F422559

General Info

Members Datasets Scaffolds Average Seq Length
362 201 724 138

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100766625|Ga0097621_1007666252
Length 140
Sequence LGIEVLAHVNGALNFTLSILLTTGWVLIRRKRIRQHRRVMIAAIVVSALFFTSYIIYHANIGSKPFAGTGIARTIYFSILIPHVTLAALTLPFIVVTFLRGLRRDDARHRRFARKTMPVWLFVSVSGWIVYLMLYHWPAT

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
142 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
143 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
182 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 5.25
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 16.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100766625 3300006237 Bacteria 892
2 SwRhRL3b_contig_1526846 2162886006 Unclassified 851
3 Ga0065712_10108670 3300005290 Bacteria 1870
4 Ga0065715_10008964 3300005293 Bacteria 2840
5 Ga0065715_10118097 3300005293 Bacteria 2327
6 Ga0065715_10138345 3300005293 Bacteria 1883
7 Ga0065715_10714175 3300005293 Bacteria 646
8 Ga0065707_10097016 3300005295 Bacteria 3212
9 Ga0070676_10014627 3300005328 Bacteria 4317
10 Ga0070676_10040119 3300005328 Unclassified 2710
11 Ga0070690_100003409 3300005330 Bacteria 8691
12 Ga0070690_100286276 3300005330 Unclassified 1177
13 Ga0070670_100024093 3300005331 Bacteria 5236
14 Ga0070670_100741356 3300005331 Bacteria 885
15 Ga0068869_100089806 3300005334 Bacteria 2308
16 Ga0068869_100510685 3300005334 Bacteria 1005
17 Ga0070666_10184406 3300005335 Bacteria 1465
18 Ga0070666_10359271 3300005335 Bacteria 1043
19 Ga0068868_100280617 3300005338 Bacteria 1410
20 Ga0070687_100105159 3300005343 Bacteria 1588
21 Ga0070669_100001000 3300005353 Bacteria 20586
22 Ga0070675_100002898 3300005354 Bacteria 12924
23 Ga0070675_100052235 3300005354 Bacteria 3360
24 Ga0070675_100480701 3300005354 Bacteria 1117
25 Ga0070671_101066415 3300005355 Bacteria 709
26 Ga0070671_101140790 3300005355 Bacteria 685
27 Ga0070674_100081929 3300005356 Bacteria 2307
28 Ga0070674_100121986 3300005356 Bacteria 1930
29 Ga0070673_100030140 3300005364 Bacteria 4054
30 Ga0070673_101362219 3300005364 Bacteria 667
31 Ga0070688_100187708 3300005365 Bacteria 1438
32 Ga0070688_100295870 3300005365 Unclassified 1168
33 Ga0070659_100291459 3300005366 Unclassified 1359
34 Ga0070667_100356045 3300005367 Bacteria 1326
35 Ga0070667_100401146 3300005367 Bacteria 1248
36 Ga0070667_101237665 3300005367 Bacteria 699
37 Ga0070701_10558420 3300005438 Bacteria 752
38 Ga0070705_101657499 3300005440 Bacteria 539
39 Ga0070700_100071740 3300005441 Bacteria 2212
40 Ga0070708_100416423 3300005445 Unclassified 1267
41 Ga0070663_100016664 3300005455 Bacteria 4780
42 Ga0070663_100086733 3300005455 Bacteria 2312
43 Ga0070678_100253445 3300005456 Bacteria 1477
44 Ga0070678_100806434 3300005456 Bacteria 853
45 Ga0070662_100348807 3300005457 Unclassified 1212
46 Ga0070662_101423595 3300005457 Unclassified 597
47 Ga0070681_10216290 3300005458 Bacteria 1832
48 Ga0068867_100032865 3300005459 Bacteria 3753
49 Ga0068867_101644192 3300005459 Bacteria 601
50 Ga0068867_101915274 3300005459 Bacteria 559
51 Ga0070685_10956922 3300005466 Bacteria 640
52 Ga0070707_101030851 3300005468 Bacteria 788
53 Ga0070698_100190165 3300005471 Bacteria 1991
54 Ga0070699_100498380 3300005518 Bacteria 1106
55 Ga0070672_100011284 3300005543 Bacteria 6231
56 Ga0070672_100062995 3300005543 Bacteria 2928
57 Ga0070672_100155792 3300005543 Bacteria 1892
58 Ga0070672_100405619 3300005543 Unclassified 1169
59 Ga0070686_100517961 3300005544 Bacteria 928
