_100846505 3300005549 Bacteria 820
47 Ga0068855_100181036 3300005563 Unclassified 2382
48 Ga0068855_100407818 3300005563 Bacteria 1488
49 Ga0068857_101143467 3300005577 Bacteria 753
50 Ga0068854_100947000 3300005578 Bacteria 759
51 Ga0068856_100099216 3300005614 Bacteria 2903
52 Ga0068856_101193819 3300005614 Unclassified 777
53 Ga0068856_101240064 3300005614 Bacteria 762
54 Ga0068856_102548063 3300005614 Bacteria 518
55 Ga0068852_100649570 3300005616 Bacteria 1062
56 Ga0068852_101202229 3300005616 Bacteria 779
57 Ga0068864_101460870 3300005618 Unclassified 686
58 Ga0068866_11116925 3300005718 Bacteria 565
59 Ga0068858_101658540 3300005842 Bacteria 631
60 Ga0068860_100477942 3300005843 Bacteria 1242
61 Ga0068862_100601127 3300005844 Bacteria 1056
62 Ga0068862_100856132 3300005844 Bacteria 891
63 Ga0081455_10163483 3300005937 Bacteria 1703
64 Ga0070717_10337069 3300006028 Bacteria 1346
65 Ga0070716_100556526 3300006173 Bacteria 856
66 Ga0097621_100585831 3300006237 Bacteria 1018
67 Ga0097621_101609152 3300006237 Bacteria 618
68 Ga0097621_102102692 3300006237 Bacteria 540
69 Ga0075370_10152480 3300006353 Bacteria 1355
70 Ga0068871_100518379 3300006358 Bacteria 1076
71 Ga0068871_100676571 3300006358 Unclassified 944
72 Ga0068871_100906974 3300006358 Unclassified 817
73 Ga0075428_100895586 3300006844 Bacteria 941
74 Ga0075433_10101794 3300006852 Bacteria 2544
75 Ga0075429_101347012 3300006880 Bacteria 622
76 Ga0075436_100243821 3300006914 Bacteria 1278
77 Ga0075435_100005396 3300007076 Bacteria 8913
78 Ga0105240_10016130 3300009093 Bacteria 10123
79 Ga0105240_10862433 3300009093 Unclassified 976
80 Ga0105240_11469626 3300009093 Bacteria 715
81 Ga0111539_11755417 3300009094 Unclassified 720
82 Ga0111539_12377086 3300009094 Bacteria 615
83 Ga0111539_13302828 3300009094 Unclassified 519
84 Ga0105245_10000382 3300009098 Bacteria 41169
85 Ga0105245_10031156 3300009098 Bacteria 4718
86 Ga0105245_10394590 3300009098 Bacteria 1381
87 Ga0105243_10009596 3300009148 Bacteria 7369
88 Ga0105241_10219187 3300009174 Bacteria 1598
89 Ga0105242_11357919 3300009176 Bacteria 736
90 Ga0105237_10000048 3300009545 Bacteria 165532
91 Ga0105237_12269227 3300009545 Bacteria 552
92 Ga0105238_10019541 3300009551 Bacteria 6900
93 Ga0105239_10029644 3300010375 Bacteria 6016
94 Ga0105239_10381383 3300010375 Bacteria 1594
95 Ga0105239_12373011 3300010375 Bacteria 618
96 Ga0105239_12727895 3300010375 Bacteria 576
97 Ga0157373_10526674 3300013100 Unclassified 855
98 Ga0157374_10545501 3300013296 Unclassified 1167
99 Ga0157374_10608035 3300013296 Bacteria 1103
100 Ga0157374_11032567 3300013296 Bacteria 842
101 Ga0157378_10749384 3300013297 Bacteria 999
102 Ga0157378_11416140 3300013297 Bacteria 738
103 Ga0157378_12126412 3300013297 Bacteria 612
104 Ga0163162_13169161 3300013306 Unclassified 528
105 Ga0163163_12040383 3300014325 Bacteria 633
106 Ga0157380_11012616 3300014326 Unclassified 865
107 Ga0157380_13478984 3300014326 Bacteria 504
108 Ga0182008_10603577 3300014497 Bacteria 616
109 Ga0157377_10000038 3300014745 Bacteria 113777
110 Ga0157379_10191014 3300014968 Bacteria 1851
