F421945

General Info

Members Datasets Scaffolds Average Seq Length
360 229 353 213

Family's Representative Sequence

Representative Sequence 3300042129|Ga0450891_006364|Ga0450891_006364_368_1078
Length 236
Sequence MRRAGRPASSRSLPESAQIMTTSLIQIRRILTHVEDIHHESGPPPGQPLRRGAIAAVLANPFAGRYEPDILPMMEQLQPVGVEMAGRLRAAMDVPAERIESYGKGAIIGAAGELEHGALWHVPGGYAMRELLGWKGDRKAYAQGQADAAKGQPGNALAIVPSTKKVGAAGCTLDVPLTHINAAYVRSHFDAMEVRVPGAPLADEIVFILVMSTGARVHARVGGLKAAEISRWDGLR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
5 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
6 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
151 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.94
Nodule 0.56
Rhizoplane 3.06
Rhizosphere 60.56
Stem 0
Stem Tuber 0
Unclassified 18.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1009532 3300002774 Bacteria 1841
2 JGI25159J45721_1000497 3300002987 Bacteria 18012
3 JGI25153J46596_10001000 3300003215 Bacteria 17177
4 rootH1_10055684 3300003316 Bacteria 2867
5 rootL2_10022546 3300003322 Bacteria 1657
6 JGI25160J50197_1000228 3300003354 Bacteria 44139
7 JGI25161J50226_1000171 3300003374 Bacteria 44139
8 Ga0055543_1001492 3300004625 Bacteria 9204
9 Ga0065165_1008858 3300005262 Bacteria 4620
10 Ga0065707_10126464 3300005295 Bacteria 2003
11 Ga0065707_10507267 3300005295 Bacteria 752
12 Ga0070670_100067427 3300005331 Bacteria 3070
13 Ga0068869_100040889 3300005334 Bacteria 3317
14 Ga0068868_100255493 3300005338 Bacteria 1476
15 Ga0070668_100035336 3300005347 Bacteria 3811
16 Ga0070669_100177880 3300005353 Bacteria 1662
17 Ga0070675_100021795 3300005354 Bacteria 5119
18 Ga0070671_100055325 3300005355 Bacteria 3301
19 Ga0070671_100078110 3300005355 Bacteria 2767
20 Ga0070671_100461813 3300005355 Bacteria 1090
21 Ga0070674_100722931 3300005356 Bacteria 853
22 Ga0070673_100072513 3300005364 Bacteria 2769
23 Ga0070659_100190186 3300005366 Bacteria 1687
24 Ga0070667_100009522 3300005367 Bacteria 8054
25 Ga0070700_100009539 3300005441 Bacteria 5336
26 Ga0070708_100140405 3300005445 Bacteria 2240
27 Ga0070708_100424516 3300005445 Bacteria 1254
28 Ga0070662_100093108 3300005457 Bacteria 2266
29 Ga0068867_100005799 3300005459 Bacteria 8762
30 Ga0068867_100095795 3300005459 Bacteria 2258
31 Ga0070706_100005279 3300005467 Bacteria 12318
32 Ga0070707_100511262 3300005468 Bacteria 1163
33 Ga0070698_100118715 3300005471 Bacteria 2606
34 Ga0070698_100600002 3300005471 Bacteria 1041
35 Ga0068853_100111399 3300005539 Bacteria 2432
36 Ga0070672_100029058 3300005543 Bacteria 4142
37 Ga0070672_100035679 3300005543 Bacteria 3781
38 Ga0068855_100531634 3300005563 Bacteria 1275
39 Ga0068857_100118714 3300005577 Bacteria 2380
40 Ga0068854_100070785 3300005578 Bacteria 2550
41 Ga0068856_100103891 3300005614 Bacteria 2834
42 Ga0068852_100291118 3300005616 Bacteria 1578