60 Ga0070686_100598776 3300005544 Bacteria 868
61 Ga0070686_100815040 3300005544 Unclassified 753
62 Ga0070686_101704033 3300005544 Bacteria 535
63 Ga0070696_100178276 3300005546 Bacteria 1575
64 Ga0070664_100828857 3300005564 Bacteria 866
65 Ga0068857_100039583 3300005577 Bacteria 4176
66 Ga0068857_100069628 3300005577 Bacteria 3133
67 Ga0068854_100081624 3300005578 Bacteria 2388
68 Ga0068854_101644106 3300005578 Unclassified 586
69 Ga0070702_100072512 3300005615 Unclassified 2038
70 Ga0070702_100340074 3300005615 Bacteria 1053
71 Ga0068859_100042399 3300005617 Bacteria 4571
72 Ga0068864_100051119 3300005618 Bacteria 3559
73 Ga0068861_100016551 3300005719 Bacteria 5220
74 Ga0068861_100716553 3300005719 Bacteria 931
75 Ga0068861_101870315 3300005719 Unclassified 597
76 Ga0068870_10042215 3300005840 Bacteria 2374
77 Ga0068870_10784709 3300005840 Unclassified 664
78 Ga0068863_100813755 3300005841 Unclassified 932
79 Ga0068858_100046236 3300005842 Bacteria 4036
80 Ga0068858_100133975 3300005842 Unclassified 2324
81 Ga0068860_100080511 3300005843 Bacteria 3097
82 Ga0068860_100135598 3300005843 Bacteria 2364
83 Ga0068860_100453026 3300005843 Bacteria 1276
84 Ga0068860_100629023 3300005843 Bacteria 1080
85 Ga0068862_100132255 3300005844 Bacteria 2208
86 Ga0075368_10129541 3300006042 Bacteria 1048
87 Ga0075367_10079675 3300006178 Bacteria 1980
88 Ga0097621_100187146 3300006237 Bacteria 1791
89 Ga0097621_100739662 3300006237 Bacteria 908
90 Ga0097621_101245218 3300006237 Unclassified 702
91 Ga0068871_100564328 3300006358 Viruses 1032
92 Ga0068871_100680720 3300006358 Unclassified 941
93 Ga0075428_100002988 3300006844 Bacteria 18431
94 Ga0075428_100031346 3300006844 Bacteria 5878
95 Ga0075428_100203095 3300006844 Bacteria 2142
96 Ga0075428_100282828 3300006844 Bacteria 1785
97 Ga0075428_100886035 3300006844 Unclassified 947
98 Ga0075428_101037782 3300006844 Bacteria 867
99 Ga0075430_100022975 3300006846 Bacteria 5303
100 Ga0075430_100035150 3300006846 Bacteria 4253
101 Ga0075430_100052029 3300006846 Bacteria 3449
102 Ga0075431_100018520 3300006847 Bacteria 7093
103 Ga0075431_100091866 3300006847 Bacteria 3132
104 Ga0075431_100104719 3300006847 Bacteria 2919
105 Ga0075431_100614337 3300006847 Bacteria 1070
106 Ga0075431_101249304 3300006847 Unclassified 705
107 Ga0075431_101330908 3300006847 Bacteria 679
108 Ga0075433_10109290 3300006852 Bacteria 2453
109 Ga0075433_10137194 3300006852 Bacteria 2174
110 Ga0075433_10901745 3300006852 Bacteria 771
111 Ga0075434_100005896 3300006871 Bacteria 11200
112 Ga0075434_100373834 3300006871 Unclassified 1446
113 Ga0075434_101436609 3300006871 Bacteria 699
114 Ga0075429_100209664 3300006880 Bacteria 1707
115 Ga0075429_100414895 3300006880 Bacteria 1179
116 Ga0075429_101494196 3300006880 Bacteria 588
117 Ga0068865_100005014 3300006881 Bacteria 8010
118 Ga0068865_101185024 3300006881 Bacteria 676
119 Ga0097620_100042399 3300006931 Bacteria 4571
120 Ga0075435_100800880 3300007076 Unclassified 820
121 Ga0111539_10007904 3300009094 Bacteria 13569
122 Ga0111539_10075886 3300009094 Bacteria 3959
123 Ga0111539_10143734 3300009094 Bacteria 2792
124 Ga0111539_10692398 3300009094 Bacteria 1186
125 Ga0105245_11578277 3300009098 Bacteria 708
126 Ga0114129_10034283 3300009147 Bacteria 7169
127 Ga0114129_10035765 3300009147 Bacteria 7015
128 Ga0114129_10465302 3300009147 Unclassified 1657
129 Ga0114129_10485952 3300009147 Bacteria 1615
130 Ga0114129_11591170 3300009147 Bacteria 800
131 Ga0114129_12126445 3300009147 Bacteria 677