111 Ga0157376_10067180 3300014969 Bacteria 3032
112 Ga0157376_11120598 3300014969 Bacteria 813
113 Ga0182007_10355831 3300015262 Bacteria 551
114 Ga0182005_1124518 3300015265 Bacteria 736
115 Ga0206355_1446007 3300020076 Bacteria 525
116 Ga0206351_10788557 3300020077 Bacteria 571
117 Ga0213876_10592488 3300021384 Unclassified 590
118 Ga0213875_10012440 3300021388 Bacteria 4205
119 Ga0213875_10043112 3300021388 Bacteria 2119
120 Ga0224712_10248029 3300022467 Bacteria 822
121 Ga0209677_100707 3300025253 Bacteria 17037
122 Ga0207705_10006354 3300025909 Bacteria 8764
123 Ga0207705_10081899 3300025909 Bacteria 2353
124 Ga0207705_10574370 3300025909 Bacteria 876
125 Ga0207684_10000894 3300025910 Bacteria 33903
126 Ga0207654_10027111 3300025911 Bacteria 3111
127 Ga0207707_10515129 3300025912 Bacteria 1019
128 Ga0207695_10007737 3300025913 Bacteria 13615
129 Ga0207695_10487954 3300025913 Bacteria 1114
130 Ga0207695_11277856 3300025913 Bacteria 614
131 Ga0207671_10000077 3300025914 Bacteria 150801
132 Ga0207660_10246468 3300025917 Bacteria 1409
133 Ga0207660_11670804 3300025917 Bacteria 512
134 Ga0207657_10371396 3300025919 Bacteria 1127
135 Ga0207652_10000786 3300025921 Bacteria 30309
136 Ga0207652_10020810 3300025921 Bacteria 5407
137 Ga0207652_10935558 3300025921 Unclassified 764
138 Ga0207646_10015030 3300025922 Bacteria 7326
139 Ga0207694_10025407 3300025924 Bacteria 4503
140 Ga0207694_10547604 3300025924 Bacteria 971
141 Ga0207659_10883295 3300025926 Bacteria 768
142 Ga0207687_10009986 3300025927 Bacteria 6211
143 Ga0207687_10051740 3300025927 Bacteria 2864
144 Ga0207687_11197254 3300025927 Bacteria 653
145 Ga0207687_11360527 3300025927 Unclassified 610
146 Ga0207690_10179736 3300025932 Unclassified 1592
147 Ga0207690_10203040 3300025932 Bacteria 1507
148 Ga0207706_10001797 3300025933 Bacteria 21093
149 Ga0207709_10320854 3300025935 Bacteria 1159
150 Ga0207665_10821938 3300025939 Bacteria 735
151 Ga0207691_10251315 3300025940 Bacteria 1526
152 Ga0207679_12189961 3300025945 Bacteria 501
153 Ga0207667_10177581 3300025949 Bacteria 2187
154 Ga0207712_10664442 3300025961 Unclassified 907
155 Ga0207677_10469900 3300026023 Bacteria 1081
156 Ga0207639_10313894 3300026041 Bacteria 1390
157 Ga0207639_11778248 3300026041 Unclassified 577
158 Ga0207678_11449729 3300026067 Bacteria 606
159 Ga0207702_10867435 3300026078 Bacteria 894
160 Ga0207702_12254032 3300026078 Unclassified 533
161 Ga0207641_10101685 3300026088 Bacteria 2533
162 Ga0207648_10000053 3300026089 Bacteria 107516
163 Ga0207676_11193322 3300026095 Unclassified 754
164 Ga0207674_10865941 3300026116 Bacteria 871
165 Ga0207675_100858605 3300026118 Unclassified 923
166 Ga0207675_101650326 3300026118 Unclassified 661
167 Ga0207683_10103243 3300026121 Bacteria 2546
168 Ga0207683_11448699 3300026121 Bacteria 635
169 Ga0207698_10902497 3300026142 Bacteria 891
170 Ga0209998_10011533 3300027717 Bacteria 1830
171 Ga0209974_10005590 3300027876 Bacteria 4413
172 Ga0268266_10079728 3300028379 Bacteria 2851
173 Ga0268266_10435446 3300028379 Bacteria 1245
174 Ga0268265_10926230 3300028380 Bacteria 857