43 Ga0068859_100060940 3300005617 Bacteria 3802
44 Ga0068864_100596426 3300005618 Bacteria 1071
45 Ga0068866_10091245 3300005718 Bacteria 1660
46 Ga0068863_100343390 3300005841 Bacteria 1452
47 Ga0068863_100644287 3300005841 Bacteria 1050
48 Ga0068860_100000995 3300005843 Bacteria 31354
49 Ga0068860_100431615 3300005843 Bacteria 1307
50 Ga0068862_100128123 3300005844 Bacteria 2242
51 Ga0068862_100907435 3300005844 Bacteria 866
52 Ga0081455_10090322 3300005937 Bacteria 2484
53 Ga0075365_10127184 3300006038 Bacteria 1761
54 Ga0075363_100020904 3300006048 Bacteria 3288
55 Ga0075363_100113715 3300006048 Bacteria 1506
56 Ga0075432_10081914 3300006058 Bacteria 1171
57 Ga0075362_10029082 3300006177 Bacteria 2378
58 Ga0075367_10043091 3300006178 Bacteria 2643
59 Ga0075367_10325916 3300006178 Bacteria 968
60 Ga0075369_10008083 3300006186 Bacteria 4034
61 Ga0075369_10205025 3300006186 Bacteria 910
62 Ga0075366_10011581 3300006195 Bacteria 4982
63 Ga0075366_10019993 3300006195 Bacteria 3881
64 Ga0075366_10026925 3300006195 Bacteria 3370
65 Ga0075366_10043857 3300006195 Bacteria 2650
66 Ga0075366_10109104 3300006195 Bacteria 1664
67 Ga0075366_10113681 3300006195 Bacteria 1630
68 Ga0075370_10001269 3300006353 Bacteria 10753
69 Ga0075370_10010249 3300006353 Bacteria 4893
70 Ga0075370_10043137 3300006353 Bacteria 2549
71 Ga0075431_100032321 3300006847 Bacteria 5392
72 Ga0075434_101073195 3300006871 Bacteria 819
73 Ga0075429_100153834 3300006880 Bacteria 2014
74 Ga0068865_100019777 3300006881 Bacteria 4360
75 Ga0068865_100035742 3300006881 Bacteria 3345
76 Ga0068865_100083618 3300006881 Bacteria 2298
77 Ga0097620_100060937 3300006931 Bacteria 3802
78 Ga0105245_10588931 3300009098 Bacteria 1138
79 Ga0105247_10531018 3300009101 Bacteria 862
80 Ga0114129_10017885 3300009147 Bacteria 10091
81 Ga0114129_10051604 3300009147 Bacteria 5774
82 Ga0105243_10098560 3300009148 Bacteria 2421
83 Ga0105243_10381340 3300009148 Bacteria 1304
84 Ga0105243_10601193 3300009148 Bacteria 1059
85 Ga0105243_10613230 3300009148 Bacteria 1049
86 Ga0105237_10134440 3300009545 Bacteria 2467
87 Ga0105238_10462312 3300009551 Bacteria 1267
88 Ga0105238_10657454 3300009551 Bacteria 1058
89 Ga0105249_10116862 3300009553 Bacteria 2529
90 Ga0105239_10398951 3300010375 Bacteria 1556
91 Ga0157374_10671798 3300013296 Bacteria 1048
92 Ga0157378_10116453 3300013297 Bacteria 2457
93 Ga0157378_11003855 3300013297 Bacteria 869
94 Ga0163162_10005722 3300013306 Bacteria 12018
95 Ga0163162_10609054 3300013306 Bacteria 1218
96 Ga0157375_10014387 3300013308 Bacteria 7056
97 Ga0163163_11001425 3300014325 Bacteria 899
98 Ga0157380_10032105 3300014326 Bacteria 4036
99 Ga0182008_10221965 3300014497 Bacteria 967
100 Ga0157379_10057790 3300014968 Bacteria 3467
101 Ga0157376_10293701 3300014969 Bacteria 1535
102 Ga0163161_10091220 3300017792 Bacteria 2255