132 Ga0114129_12167872 3300009147 Unclassified 669
133 Ga0105243_10010908 3300009148 Bacteria 6874
134 Ga0105243_10272880 3300009148 Bacteria 1519
135 Ga0105241_11946964 3300009174 Unclassified 577
136 Ga0105242_10053501 3300009176 Bacteria 3297
137 Ga0105242_11707155 3300009176 Bacteria 666
138 Ga0105248_10056897 3300009177 Bacteria 4388
139 Ga0105248_11800401 3300009177 Unclassified 694
140 Ga0105238_10004828 3300009551 Bacteria 13339
141 Ga0105238_12228261 3300009551 Bacteria 583
142 Ga0105249_10002529 3300009553 Bacteria 15827
143 Ga0105249_10170043 3300009553 Bacteria 2113
144 Ga0105249_11554810 3300009553 Bacteria 734
145 Ga0105239_11066275 3300010375 Unclassified 930
146 Ga0105239_12546700 3300010375 Bacteria 596
147 Ga0105246_10056937 3300011119 Bacteria 2704
148 Ga0105246_10285328 3300011119 Bacteria 1326
149 Ga0105246_10383524 3300011119 Bacteria 1162
150 Ga0105246_10639676 3300011119 Bacteria 924
151 Ga0157378_11003339 3300013297 Unclassified 869
152 Ga0163162_12040667 3300013306 Bacteria 657
153 Ga0157375_10050116 3300013308 Unclassified 4095
154 Ga0157375_10803748 3300013308 Unclassified 1089
155 Ga0157375_11274527 3300013308 Bacteria 863
156 Ga0163163_10118271 3300014325 Bacteria 2682
157 Ga0163163_10734410 3300014325 Bacteria 1051
158 Ga0157380_10100552 3300014326 Bacteria 2408
159 Ga0157380_10141984 3300014326 Bacteria 2065
160 Ga0157380_10337411 3300014326 Bacteria 1404
161 Ga0157380_10349009 3300014326 Bacteria 1384
162 Ga0157380_10476429 3300014326 Bacteria 1206
163 Ga0157380_11800029 3300014326 Bacteria 672
164 Ga0157377_10039550 3300014745 Bacteria 2609
165 Ga0157379_10573004 3300014968 Bacteria 1052
166 Ga0157376_11982168 3300014969 Bacteria 620
167 Ga0207666_1027969 3300025271 Unclassified 854
168 Ga0207697_10000030 3300025315 Bacteria 51253
169 Ga0207682_10018991 3300025893 Bacteria 2690
170 Ga0207642_10065764 3300025899 Bacteria 1705
171 Ga0207642_10751109 3300025899 Bacteria 618
172 Ga0207688_10000192 3300025901 Bacteria 27058
173 Ga0207688_10517583 3300025901 Unclassified 748
174 Ga0207680_10296918 3300025903 Bacteria 1125
175 Ga0207680_10452314 3300025903 Bacteria 912
176 Ga0207645_10001344 3300025907 Bacteria 20211
177 Ga0207645_10246567 3300025907 Unclassified 1181
178 Ga0207645_10302132 3300025907 Bacteria 1066
179 Ga0207643_10058635 3300025908 Bacteria 2195
180 Ga0207643_10490167 3300025908 Bacteria 785
181 Ga0207662_10097749 3300025918 Bacteria 1815
182 Ga0207662_10128989 3300025918 Bacteria 1592
183 Ga0207657_10708411 3300025919 Bacteria 782
184 Ga0207681_10022308 3300025923 Bacteria 4037
185 Ga0207681_10066115 3300025923 Unclassified 2502
186 Ga0207694_10229877 3300025924 Bacteria 1514
187 Ga0207650_10042013 3300025925 Bacteria 3353
188 Ga0207650_10363638 3300025925 Bacteria 1192
189 Ga0207659_10006823 3300025926 Bacteria 7019
190 Ga0207659_10422903 3300025926 Unclassified 1118
191 Ga0207659_10523718 3300025926 Bacteria 1005
192 Ga0207659_10600072 3300025926 Bacteria 939
193 Ga0207644_10383022 3300025931 Bacteria 1147
194 Ga0207706_10797112 3300025933 Unclassified 803
195 Ga0207706_10872314 3300025933 Bacteria 761
196 Ga0207686_10040929 3300025934 Bacteria 2821
197 Ga0207686_11773602 3300025934 Unclassified 511
198 Ga0207709_10044541 3300025935 Bacteria 2682
199 Ga0207709_11078350 3300025935 Unclassified 659
200 Ga0207704_10003175 3300025938 Bacteria 7440
201 Ga0207704_11731237 3300025938 Bacteria 537
202 Ga0207691_10008637 3300025940 Bacteria 9777
203 Ga0207691_10064834 3300025940 Bacteria 3308
204 Ga0207691_10316790 3300025940 Unclassified 1338