175 Ga0265337_1039321 3300028556 Bacteria 1368
176 Ga0265319_1009795 3300028563 Bacteria 4046
177 Ga0265319_1054392 3300028563 Bacteria 1313
178 Ga0265319_1057341 3300028563 Bacteria 1271
179 Ga0265319_1059877 3300028563 Bacteria 1237
180 Ga0265318_10000011 3300028577 Bacteria 231078
181 Ga0265318_10003880 3300028577 Bacteria 7379
182 Ga0265318_10145517 3300028577 Unclassified 870
183 Ga0307515_10065258 3300028794 Bacteria 5071
184 Ga0265338_10003474 3300028800 Bacteria 22142
185 Ga0265330_10000019 3300031235 Bacteria 156905
186 Ga0265332_10000252 3300031238 Bacteria 42775
187 Ga0265328_10012856 3300031239 Bacteria 3326
188 Ga0265320_10000005 3300031240 Bacteria 354422
189 Ga0265320_10009881 3300031240 Bacteria 5717
190 Ga0265320_10212570 3300031240 Bacteria 862
191 Ga0265320_10254677 3300031240 Bacteria 778
192 Ga0265329_10006127 3300031242 Bacteria 4796
193 Ga0265339_10088477 3300031249 Bacteria 1627
194 Ga0265331_10000013 3300031250 Bacteria 296011
195 Ga0265316_10004150 3300031344 Bacteria 14477
196 Ga0307513_10343761 3300031456 Bacteria 1242
197 Ga0307408_100702338 3300031548 Bacteria 909
198 Ga0265313_10000019 3300031595 Bacteria 149106
199 Ga0265313_10013024 3300031595 Bacteria 5026
200 Ga0265313_10042349 3300031595 Bacteria 2237
201 Ga0265313_10152700 3300031595 Bacteria 986
202 Ga0265314_10000024 3300031711 Bacteria 295216
203 Ga0265342_10034832 3300031712 Bacteria 3086
204 Ga0307516_10000340 3300031730 Bacteria 61066
205 Ga0307410_10306654 3300031852 Bacteria 1255
206 Ga0307412_10098092 3300031911 Bacteria 2066
207 Ga0307414_10909273 3300032004 Bacteria 807
208 Ga0307411_10088777 3300032005 Bacteria 2151
209 Ga0373956_0482945 3300035119 Bacteria 591
210 Ga0373931_0040476 3300035691 Bacteria 2446
211 Ga0373937_1039287 3300036401 Unclassified 768
212 Ga0373937_1669207 3300036401 Unclassified 584
213 Ga0373925_1260211 3300037068 Bacteria 607
214 Ga0395899_0281900 3300037312 Bacteria 1130
215 Ga0395900_0521959 3300037418 Bacteria 1135
216 Ga0395905_0000290 3300037471 Bacteria 73649
217 Ga0395905_0000597 3300037471 Bacteria 48243
218 Ga0395905_0009267 3300037471 Bacteria 9630
219 Ga0395905_0073283 3300037471 Bacteria 3210
220 Ga0436364_0875922 3300037853 Bacteria 617
221 Ga0436364_1483012 3300037853 Bacteria 2096
222 Ga0436364_1561970 3300037853 Bacteria 4715
223 Ga0395901_0139916 3300038443 Bacteria 2544
224 Ga0395901_1378522 3300038443 Bacteria 664
225 Ga0436365_0253348 3300039437 Bacteria 5796
226 Ga0436365_0363292 3300039437 Bacteria 1387
227 Ga0436365_0450834 3300039437 Bacteria 1697
228 Ga0436365_0661272 3300039437 Bacteria 519
229 Ga0436365_0852231 3300039437 Bacteria 717
230 Ga0436365_1898013 3300039437 Bacteria 2777
231 Ga0436362_0922567 3300039453 Unclassified 557
232 Ga0436362_1062908 3300039453 Bacteria 569
233 Ga0451791_0805373 3300041451 Unclassified 653
234 Ga0451800_1348982 3300041459 Bacteria 580
235 Ga0451807_1580924 3300041486 Bacteria 813
236 Ga0451807_2493558 3300041486 Unclassified 586
237 Ga0451807_2497587 3300041486 Bacteria 513
238 Ga0451807_2713744 3300041486 Bacteria 1043
239 Ga0451837_1727274 3300041494 Bacteria 696