103 Ga0213872_10052175 3300021361 Bacteria 1855
104 Ga0207425_1017241 3300025245 Bacteria 1590
105 Ga0209130_1000440 3300025284 Bacteria 44209
106 Ga0209758_1000089 3300025297 Bacteria 251523
107 Ga0209050_1002543 3300025298 Bacteria 15245
108 Ga0207426_1000428 3300025302 Bacteria 68777
109 Ga0207682_10163781 3300025893 Bacteria 1009
110 Ga0207645_10018834 3300025907 Bacteria 4535
111 Ga0207645_10094174 3300025907 Bacteria 1928
112 Ga0207643_10115102 3300025908 Bacteria 1588
113 Ga0207684_10292625 3300025910 Bacteria 1404
114 Ga0207671_10305717 3300025914 Bacteria 1257
115 Ga0207681_10086067 3300025923 Bacteria 2232
116 Ga0207694_10489255 3300025924 Bacteria 1029
117 Ga0207650_10117049 3300025925 Bacteria 2070
118 Ga0207650_10613692 3300025925 Bacteria 915
119 Ga0207659_10028443 3300025926 Bacteria 3799
120 Ga0207687_10111731 3300025927 Bacteria 2029
121 Ga0207644_10123819 3300025931 Bacteria 1971
122 Ga0207644_10230252 3300025931 Bacteria 1472
123 Ga0207644_10232676 3300025931 Bacteria 1465
124 Ga0207690_10258614 3300025932 Bacteria 1348
125 Ga0207706_10027452 3300025933 Bacteria 5089
126 Ga0207686_10565981 3300025934 Bacteria 890
127 Ga0207709_10054839 3300025935 Bacteria 2460
128 Ga0207709_10231119 3300025935 Bacteria 1340
129 Ga0207709_10373676 3300025935 Bacteria 1083
130 Ga0207704_10000547 3300025938 Bacteria 16748
131 Ga0207704_10032218 3300025938 Bacteria 2964
132 Ga0207691_10046211 3300025940 Bacteria 4003
133 Ga0207691_10060400 3300025940 Bacteria 3444
134 Ga0207689_10020951 3300025942 Bacteria 5495
135 Ga0207689_10021325 3300025942 Bacteria 5447
136 Ga0207651_10017995 3300025960 Bacteria 4192
137 Ga0207712_10089790 3300025961 Bacteria 2259
138 Ga0207712_10206344 3300025961 Bacteria 1562
139 Ga0207668_10035340 3300025972 Bacteria 3326
140 Ga0207658_10354068 3300025986 Bacteria 1279
141 Ga0207658_10417066 3300025986 Bacteria 1183
142 Ga0207677_10131803 3300026023 Bacteria 1899
143 Ga0207703_10145720 3300026035 Bacteria 2059
144 Ga0207703_10247819 3300026035 Bacteria 1604
145 Ga0207708_10002518 3300026075 Bacteria 13474
146 Ga0207702_10055560 3300026078 Bacteria 3358
147 Ga0207641_10121034 3300026088 Bacteria 2336
148 Ga0207641_10153996 3300026088 Bacteria 2084
149 Ga0207641_10508877 3300026088 Bacteria 1170
150 Ga0207648_10005351 3300026089 Bacteria 12940
151 Ga0207648_10008777 3300026089 Bacteria 9739
152 Ga0207674_10108501 3300026116 Bacteria 2752
153 Ga0207674_10372480 3300026116 Bacteria 1380
154 Ga0207675_100005164 3300026118 Bacteria 12569
155 Ga0207698_10218449 3300026142 Bacteria 1720
156 Ga0209974_10058851 3300027876 Bacteria 1299
157 Ga0268265_10157462 3300028380 Bacteria 1924
158 Ga0268265_10430628 3300028380 Bacteria 1227
159 Ga0268265_10771353 3300028380 Bacteria 935
160 Ga0268264_10002908 3300028381 Bacteria 14883