205 Ga0207691_10599285 3300025940 Bacteria 933
206 Ga0207691_11642912 3300025940 Unclassified 521
207 Ga0207711_10042661 3300025941 Bacteria 3865
208 Ga0207689_10002798 3300025942 Bacteria 16109
209 Ga0207689_10123056 3300025942 Bacteria 2133
210 Ga0207651_10000940 3300025960 Bacteria 12838
211 Ga0207712_10113686 3300025961 Bacteria 2035
212 Ga0207712_10201496 3300025961 Bacteria 1579
213 Ga0207712_10793737 3300025961 Bacteria 832
214 Ga0207640_10093667 3300025981 Bacteria 2087
215 Ga0207640_10533161 3300025981 Bacteria 983
216 Ga0207658_10088962 3300025986 Bacteria 2389
217 Ga0207658_10112597 3300025986 Bacteria 2154
218 Ga0207677_10358163 3300026023 Bacteria 1225
219 Ga0207703_10010542 3300026035 Bacteria 7227
220 Ga0207703_10933400 3300026035 Bacteria 831
221 Ga0207678_10063544 3300026067 Bacteria 3172
222 Ga0207678_10463441 3300026067 Bacteria 1102
223 Ga0207708_10402398 3300026075 Bacteria 1132
224 Ga0207641_10439103 3300026088 Bacteria 1260
225 Ga0207648_10001228 3300026089 Bacteria 28750
226 Ga0207648_10757841 3300026089 Bacteria 902
227 Ga0207648_11372642 3300026089 Unclassified 664
228 Ga0207676_10012831 3300026095 Bacteria 6015
229 Ga0207674_10029694 3300026116 Bacteria 5754
230 Ga0207674_10050192 3300026116 Bacteria 4263
231 Ga0207675_100037791 3300026118 Bacteria 4503
232 Ga0207675_100219692 3300026118 Bacteria 1831
233 Ga0207675_100835646 3300026118 Bacteria 935
234 Ga0207675_101691419 3300026118 Bacteria 653
235 Ga0207683_10213277 3300026121 Bacteria 1758
236 Ga0209971_1009799 3300027682 Bacteria 2269
237 Ga0209971_1056104 3300027682 Bacteria 953
238 Ga0209998_10143872 3300027717 Unclassified 610
239 Ga0209974_10040817 3300027876 Unclassified 1545
240 Ga0207428_10018068 3300027907 Bacteria 6035
241 Ga0207428_10589907 3300027907 Bacteria 801
242 Ga0268265_10334967 3300028380 Bacteria 1376
243 Ga0268264_10037693 3300028381 Bacteria 3987
244 Ga0268264_10130408 3300028381 Bacteria 2227
245 Ga0268264_11399540 3300028381 Bacteria 710
246 Ga0307408_100452834 3300031548 Bacteria 1114
247 Ga0307405_10229545 3300031731 Unclassified 1367
248 Ga0307413_10357724 3300031824 Bacteria 1129
249 Ga0307413_11241786 3300031824 Unclassified 650
250 Ga0307410_10014962 3300031852 Bacteria 4586
251 Ga0307410_10923109 3300031852 Bacteria 749
252 Ga0307410_11091252 3300031852 Bacteria 692
253 Ga0307407_10017389 3300031903 Bacteria 3607
254 Ga0307407_11506035 3300031903 Unclassified 532
255 Ga0307412_10228130 3300031911 Unclassified 1432
256 Ga0307409_100278228 3300031995 Bacteria 1545
257 Ga0307416_100084919 3300032002 Bacteria 2692
258 Ga0307416_100500136 3300032002 Bacteria 1280
259 Ga0307414_10565887 3300032004 Bacteria 1015
260 Ga0307411_10111317 3300032005 Bacteria 1960
261 Ga0307411_10705408 3300032005 Bacteria 879
262 Ga0307415_100123584 3300032126 Bacteria 1946
263 Ga0373947_0970351 3300035725 Bacteria 580
264 Ga0439453_0016493 3300041408 Bacteria 1289
265 Ga0439453_0063066 3300041408 Unclassified 771
266 Ga0451843_0570956 3300041509 Bacteria 564
267 Ga0439431_0022876 3300041997 Bacteria 1509
268 Ga0439441_007898 3300042001 Bacteria 1727
269 Ga0439445_0010013 3300042004 Bacteria 2238
270 Ga0439449_0248908 3300042007 Bacteria 668
271 Ga0439450_026959 3300042008 Bacteria 1270
272 Ga0450921_005374 3300042123 Bacteria 967
273 Ga0450923_021172 3300042125 Bacteria 1266
274 Ga0450923_048636 3300042125 Bacteria 906
275 Ga0450898_151352 3300042134 Bacteria 508
276 Ga0439446_0041128 3300042156 Bacteria 1362
277 Ga0439435_0065747 3300042436 Bacteria 1065