240 Ga0451841_1337413 3300041498 Unclassified 542
241 Ga0451855_1367661 3300041511 Unclassified 509
242 Ga0451853_3351758 3300041512 Unclassified 680
243 Ga0439449_0052476 3300042007 Bacteria 1508
244 Ga0439457_087315 3300042014 Unclassified 720
245 Ga0439462_0081261 3300042015 Bacteria 885
246 Ga0450896_031327 3300042133 Unclassified 806
247 Ga0450898_089627 3300042134 Bacteria 633
248 Ga0439446_0253503 3300042156 Bacteria 607
249 Ga0451577_0008875 3300042876 Bacteria 9732
250 Ga0466969_0013877 3300044656 Bacteria 4240
251 Ga0466969_0023479 3300044656 Bacteria 3178
252 Ga0466969_0065573 3300044656 Bacteria 1755
253 Ga0466972_0120663 3300044658 Bacteria 1236
254 Ga0466965_0017376 3300044683 Bacteria 3438
255 Ga0466965_0038743 3300044683 Bacteria 2342
256 Ga0466965_0176587 3300044683 Bacteria 1125
257 Ga0466966_0018273 3300044684 Bacteria 4625
258 Ga0466966_0039336 3300044684 Bacteria 3046
259 Ga0466966_0868649 3300044684 Bacteria 544
260 Ga0466961_0027852 3300044693 Bacteria 3633
261 Ga0466961_0046178 3300044693 Bacteria 2786
262 Ga0466961_0335857 3300044693 Bacteria 920
263 Ga0466964_0001297 3300044706 Bacteria 8525
264 Ga0466964_0060293 3300044706 Bacteria 1578
265 Ga0453684_0157234 3300044712 Bacteria 2693
266 Ga0466971_0056491 3300044719 Bacteria 1770
267 Ga0466968_0247997 3300044735 Bacteria 845
268 Ga0466970_0064935 3300044765 Bacteria 1958
269 Ga0466970_0192148 3300044765 Bacteria 1134
270 Ga0466970_0297299 3300044765 Bacteria 910
271 Ga0466970_0489578 3300044765 Bacteria 707
272 Ga0466957_0120473 3300044842 Bacteria 1672
273 Ga0466957_0302218 3300044842 Bacteria 1075
274 Ga0466960_0095507 3300044901 Bacteria 1522
275 Ga0466959_0016024 3300045049 Bacteria 5470
276 Ga0466959_0019182 3300045049 Bacteria 5028
277 Ga0466959_0051993 3300045049 Bacteria 3002
278 Ga0466959_0068599 3300045049 Bacteria 2569
279 Ga0466959_0925379 3300045049 Bacteria 581
280 Ga0466959_1100358 3300045049 Bacteria 528
281 Ga0466958_0179740 3300045836 Bacteria 1342
282 Ga0466958_0203828 3300045836 Bacteria 1259
283 Ga0466958_0433679 3300045836 Bacteria 850
284 Ga0466958_0960770 3300045836 Bacteria 557
285 Ga0466967_0147198 3300045976 Bacteria 2198
286 Ga0466967_0380288 3300045976 Bacteria 1371
287 Ga0466967_1029401 3300045976 Bacteria 820
288 Ga0466967_1604672 3300045976 Bacteria 648
289 Ga0466967_1804766 3300045976 Bacteria 609
290 Ga0466967_2582580 3300045976 Bacteria 503
291 Ga0495582_0599125 3300046473 Unclassified 638
292 Ga0495662_0513246 3300046476 Unclassified 587
293 Ga0495594_0453275 3300046499 Unclassified 729
294 Ga0495628_0406343 3300046516 Unclassified 994
295 Ga0495630_0545485 3300046517 Unclassified 889
296 Ga0495645_0707806 3300046543 Unclassified 611
297 Ga0495635_0476730 3300046663 Unclassified 823
298 Ga0495647_0491110 3300046681 Unclassified 571
299 Ga0495658_1046238 3300046683 Bacteria 521
300 Ga0495658_1099248 3300046683 Bacteria 507
301 Ga0495674_1009741 3300047319 Unclassified 637
302 Ga0495676_0153795 3300047321 Bacteria 1634
303 Ga0495686_0437313 3300047472 Unclassified 697
304 Ga0496103_0549922 3300048906 Bacteria 737
305 Ga0496104_0054975 3300048907 Bacteria 3763