161 Ga0268264_10155875 3300028381 Bacteria 2052
162 Ga0307517_10002655 3300028786 Bacteria 28561
163 Ga0307517_10072572 3300028786 Bacteria 3066
164 Ga0307517_10122551 3300028786 Bacteria 1914
165 Ga0307517_10131414 3300028786 Bacteria 1801
166 Ga0307517_10133734 3300028786 Bacteria 1773
167 Ga0307517_10257045 3300028786 Bacteria 1018
168 Ga0307515_10000011 3300028794 Bacteria 633903
169 Ga0307515_10000043 3300028794 Bacteria 304612
170 Ga0307515_10000665 3300028794 Bacteria 79372
171 Ga0307515_10000997 3300028794 Bacteria 64733
172 Ga0307515_10005007 3300028794 Bacteria 27028
173 Ga0307515_10005346 3300028794 Bacteria 26084
174 Ga0307515_10008674 3300028794 Bacteria 19781
175 Ga0307515_10087129 3300028794 Bacteria 3969
176 Ga0307515_10104042 3300028794 Bacteria 3397
177 Ga0307515_10119028 3300028794 Bacteria 3008
178 Ga0307515_10148546 3300028794 Bacteria 2465
179 Ga0307515_10214259 3300028794 Bacteria 1761
180 Ga0307515_10301779 3300028794 Bacteria 1285
181 Ga0307512_10012137 3300030522 Bacteria 8145
182 Ga0307512_10152205 3300030522 Bacteria 1380
183 Ga0307513_10000034 3300031456 Bacteria 185012
184 Ga0307513_10002789 3300031456 Bacteria 23982
185 Ga0307513_10009006 3300031456 Bacteria 12664
186 Ga0307513_10015133 3300031456 Bacteria 9365
187 Ga0307513_10029154 3300031456 Bacteria 6296
188 Ga0307513_10062826 3300031456 Bacteria 3923
189 Ga0307513_10070848 3300031456 Bacteria 3641
190 Ga0307513_10127486 3300031456 Bacteria 2497
191 Ga0307513_10183720 3300031456 Bacteria 1951
192 Ga0307513_10184632 3300031456 Bacteria 1944
193 Ga0307513_10275514 3300031456 Bacteria 1463
194 Ga0307509_10004612 3300031507 Bacteria 19754
195 Ga0307509_10005248 3300031507 Bacteria 18145
196 Ga0307509_10012825 3300031507 Bacteria 9976
197 Ga0307509_10088383 3300031507 Bacteria 3181
198 Ga0307509_10147440 3300031507 Bacteria 2275
199 Ga0307509_10264081 3300031507 Bacteria 1494
200 Ga0307508_10000004 3300031616 Bacteria 287547
201 Ga0307508_10000450 3300031616 Bacteria 49283
202 Ga0307508_10012836 3300031616 Bacteria 7659
203 Ga0307508_10108530 3300031616 Bacteria 2375
204 Ga0307514_10000694 3300031649 Bacteria 59136
205 Ga0307514_10008619 3300031649 Bacteria 8651
206 Ga0307514_10056450 3300031649 Bacteria 3014
207 Ga0307514_10136611 3300031649 Bacteria 1676
208 Ga0307516_10000244 3300031730 Bacteria 70125
209 Ga0307516_10000851 3300031730 Bacteria 41827
210 Ga0307516_10004352 3300031730 Bacteria 17513
211 Ga0307516_10016764 3300031730 Bacteria 7650
212 Ga0307516_10021101 3300031730 Bacteria 6715
213 Ga0307516_10182774 3300031730 Bacteria 1829
214 Ga0307516_10271153 3300031730 Bacteria 1383
215 Ga0307516_10481353 3300031730 Bacteria 896
216 Ga0307410_10761279 3300031852 Bacteria 821
217 Ga0307412_10854984 3300031911 Bacteria 794
218 Ga0307416_100226827 3300032002 Bacteria 1797
219 Ga0307507_10047573 3300033179 Bacteria 4186