278 Ga0450918_024008 3300042531 Bacteria 1066
279 Ga0439440_0162177 3300042993 Bacteria 646
280 Ga0451576_0266151 3300045051 Bacteria 1792
281 Ga0495603_0175031 3300046455 Bacteria 1242
282 Ga0495603_0291746 3300046455 Bacteria 937
283 Ga0495629_0022781 3300046459 Bacteria 4463
284 Ga0495638_0065553 3300046460 Unclassified 2235
285 Ga0495641_0459775 3300046461 Bacteria 579
286 Ga0495582_0252876 3300046473 Bacteria 1011
287 Ga0495594_0709581 3300046499 Bacteria 568
288 Ga0495621_0024127 3300046539 Bacteria 2029
289 Ga0495658_0114498 3300046683 Bacteria 1625
290 Ga0495670_0837665 3300046691 Bacteria 502
291 Ga0495589_0579899 3300046794 Bacteria 511
292 Ga0495676_1099372 3300047321 Bacteria 505
293 Ga0496100_0440103 3300048903 Bacteria 998
294 Ga0496100_0972365 3300048903 Bacteria 668
295 Ga0496102_0218588 3300048905 Bacteria 1796
296 Ga0496103_0076792 3300048906 Bacteria 2097
297 Ga0496104_0592198 3300048907 Bacteria 1019
298 Ga0496104_0753384 3300048907 Bacteria 881
299 Ga0496105_1033000 3300048908 Bacteria 613
300 Ga0496106_0660161 3300048909 Unclassified 835
301 Ga0496108_0100229 3300048911 Bacteria 2470
302 Ga0496108_0197360 3300048911 Bacteria 1746
303 Ga0496109_0077565 3300048912 Bacteria 3058
304 Ga0496109_0086113 3300048912 Bacteria 2902
305 Ga0496109_1096565 3300048912 Bacteria 733
306 Ga0496110_0016526 3300048913 Bacteria 6162
307 Ga0496110_0830062 3300048913 Bacteria 829
308 Ga0496111_0346351 3300048914 Bacteria 1100
309 Ga0496112_0030488 3300048915 Bacteria 5220
310 Ga0496113_0074891 3300048916 Bacteria 2582
311 Ga0496114_0802609 3300048917 Bacteria 820
312 Ga0501031_0124510 3300049568 Bacteria 1684
313 Ga0501036_0145536 3300049572 Bacteria 1999
314 Ga0501036_0401674 3300049572 Bacteria 1143
315 Ga0501040_0984557 3300049576 Bacteria 611
316 Ga0501072_0347899 3300049588 Bacteria 1177
317 Ga0501074_0542833 3300049590 Bacteria 823
318 Ga0501075_0009471 3300049591 Bacteria 6816
319 Ga0501076_0017948 3300049592 Bacteria 5383
320 Ga0501233_121454 3300049668 Bacteria 706
321 Ga0501246_031910 3300049676 Bacteria 596
322 Ga0501261_052263 3300049690 Bacteria 673
323 Ga0501081_0046456 3300049743 Bacteria 2985
324 nmdc:mga03683_115720_c1 3300050489 Bacteria 1189
325 nmdc:mga00v17_393757_c1 3300050491 Unclassified 900
326 nmdc:mga06z11_25556_c1 3300050494 Bacteria 2800
327 nmdc:mga05p37_3120_c1 3300050507 Bacteria 19261
328 nmdc:mga05p37_37862_c1 3300050507 Bacteria 5915
329 nmdc:mga05p37_87835_c1 3300050507 Bacteria 2403
330 nmdc:mga09592_125879_c1 3300050508 Bacteria 2202
331 nmdc:mga09592_232047_c1 3300050508 Bacteria 1599
332 nmdc:mga09592_295880_c1 3300050508 Bacteria 1403
333 nmdc:mga0qj67_102601_c1 3300050509 Bacteria 2307
334 nmdc:mga0qj67_1120481_c1 3300050509 Bacteria 614
335 nmdc:mga0qj67_128055_c1 3300050509 Unclassified 2055
336 nmdc:mga0qj67_35279_c2 3300050509 Bacteria 2647
337 nmdc:mga06r32_108024_c1 3300050510 Bacteria 2735
338 nmdc:mga06r32_1116479_c1 3300050510 Bacteria 737
339 nmdc:mga06r32_213686_c1 3300050510 Bacteria 1917
340 nmdc:mga06r32_307146_c1 3300050510 Bacteria 1572
341 nmdc:mga06r32_395137_c1 3300050510 Bacteria 1365
342 nmdc:mga06r32_483337_c1 3300050510 Bacteria 1216
343 nmdc:mga08y16_1220493_c1 3300050511 Unclassified 722
344 nmdc:mga08y16_1978774_c1 3300050511 Bacteria 532
345 nmdc:mga08y16_224273_c1 3300050511 Bacteria 1945
346 nmdc:mga08y16_328527_c1 3300050511 Unclassified 1574
347 nmdc:mga08y16_734375_c1 3300050511 Bacteria 984
348 nmdc:mga0n895_1788088_c1 3300050512 Unclassified 575