306 Ga0496104_0146215 3300048907 Unclassified 2270
307 Ga0496104_1526362 3300048907 Unclassified 571
308 Ga0496105_0166128 3300048908 Bacteria 1810
309 Ga0496106_0024891 3300048909 Bacteria 4451
310 Ga0496107_0775571 3300048910 Bacteria 703
311 Ga0496108_0003809 3300048911 Bacteria 12079
312 Ga0496108_0084017 3300048911 Bacteria 2701
313 Ga0496109_0026250 3300048912 Bacteria 5194
314 Ga0496109_0156396 3300048912 Bacteria 2135
315 Ga0496110_0477319 3300048913 Bacteria 1136
316 Ga0496112_0031408 3300048915 Bacteria 5151
317 Ga0496113_0469943 3300048916 Bacteria 1010
318 Ga0496114_0440833 3300048917 Bacteria 1153
319 Ga0496115_1355235 3300048918 Unclassified 527
320 Ga0496121_0494087 3300048924 Bacteria 778
321 Ga0501308_011803 3300049128 Bacteria 990
322 Ga0501304_017813 3300049160 Bacteria 682
323 Ga0501314_046717 3300049530 Bacteria 516
324 Ga0501032_0323463 3300049569 Bacteria 995
325 Ga0501033_0224473 3300049570 Bacteria 1336
326 Ga0501034_0238806 3300049571 Bacteria 1764
327 Ga0501036_0072234 3300049572 Bacteria 2917
328 Ga0501039_1510911 3300049575 Bacteria 516
329 Ga0501043_0000500 3300049579 Bacteria 35172
330 Ga0501043_0867368 3300049579 Bacteria 649
331 Ga0501046_0000571 3300049580 Bacteria 36427
332 Ga0501046_0323780 3300049580 Bacteria 1123
333 Ga0501047_0000062 3300049581 Bacteria 137218
334 Ga0501047_0076823 3300049581 Bacteria 3214
335 Ga0501047_1303444 3300049581 Bacteria 540
336 Ga0501048_0000388 3300049582 Bacteria 30543
337 Ga0501068_0171176 3300049584 Bacteria 1371
338 Ga0501070_0229136 3300049586 Bacteria 1522
339 Ga0501072_0588639 3300049588 Bacteria 877
340 Ga0501074_0130575 3300049590 Bacteria 1797
341 Ga0501236_126906 3300049670 Bacteria 523
342 Ga0501080_0013527 3300049742 Bacteria 7510
343 Ga0501080_0064470 3300049742 Bacteria 3408
344 Ga0501080_0627776 3300049742 Bacteria 952
345 Ga0501083_0128082 3300049744 Bacteria 1664
346 Ga0501035_0053283 3300049822 Bacteria 3618
347 Ga0501044_0948446 3300049823 Bacteria 733
348 Ga0501044_1119583 3300049823 Bacteria 656
349 Ga0501044_1635427 3300049823 Bacteria 509
350 Ga0501045_0005854 3300049824 Bacteria 8507
351 nmdc:mga0k408_290291_c1 3300050493 Bacteria 976
352 nmdc:mga07m45_232152_c1 3300050496 Unclassified 1073
353 nmdc:mga07m45_76508_c1 3300050496 Bacteria 1908
354 nmdc:mga08y16_142903_c1 3300050511 Bacteria 2488
355 Ga0495601_0692790 3300053077 Unclassified 650
356 Ga0495619_0101695 3300053085 Bacteria 1957
357 Ga0500578_0058160 3300053086 Bacteria 2471
358 Ga0500645_002062 3300053730 Bacteria 9320
359 Ga0501084_0169273 3300054114 Bacteria 1844
360 Ga0587066_227952 3300059490 Bacteria 503
361 Ga0501082_1184529 3300060353 Bacteria 668
362 Ga0466962_0003830 3300061719 Bacteria 7188
363 Ga0466962_0172935 3300061719 Bacteria 1052
364 Ga0105243_10781761
365 LJNas_1041641
366 rootH1_10027541
367 rootL2_10082481
368 rootL2_10256422
369 Ga0070658_10032668
370 Ga0070658_11870657
371 Ga0070680_100183677
372 Ga0068868_100890725
373 Ga0070660_100929126
374 Ga0070660_101155735
375 Ga0070668_101374939
376 Ga0070669_100261886
377 Ga0070671_101131392
378 Ga0070709_11668072