220 Ga0307507_10076797 3300033179 Bacteria 2976
221 Ga0307510_10000109 3300033180 Bacteria 65353
222 Ga0307510_10010346 3300033180 Bacteria 11079
223 Ga0307510_10015813 3300033180 Bacteria 8918
224 Ga0307510_10130586 3300033180 Bacteria 2187
225 Ga0307510_10250825 3300033180 Bacteria 1258
226 Ga0373943_0299605 3300035170 Bacteria 913
227 Ga0373931_0025589 3300035691 Bacteria 2997
228 Ga0373925_0053609 3300037068 Bacteria 3016
229 Ga0373925_0777733 3300037068 Bacteria 789
230 Ga0395899_0000035 3300037312 Bacteria 295584
231 Ga0395899_0004125 3300037312 Bacteria 11431
232 Ga0395899_0117725 3300037312 Bacteria 1905
233 Ga0395900_0000113 3300037418 Bacteria 139979
234 Ga0395900_0235851 3300037418 Bacteria 1837
235 Ga0395900_0282733 3300037418 Bacteria 1650
236 Ga0395898_0000444 3300037466 Bacteria 85520
237 Ga0395898_0068739 3300037466 Bacteria 3427
238 Ga0395901_0006629 3300038443 Bacteria 11698
239 Ga0395901_0077928 3300038443 Bacteria 3459
240 Ga0436361_0169464 3300039447 Bacteria 5054
241 Ga0436361_0787274 3300039447 Bacteria 6567
242 Ga0439439_0054206 3300041406 Bacteria 1056
243 Ga0451793_0097171 3300041452 Bacteria 1085
244 Ga0451793_0299115 3300041452 Bacteria 1527
245 Ga0451798_0188138 3300041458 Bacteria 971
246 Ga0451798_0518902 3300041458 Bacteria 617
247 Ga0451800_1462287 3300041459 Bacteria 1211
248 Ga0451802_0703220 3300041460 Bacteria 1019
249 Ga0451807_1539224 3300041486 Bacteria 986
250 Ga0451807_2656589 3300041486 Bacteria 1515
251 Ga0439449_0003543 3300042007 Bacteria 6063
252 Ga0439455_0009099 3300042012 Bacteria 2147
253 Ga0439462_0002283 3300042015 Bacteria 4433
254 Ga0450890_029208 3300042127 Bacteria 778
255 Ga0450891_006364 3300042129 Bacteria 1088
256 Ga0439446_0090474 3300042156 Bacteria 958
257 Ga0450893_0006752 3300042532 Bacteria 1859
258 Ga0466969_0079635 3300044656 Bacteria 1565
259 Ga0466972_0072799 3300044658 Bacteria 1638
260 Ga0466965_0014791 3300044683 Bacteria 3696
261 Ga0466965_0057247 3300044683 Bacteria 1942
262 Ga0466966_0000092 3300044684 Bacteria 55643
263 Ga0466961_0000667 3300044693 Bacteria 21631
264 Ga0466963_0255849 3300044694 Bacteria 1229
265 Ga0453684_0191827 3300044712 Bacteria 2390
266 Ga0453684_0279065 3300044712 Bacteria 1906
267 Ga0453684_0448309 3300044712 Bacteria 1437
268 Ga0466971_0036620 3300044719 Bacteria 2200
269 Ga0466970_0005432 3300044765 Bacteria 6324
270 Ga0466960_0083867 3300044901 Bacteria 1611
271 Ga0466959_0004282 3300045049 Bacteria 9516
272 Ga0466959_0053211 3300045049 Bacteria 2960
273 Ga0466958_0006951 3300045836 Bacteria 6191
274 Ga0495617_065255 3300046452 Bacteria 1201
275 Ga0495592_0000160 3300046454 Bacteria 59404
276 Ga0495590_0015415 3300046457 Bacteria 2775
277 Ga0495629_0084777 3300046459 Bacteria 2211
278 Ga0495638_0224937 3300046460 Bacteria 1047