349 nmdc:mga0n895_3174_c1 3300050512 Bacteria 13132
350 nmdc:mga0n895_41923_c1 3300050512 Bacteria 3361
351 nmdc:mga0rr50_704544_c1 3300050513 Unclassified 862
352 nmdc:mga0a205_1086208_c1 3300050515 Bacteria 647
353 nmdc:mga0a205_156252_c1 3300050515 Bacteria 2179
354 nmdc:mga0a205_303649_c1 3300050515 Unclassified 1469
355 Ga0501084_0731311 3300054114 Bacteria 834
356 Ga0590071_012793 3300059421 Bacteria 1966
357 Ga0590074_013673 3300059423 Bacteria 1372
358 Ga0590075_000945 3300059424 Bacteria 7546
359 Ga0590077_026691 3300059426 Bacteria 1248
360 Ga0590077_047562 3300059426 Unclassified 960
361 Ga0501082_0140680 3300060353 Bacteria 2095
362 Ga0530510_0108110 3300061734 Bacteria 2036
363 Ga0097621_100766625
364 SwRhRL3b_contig_1526846
365 Ga0065712_10108670
366 Ga0065715_10008964
367 Ga0065715_10118097
368 Ga0065715_10138345
369 Ga0065715_10714175
370 Ga0065707_10097016
371 Ga0070676_10014627
372 Ga0070676_10040119
373 Ga0070690_100003409
374 Ga0070690_100286276
375 Ga0070670_100024093
376 Ga0070670_100741356
377 Ga0068869_100089806
378 Ga0068869_100510685
379 Ga0070666_10184406
380 Ga0070666_10359271
381 Ga0068868_100280617
382 Ga0070687_100105159
383 Ga0070669_100001000
384 Ga0070675_100002898
385 Ga0070675_100052235
386 Ga0070675_100480701
387 Ga0070671_101066415
388 Ga0070671_101140790
389 Ga0070674_100081929
390 Ga0070674_100121986
391 Ga0070673_100030140
392 Ga0070673_101362219
393 Ga0070688_100187708
394 Ga0070688_100295870
395 Ga0070659_100291459
396 Ga0070667_100356045
397 Ga0070667_100401146
398 Ga0070667_101237665
399 Ga0070701_10558420
400 Ga0070705_101657499
401 Ga0070700_100071740
402 Ga0070708_100416423
403 Ga0070663_100016664
404 Ga0070663_100086733
405 Ga0070678_100253445
406 Ga0070678_100806434
407 Ga0070662_100348807
408 Ga0070662_101423595
409 Ga0070681_10216290
410 Ga0068867_100032865
411 Ga0068867_101644192
412 Ga0068867_101915274
413 Ga0070685_10956922
414 Ga0070707_101030851
415 Ga0070698_100190165
416 Ga0070699_100498380
417 Ga0070672_100011284
418 Ga0070672_100062995
419 Ga0070672_100155792
420 Ga0070672_100405619
421 Ga0070686_100517961
422 Ga0070686_100598776
423 Ga0070686_100815040
424 Ga0070686_101704033
425 Ga0070696_100178276
426 Ga0070664_100828857
427 Ga0068857_100039583
428 Ga0068857_100069628
429 Ga0068854_100081624
430 Ga0068854_101644106
431 Ga0070702_100072512
432 Ga0070702_100340074
433 Ga0068859_100042399
434 Ga0068864_100051119
435 Ga0068861_100016551
436 Ga0068861_100716553
437 Ga0068861_101870315
438 Ga0068870_10042215
439 Ga0068870_10784709
440 Ga0068863_100813755
441 Ga0068858_100046236
442 Ga0068858_100133975
443 Ga0068860_100080511
444 Ga0068860_100135598
445 Ga0068860_100453026
446 Ga0068860_100629023
447 Ga0068862_100132255
448 Ga0075368_10129541
449 Ga0075367_10079675
450 Ga0097621_100187146
451 Ga0097621_100739662
452 Ga0097621_101245218
453 Ga0068871_100564328
454 Ga0068871_100680720
455 Ga0075428_100002988
456 Ga0075428_100031346
457 Ga0075428_100203095
458 Ga0075428_100282828
459 Ga0075428_100886035
460 Ga0075428_101037782
461 Ga0075430_100022975
462 Ga0075430_100035150
463 Ga0075430_100052029
464 Ga0075431_100018520
465 Ga0075431_100091866
466 Ga0075431_100104719
467 Ga0075431_100614337
468 Ga0075431_101249304
469 Ga0075431_101330908
470 Ga0075433_10109290
471 Ga0075433_10137194
472 Ga0075433_10901745
473 Ga0075434_100005896
474 Ga0075434_100373834
475 Ga0075434_101436609
476 Ga0075429_100209664
477 Ga0075429_100414895
478 Ga0075429_101494196
479 Ga0068865_100005014
480 Ga0068865_101185024