379 Ga0070714_101236078
380 Ga0070701_10356464
381 Ga0070705_100002944
382 Ga0070705_100385169
383 Ga0070705_101644655
384 Ga0070694_100804144
385 Ga0070708_101373288
386 Ga0070708_101926268
387 Ga0070708_101966062
388 Ga0070663_101905036
389 Ga0070678_100047155
390 Ga0070662_100028438
391 Ga0070681_10298129
392 Ga0068867_100170522
393 Ga0070685_10329649
394 Ga0070706_100000262
395 Ga0070706_100449464
396 Ga0070706_101439376
397 Ga0070707_100014653
398 Ga0070707_100874063
399 Ga0070679_100002353
400 Ga0070679_100446869
401 Ga0070679_101734280
402 Ga0070684_101297026
403 Ga0070684_101957606
404 Ga0070697_101798497
405 Ga0070693_100302879
406 Ga0070693_100340162
407 Ga0070665_100013341
408 Ga0070704_100129224
409 Ga0070704_100846505
410 Ga0068855_100181036
411 Ga0068855_100407818
412 Ga0068857_101143467
413 Ga0068854_100947000
414 Ga0068856_100099216
415 Ga0068856_101193819
416 Ga0068856_101240064
417 Ga0068856_102548063
418 Ga0068852_100649570
419 Ga0068852_101202229
420 Ga0068864_101460870
421 Ga0068866_11116925
422 Ga0068858_101658540
423 Ga0068860_100477942
424 Ga0068862_100601127
425 Ga0068862_100856132
426 Ga0081455_10163483
427 Ga0070717_10337069
428 Ga0070716_100556526
429 Ga0097621_100585831
430 Ga0097621_101609152
431 Ga0097621_102102692
432 Ga0075370_10152480
433 Ga0068871_100518379
434 Ga0068871_100676571
435 Ga0068871_100906974
436 Ga0075428_100895586
437 Ga0075433_10101794
438 Ga0075429_101347012
439 Ga0075436_100243821
440 Ga0075435_100005396
441 Ga0105240_10016130
442 Ga0105240_10862433
443 Ga0105240_11469626
444 Ga0111539_11755417
445 Ga0111539_12377086
446 Ga0111539_13302828
447 Ga0105245_10000382
448 Ga0105245_10031156
449 Ga0105245_10394590
450 Ga0105243_10009596
451 Ga0105241_10219187
452 Ga0105242_11357919
453 Ga0105237_10000048
454 Ga0105237_12269227
455 Ga0105238_10019541
456 Ga0105239_10029644
457 Ga0105239_10381383
458 Ga0105239_12373011
459 Ga0105239_12727895
460 Ga0157373_10526674
461 Ga0157374_10545501
462 Ga0157374_10608035
463 Ga0157374_11032567
464 Ga0157378_10749384
465 Ga0157378_11416140
466 Ga0157378_12126412
467 Ga0163162_13169161
468 Ga0163163_12040383
469 Ga0157380_11012616
470 Ga0157380_13478984
471 Ga0182008_10603577
472 Ga0157377_10000038
473 Ga0157379_10191014
474 Ga0157376_10067180
475 Ga0157376_11120598
476 Ga0182007_10355831
477 Ga0182005_1124518
478 Ga0206355_1446007
479 Ga0206351_10788557
480 Ga0213876_10592488
481 Ga0213875_10012440
482 Ga0213875_10043112
483 Ga0224712_10248029
484 Ga0209677_100707
485 Ga0207705_10006354
486 Ga0207705_10081899
487 Ga0207705_10574370
488 Ga0207684_10000894
489 Ga0207654_10027111
490 Ga0207707_10515129
491 Ga0207695_10007737
492 Ga0207695_10487954
493 Ga0207695_11277856
494 Ga0207671_10000077
495 Ga0207660_10246468
496 Ga0207660_11670804
497 Ga0207657_10371396
498 Ga0207652_10000786
499 Ga0207652_10020810
500 Ga0207652_10935558
501 Ga0207646_10015030
502 Ga0207694_10025407
503 Ga0207694_10547604
504 Ga0207659_10883295
505 Ga0207687_10009986
506 Ga0207687_10051740
507 Ga0207687_11197254
508 Ga0207687_11360527
509 Ga0207690_10179736
510 Ga0207690_10203040
511 Ga0207706_10001797