279 Ga0495650_0007081 3300046471 Bacteria 6813
280 Ga0495580_0261232 3300046472 Bacteria 1184
281 Ga0495582_0203705 3300046473 Bacteria 1130
282 Ga0495610_0084437 3300046512 Bacteria 1451
283 Ga0495620_0049880 3300046515 Bacteria 1788
284 Ga0495630_0094357 3300046517 Bacteria 2262
285 Ga0495632_0008995 3300046519 Bacteria 6060
286 Ga0495632_0113834 3300046519 Bacteria 1268
287 Ga0495643_0080829 3300046522 Bacteria 1691
288 Ga0495643_0231284 3300046522 Bacteria 871
289 Ga0495648_0137067 3300046524 Bacteria 1293
290 Ga0495663_0064978 3300046525 Bacteria 1153
291 Ga0495642_0102461 3300046528 Bacteria 1219
292 Ga0495654_0000114 3300046530 Bacteria 91751
293 Ga0495654_0000847 3300046530 Bacteria 23171
294 Ga0495597_0009596 3300046542 Bacteria 4772
295 Ga0495633_0125802 3300046558 Bacteria 1186
296 Ga0495611_0180423 3300046648 Bacteria 987
297 Ga0495611_0313226 3300046648 Bacteria 723
298 Ga0495625_0015391 3300046660 Bacteria 6061
299 Ga0495625_0016801 3300046660 Bacteria 5746
300 Ga0495588_0043495 3300046674 Bacteria 2299
301 Ga0495658_0042046 3300046683 Bacteria 2550
302 Ga0495669_0156899 3300046684 Bacteria 1079
303 Ga0495613_0438273 3300046689 Bacteria 887
304 Ga0495649_0011645 3300046694 Bacteria 5153
305 Ga0495636_0108085 3300047318 Bacteria 1222
306 Ga0495676_0033347 3300047321 Bacteria 4339
307 Ga0495687_004820 3300047443 Bacteria 8886
308 Ga0495687_022383 3300047443 Bacteria 3034
309 Ga0495685_078614 3300047447 Bacteria 1100
310 Ga0495686_0272992 3300047472 Bacteria 942
311 Ga0495626_0098739 3300048091 Bacteria 1275
312 Ga0496102_0118304 3300048905 Bacteria 2473
313 Ga0496106_0276472 3300048909 Bacteria 1345
314 Ga0496108_1029438 3300048911 Viruses 702
315 Ga0496121_0132058 3300048924 Bacteria 1867
316 Ga0496123_0119626 3300048926 Bacteria 1485
317 Ga0501257_053619 3300049686 Bacteria 1009
318 Ga0501081_0689474 3300049743 Bacteria 767
319 nmdc:mga03683_106456_c1 3300050489 Bacteria 1236
320 nmdc:mga03683_41144_c1 3300050489 Bacteria 1898
321 nmdc:mga00v17_86246_c1 3300050491 Bacteria 1967
322 nmdc:mga0k408_111194_c2 3300050493 Bacteria 952
323 nmdc:mga0k408_122045_c1 3300050493 Bacteria 1544
324 nmdc:mga0k408_137367_c1 3300050493 Bacteria 1453
325 nmdc:mga0k408_185209_c1 3300050493 Bacteria 1242
326 nmdc:mga0k408_21061_c1 3300050493 Bacteria 3659
327 nmdc:mga0k408_2566_c1 3300050493 Bacteria 9648
328 nmdc:mga0k408_9812_c1 3300050493 Bacteria 5171
329 nmdc:mga0k408_98207_c1 3300050493 Bacteria 1726
330 nmdc:mga06z11_13155_c1 3300050494 Bacteria 3624
331 nmdc:mga06z11_30637_c1 3300050494 Bacteria 2605
332 nmdc:mga07m45_3774_c1 3300050496 Bacteria 7328
333 nmdc:mga07m45_577_c1 3300050496 Bacteria 15597
334 nmdc:mga05p37_14669_c1 3300050507 Bacteria 9413
335 nmdc:mga06r32_87339_c1 3300050510 Bacteria 3043
336 nmdc:mga0sz30_158329_c1 3300050516 Bacteria 1003