481 Ga0097620_100042399
482 Ga0075435_100800880
483 Ga0111539_10007904
484 Ga0111539_10075886
485 Ga0111539_10143734
486 Ga0111539_10692398
487 Ga0105245_11578277
488 Ga0114129_10034283
489 Ga0114129_10035765
490 Ga0114129_10465302
491 Ga0114129_10485952
492 Ga0114129_11591170
493 Ga0114129_12126445
494 Ga0114129_12167872
495 Ga0105243_10010908
496 Ga0105243_10272880
497 Ga0105241_11946964
498 Ga0105242_10053501
499 Ga0105242_11707155
500 Ga0105248_10056897
501 Ga0105248_11800401
502 Ga0105238_10004828
503 Ga0105238_12228261
504 Ga0105249_10002529
505 Ga0105249_10170043
506 Ga0105249_11554810
507 Ga0105239_11066275
508 Ga0105239_12546700
509 Ga0105246_10056937
510 Ga0105246_10285328
511 Ga0105246_10383524
512 Ga0105246_10639676
513 Ga0157378_11003339
514 Ga0163162_12040667
515 Ga0157375_10050116
516 Ga0157375_10803748
517 Ga0157375_11274527
518 Ga0163163_10118271
519 Ga0163163_10734410
520 Ga0157380_10100552
521 Ga0157380_10141984
522 Ga0157380_10337411
523 Ga0157380_10349009
524 Ga0157380_10476429
525 Ga0157380_11800029
526 Ga0157377_10039550
527 Ga0157379_10573004
528 Ga0157376_11982168
529 Ga0207666_1027969
530 Ga0207697_10000030
531 Ga0207682_10018991
532 Ga0207642_10065764
533 Ga0207642_10751109
534 Ga0207688_10000192
535 Ga0207688_10517583
536 Ga0207680_10296918
537 Ga0207680_10452314
538 Ga0207645_10001344
539 Ga0207645_10246567
540 Ga0207645_10302132
541 Ga0207643_10058635
542 Ga0207643_10490167
543 Ga0207662_10097749
544 Ga0207662_10128989
545 Ga0207657_10708411
546 Ga0207681_10022308
547 Ga0207681_10066115
548 Ga0207694_10229877
549 Ga0207650_10042013
550 Ga0207650_10363638
551 Ga0207659_10006823
552 Ga0207659_10422903
553 Ga0207659_10523718
554 Ga0207659_10600072
555 Ga0207644_10383022
556 Ga0207706_10797112
557 Ga0207706_10872314
558 Ga0207686_10040929
559 Ga0207686_11773602
560 Ga0207709_10044541
561 Ga0207709_11078350
562 Ga0207704_10003175
563 Ga0207704_11731237
564 Ga0207691_10008637
565 Ga0207691_10064834
566 Ga0207691_10316790
567 Ga0207691_10599285
568 Ga0207691_11642912
569 Ga0207711_10042661
570 Ga0207689_10002798
571 Ga0207689_10123056
572 Ga0207651_10000940
573 Ga0207712_10113686
574 Ga0207712_10201496
575 Ga0207712_10793737
576 Ga0207640_10093667
577 Ga0207640_10533161
578 Ga0207658_10088962
579 Ga0207658_10112597
580 Ga0207677_10358163
581 Ga0207703_10010542
582 Ga0207703_10933400
583 Ga0207678_10063544
584 Ga0207678_10463441
585 Ga0207708_10402398
586 Ga0207641_10439103
587 Ga0207648_10001228
588 Ga0207648_10757841
589 Ga0207648_11372642
590 Ga0207676_10012831
591 Ga0207674_10029694
592 Ga0207674_10050192
593 Ga0207675_100037791
594 Ga0207675_100219692
595 Ga0207675_100835646
596 Ga0207675_101691419
597 Ga0207683_10213277
598 Ga0209971_1009799
599 Ga0209971_1056104
600 Ga0209998_10143872
601 Ga0209974_10040817
602 Ga0207428_10018068
603 Ga0207428_10589907
604 Ga0268265_10334967
605 Ga0268264_10037693
606 Ga0268264_10130408
607 Ga0268264_11399540
608 Ga0307408_100452834
609 Ga0307405_10229545
610 Ga0307413_10357724
611 Ga0307413_11241786
612 Ga0307410_10014962
613 Ga0307410_10923109
614 Ga0307410_11091252
615 Ga0307407_10017389
616 Ga0307407_11506035
617 Ga0307412_10228130
618 Ga0307409_100278228
619 Ga0307416_100084919
620 Ga0307416_100500136
621 Ga0307414_10565887
622 Ga0307411_10111317
623 Ga0307411_10705408
624 Ga0307415_100123584
625 Ga0373947_0970351
626 Ga0439453_0016493
627 Ga0439453_0063066
628 Ga0451843_0570956
629 Ga0439431_0022876
630 Ga0439441_007898
631 Ga0439445_0010013
632 Ga0439449_0248908
633 Ga0439450_026959