512 Ga0207709_10320854
513 Ga0207665_10821938
514 Ga0207691_10251315
515 Ga0207679_12189961
516 Ga0207667_10177581
517 Ga0207712_10664442
518 Ga0207677_10469900
519 Ga0207639_10313894
520 Ga0207639_11778248
521 Ga0207678_11449729
522 Ga0207702_10867435
523 Ga0207702_12254032
524 Ga0207641_10101685
525 Ga0207648_10000053
526 Ga0207676_11193322
527 Ga0207674_10865941
528 Ga0207675_100858605
529 Ga0207675_101650326
530 Ga0207683_10103243
531 Ga0207683_11448699
532 Ga0207698_10902497
533 Ga0209998_10011533
534 Ga0209974_10005590
535 Ga0268266_10079728
536 Ga0268266_10435446
537 Ga0268265_10926230
538 Ga0265337_1039321
539 Ga0265319_1009795
540 Ga0265319_1054392
541 Ga0265319_1057341
542 Ga0265319_1059877
543 Ga0265318_10000011
544 Ga0265318_10003880
545 Ga0265318_10145517
546 Ga0307515_10065258
547 Ga0265338_10003474
548 Ga0265330_10000019
549 Ga0265332_10000252
550 Ga0265328_10012856
551 Ga0265320_10000005
552 Ga0265320_10009881
553 Ga0265320_10212570
554 Ga0265320_10254677
555 Ga0265329_10006127
556 Ga0265339_10088477
557 Ga0265331_10000013
558 Ga0265316_10004150
559 Ga0307513_10343761
560 Ga0307408_100702338
561 Ga0265313_10000019
562 Ga0265313_10013024
563 Ga0265313_10042349
564 Ga0265313_10152700
565 Ga0265314_10000024
566 Ga0265342_10034832
567 Ga0307516_10000340
568 Ga0307410_10306654
569 Ga0307412_10098092
570 Ga0307414_10909273
571 Ga0307411_10088777
572 Ga0373956_0482945
573 Ga0373931_0040476
574 Ga0373937_1039287
575 Ga0373937_1669207
576 Ga0373925_1260211
577 Ga0395899_0281900
578 Ga0395900_0521959
579 Ga0395905_0000290
580 Ga0395905_0000597
581 Ga0395905_0009267
582 Ga0395905_0073283
583 Ga0436364_0875922
584 Ga0436364_1483012
585 Ga0436364_1561970
586 Ga0395901_0139916
587 Ga0395901_1378522
588 Ga0436365_0253348
589 Ga0436365_0363292
590 Ga0436365_0450834
591 Ga0436365_0661272
592 Ga0436365_0852231
593 Ga0436365_1898013
594 Ga0436362_0922567
595 Ga0436362_1062908
596 Ga0451791_0805373
597 Ga0451800_1348982
598 Ga0451807_1580924
599 Ga0451807_2493558
600 Ga0451807_2497587
601 Ga0451807_2713744
602 Ga0451837_1727274
603 Ga0451841_1337413
604 Ga0451855_1367661
605 Ga0451853_3351758
606 Ga0439449_0052476
607 Ga0439457_087315
608 Ga0439462_0081261
609 Ga0450896_031327
610 Ga0450898_089627
611 Ga0439446_0253503
612 Ga0451577_0008875
613 Ga0466969_0013877
614 Ga0466969_0023479
615 Ga0466969_0065573
616 Ga0466972_0120663
617 Ga0466965_0017376
618 Ga0466965_0038743
619 Ga0466965_0176587
620 Ga0466966_0018273
621 Ga0466966_0039336
622 Ga0466966_0868649
623 Ga0466961_0027852
624 Ga0466961_0046178
625 Ga0466961_0335857
626 Ga0466964_0001297
627 Ga0466964_0060293
628 Ga0453684_0157234
629 Ga0466971_0056491
630 Ga0466968_0247997
631 Ga0466970_0064935
632 Ga0466970_0192148
633 Ga0466970_0297299
634 Ga0466970_0489578
635 Ga0466957_0120473
636 Ga0466957_0302218
637 Ga0466960_0095507
638 Ga0466959_0016024
639 Ga0466959_0019182
640 Ga0466959_0051993
641 Ga0466959_0068599
642 Ga0466959_0925379
643 Ga0466959_1100358
644 Ga0466958_0179740
645 Ga0466958_0203828
646 Ga0466958_0433679
647 Ga0466958_0960770
648 Ga0466967_0147198
649 Ga0466967_0380288