337 nmdc:mga0sz30_3594_c1 3300050516 Bacteria 5590
338 Ga0500578_0212295 3300053086 Bacteria 1180
339 Ga0500644_0015700 3300053088 Bacteria 2166
340 Ga0500646_0039084 3300053090 Bacteria 1330
341 Ga0500583_0163860 3300053092 Bacteria 1107
342 Ga0500651_0066732 3300053093 Bacteria 2241
343 Ga0500641_0230246 3300053096 Bacteria 783
344 Ga0500594_0014014 3300053118 Bacteria 1914
345 Ga0500658_0038284 3300053134 Bacteria 1910
346 Ga0500559_0000864 3300053136 Bacteria 19467
347 Ga0500568_0013660 3300053139 Bacteria 3694
348 Ga0500590_057718 3300053148 Bacteria 1957
349 Ga0500616_0088426 3300053153 Bacteria 1540
350 Ga0500622_0013090 3300053156 Bacteria 4480
351 Ga0500634_0009583 3300053161 Bacteria 4912
352 Ga0500636_0184287 3300053177 Bacteria 1118
353 Ga0466962_0005890 3300061719 Bacteria 5889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0084777 Ga0495629_0084777_40_528 148
2 3300041458 Ga0451798_0518902 Ga0451798_0518902_15_563 165
3 3300041406 Ga0439439_0054206 Ga0439439_0054206_98_751 174
4 3300042007 Ga0439449_0003543 Ga0439449_0003543_4063_4716 174
5 3300042015 Ga0439462_0002283 Ga0439462_0002283_2676_3329 174
6 iso_pu_bacteria 8054558443 8054563674 176
7 3300046530 Ga0495654_0000114 Ga0495654_0000114_84005_84586 177
8 3300053096 Ga0500641_0230246 Ga0500641_0230246_169_750 177
9 3300005471 Ga0070698_100600002 Ga0070698_1006000022 178
10 3300006847 Ga0075431_100032321 Ga0075431_1000323213 178
11 3300006880 Ga0075429_100153834 Ga0075429_1001538343 178
12 3300009147 Ga0114129_10017885 Ga0114129_100178858 178
13 3300049743 Ga0501081_0689474 Ga0501081_0689474_130_714 178
14 3300050507 nmdc:mga05p37_14669_c1 nmdc:mga05p37_14669_c1_8051_8635 178
15 3300050510 nmdc:mga06r32_87339_c1 nmdc:mga06r32_87339_c1_931_1515 178
16 3300005468 Ga0070707_100511262 Ga0070707_1005112622 181
17 3300044712 Ga0453684_0448309 Ga0453684_0448309_647_1237 181
18 3300037312 Ga0395899_0000035 Ga0395899_0000035_47160_47750 182
19 3300037418 Ga0395900_0000113 Ga0395900_0000113_47160_47750 182
20 3300037466 Ga0395898_0000444 Ga0395898_0000444_43984_44574 182
21 3300039447 Ga0436361_0169464 Ga0436361_0169464_1602_2192 182
22 3300044656 Ga0466969_0079635 Ga0466969_0079635_672_1262 182
23 3300044684 Ga0466966_0000092 Ga0466966_0000092_40362_40952 182
24 3300044693 Ga0466961_0000667 Ga0466961_0000667_10058_10648 182
25 3300044694 Ga0466963_0255849 Ga0466963_0255849_84_674 182
26 3300044719 Ga0466971_0036620 Ga0466971_0036620_731_1321 182
27 3300045049 Ga0466959_0004282 Ga0466959_0004282_5880_6470 182
28 3300045836 Ga0466958_0006951 Ga0466958_0006951_2528_3118 182
29 3300053161 Ga0500634_0009583 Ga0500634_0009583_178_768 182
30 3300061719 Ga0466962_0005890 Ga0466962_0005890_1766_2356 182
31 3300053086 Ga0500578_0212295 Ga0500578_0212295_368_1090 186
32 3300009147 Ga0114129_10051604 Ga0114129_100516043 189