634 Ga0450921_005374
635 Ga0450923_021172
636 Ga0450923_048636
637 Ga0450898_151352
638 Ga0439446_0041128
639 Ga0439435_0065747
640 Ga0450918_024008
641 Ga0439440_0162177
642 Ga0451576_0266151
643 Ga0495603_0175031
644 Ga0495603_0291746
645 Ga0495629_0022781
646 Ga0495638_0065553
647 Ga0495641_0459775
648 Ga0495582_0252876
649 Ga0495594_0709581
650 Ga0495621_0024127
651 Ga0495658_0114498
652 Ga0495670_0837665
653 Ga0495589_0579899
654 Ga0495676_1099372
655 Ga0496100_0440103
656 Ga0496100_0972365
657 Ga0496102_0218588
658 Ga0496103_0076792
659 Ga0496104_0592198
660 Ga0496104_0753384
661 Ga0496105_1033000
662 Ga0496106_0660161
663 Ga0496108_0100229
664 Ga0496108_0197360
665 Ga0496109_0077565
666 Ga0496109_0086113
667 Ga0496109_1096565
668 Ga0496110_0016526
669 Ga0496110_0830062
670 Ga0496111_0346351
671 Ga0496112_0030488
672 Ga0496113_0074891
673 Ga0496114_0802609
674 Ga0501031_0124510
675 Ga0501036_0145536
676 Ga0501036_0401674
677 Ga0501040_0984557
678 Ga0501072_0347899
679 Ga0501074_0542833
680 Ga0501075_0009471
681 Ga0501076_0017948
682 Ga0501233_121454
683 Ga0501246_031910
684 Ga0501261_052263
685 Ga0501081_0046456
686 nmdc:mga03683_115720_c1
687 nmdc:mga00v17_393757_c1
688 nmdc:mga06z11_25556_c1
689 nmdc:mga05p37_3120_c1
690 nmdc:mga05p37_37862_c1
691 nmdc:mga05p37_87835_c1
692 nmdc:mga09592_125879_c1
693 nmdc:mga09592_232047_c1
694 nmdc:mga09592_295880_c1
695 nmdc:mga0qj67_102601_c1
696 nmdc:mga0qj67_1120481_c1
697 nmdc:mga0qj67_128055_c1
698 nmdc:mga0qj67_35279_c2
699 nmdc:mga06r32_108024_c1
700 nmdc:mga06r32_1116479_c1
701 nmdc:mga06r32_213686_c1
702 nmdc:mga06r32_307146_c1
703 nmdc:mga06r32_395137_c1
704 nmdc:mga06r32_483337_c1
705 nmdc:mga08y16_1220493_c1
706 nmdc:mga08y16_1978774_c1
707 nmdc:mga08y16_224273_c1
708 nmdc:mga08y16_328527_c1
709 nmdc:mga08y16_734375_c1
710 nmdc:mga0n895_1788088_c1
711 nmdc:mga0n895_3174_c1
712 nmdc:mga0n895_41923_c1
713 nmdc:mga0rr50_704544_c1
714 nmdc:mga0a205_1086208_c1
715 nmdc:mga0a205_156252_c1
716 nmdc:mga0a205_303649_c1
717 Ga0501084_0731311
718 Ga0590071_012793
719 Ga0590074_013673
720 Ga0590075_000945
721 Ga0590077_026691
722 Ga0590077_047562
723 Ga0501082_0140680
724 Ga0530510_0108110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

6

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.725 4 131
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7092 2 131
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.6995 7 135
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.6979 5 135
8q1b-assembly1.cif.gz_c iii2-iv1 respiratory supercomplex from s. pombe 0.6974 1 135
ID Description Score Start End Superfamily
af_A0A5K1K958_64_247_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7227 6 135 1.20.120.80
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6976 4 132 1.20.120.1770
af_Q7HP05_85_278_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6919 6 135 1.20.120.80
af_A0A5K1K958_64_247_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6862 6 135 1.20.120.80
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6856 1 136 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A0R2XDP4-F1-model_v4 DUF420 domain-containing protein 0.9914 1 136 GO:0016020
AF-A0A523D1N7-F1-model_v4 DUF420 domain-containing protein 0.9903 1 137 GO:0016020
AF-A0A2V7BBQ5-F1-model_v4 DUF420 domain-containing protein 0.9894 2 137 GO:0016020
AF-A0A2E3I1W2-F1-model_v4 DUF420 domain-containing protein 0.9893 3 137 GO:0016020
AF-A0A353VAQ1-F1-model_v4 DUF420 domain-containing protein 0.9885 3 137 GO:0016020

Map