650 Ga0466967_1029401
651 Ga0466967_1604672
652 Ga0466967_1804766
653 Ga0466967_2582580
654 Ga0495582_0599125
655 Ga0495662_0513246
656 Ga0495594_0453275
657 Ga0495628_0406343
658 Ga0495630_0545485
659 Ga0495645_0707806
660 Ga0495635_0476730
661 Ga0495647_0491110
662 Ga0495658_1046238
663 Ga0495658_1099248
664 Ga0495674_1009741
665 Ga0495676_0153795
666 Ga0495686_0437313
667 Ga0496103_0549922
668 Ga0496104_0054975
669 Ga0496104_0146215
670 Ga0496104_1526362
671 Ga0496105_0166128
672 Ga0496106_0024891
673 Ga0496107_0775571
674 Ga0496108_0003809
675 Ga0496108_0084017
676 Ga0496109_0026250
677 Ga0496109_0156396
678 Ga0496110_0477319
679 Ga0496112_0031408
680 Ga0496113_0469943
681 Ga0496114_0440833
682 Ga0496115_1355235
683 Ga0496121_0494087
684 Ga0501308_011803
685 Ga0501304_017813
686 Ga0501314_046717
687 Ga0501032_0323463
688 Ga0501033_0224473
689 Ga0501034_0238806
690 Ga0501036_0072234
691 Ga0501039_1510911
692 Ga0501043_0000500
693 Ga0501043_0867368
694 Ga0501046_0000571
695 Ga0501046_0323780
696 Ga0501047_0000062
697 Ga0501047_0076823
698 Ga0501047_1303444
699 Ga0501048_0000388
700 Ga0501068_0171176
701 Ga0501070_0229136
702 Ga0501072_0588639
703 Ga0501074_0130575
704 Ga0501236_126906
705 Ga0501080_0013527
706 Ga0501080_0064470
707 Ga0501080_0627776
708 Ga0501083_0128082
709 Ga0501035_0053283
710 Ga0501044_0948446
711 Ga0501044_1119583
712 Ga0501044_1635427
713 Ga0501045_0005854
714 nmdc:mga0k408_290291_c1
715 nmdc:mga07m45_232152_c1
716 nmdc:mga07m45_76508_c1
717 nmdc:mga08y16_142903_c1
718 Ga0495601_0692790
719 Ga0495619_0101695
720 Ga0500578_0058160
721 Ga0500645_002062
722 Ga0501084_0169273
723 Ga0587066_227952
724 Ga0501082_1184529
725 Ga0466962_0003830
726 Ga0466962_0172935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

23

93

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h2w-assembly1.cif.gz_D crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp 0.9924 1 74
4h2x-assembly1.cif.gz_C crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate 0.9911 2 75
4h2x-assembly1.cif.gz_D crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and an analogue of glycyl adenylate 0.99 1 74
4h2y-assembly1.cif.gz_C crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and atp 0.9846 2 75
4h2y-assembly1.cif.gz_D crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and atp 0.9824 3 74
ID Description Score Start End Superfamily
4h2xD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.99 1 74 1.10.1200.10
4h2yD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9824 3 74 1.10.1200.10
4h2xD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9642 1 74 1.10.1200.10
4h2yD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9373 3 74 1.10.1200.10
2lkiA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8707 2 78 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A537W0P1-F1-model_v4 Acyl carrier protein 1.008 1 82
AF-A9CHM9-F1-model_v4 Aminoacyl carrier protein 1.006 1 80
AF-A0A838V4V2-F1-model_v4 Acyl carrier protein 1.005 1 75
AF-A0A2U2DRD8-F1-model_v4 Acyl carrier protein 1.004 1 80
AF-A0A494SSG1-F1-model_v4 Acyl carrier protein 1.004 2 77

Map