33 3300028794 Ga0307515_10000043 Ga0307515_1000004313 189
34 3300044658 Ga0466972_0072799 Ga0466972_0072799_853_1467 189
35 3300044683 Ga0466965_0014791 Ga0466965_0014791_547_1161 189
36 3300044683 Ga0466965_0057247 Ga0466965_0057247_894_1511 189
37 3300044901 Ga0466960_0083867 Ga0466960_0083867_73_687 189
38 3300048911 Ga0496108_1029438 Ga0496108_1029438_10_624 190
39 3300048905 Ga0496102_0118304 Ga0496102_0118304_305_934 191
40 3300028786 Ga0307517_10072572 Ga0307517_100725722 192
41 3300031730 Ga0307516_10000244 Ga0307516_100002449 192
42 3300031730 Ga0307516_10000851 Ga0307516_100008515 192
43 3300041460 Ga0451802_0703220 Ga0451802_0703220_95_718 192
44 3300041486 Ga0451807_2656589 Ga0451807_2656589_240_863 192
45 3300005445 Ga0070708_100140405 Ga0070708_1001404052 193
46 3300006195 Ga0075366_10011581 Ga0075366_100115813 193
47 3300025910 Ga0207684_10292625 Ga0207684_102926252 193
48 3300031507 Ga0307509_10147440 Ga0307509_101474403 193
49 3300050493 nmdc:mga0k408_9812_c1 nmdc:mga0k408_9812_c1_960_1631 193
50 iso_pu_bacteria 2585428062 2587755954 194
51 3300041452 Ga0451793_0097171 Ga0451793_0097171_189_833 195
52 3300044712 Ga0453684_0191827 Ga0453684_0191827_114_752 195
53 3300044712 Ga0453684_0279065 Ga0453684_0279065_316_954 195
54 3300044765 Ga0466970_0005432 Ga0466970_0005432_1751_2401 195
55 3300045049 Ga0466959_0053211 Ga0466959_0053211_1472_2122 195
56 iso_pu_bacteria 2511231002 2511243325 195
57 iso_pu_bacteria 2643221603 2644029501 195
58 iso_pu_bacteria 2643221654 2644305854 195
59 iso_pu_bacteria 2894023352 2894026758 195
60 3300005295 Ga0065707_10126464 Ga0065707_101264643 196
61 3300005295 Ga0065707_10507267 Ga0065707_105072671 196
62 3300005347 Ga0070668_100035336 Ga0070668_1000353363 196
63 3300005355 Ga0070671_100461813 Ga0070671_1004618132 196
64 3300005356 Ga0070674_100722931 Ga0070674_1007229311 196
65 3300005441 Ga0070700_100009539 Ga0070700_1000095394 196
66 3300005459 Ga0068867_100095795 Ga0068867_1000957953 196
67 3300005467 Ga0070706_100005279 Ga0070706_1000052795 196
68 3300005471 Ga0070698_100118715 Ga0070698_1001187151 196
69 3300005543 Ga0070672_100035679 Ga0070672_1000356794 196
70 3300005841 Ga0068863_100343390 Ga0068863_1003433902 196
71 3300005841 Ga0068863_100644287 Ga0068863_1006442871 196
72 3300005843 Ga0068860_100000995 Ga0068860_10000099514 196
73 3300005843 Ga0068860_100431615 Ga0068860_1004316152 196
74 3300005844 Ga0068862_100128123 Ga0068862_1001281232 196
75 3300005844 Ga0068862_100907435 Ga0068862_1009074352 196
76 3300005937 Ga0081455_10090322 Ga0081455_100903222 196
77 3300006178 Ga0075367_10325916 Ga0075367_103259162 196
78 3300006195 Ga0075366_10019993 Ga0075366_100199933 196
79 3300006871 Ga0075434_101073195 Ga0075434_1010731952 196
80 3300006881 Ga0068865_100019777 Ga0068865_1000197773 196
81 3300009101 Ga0105247_10531018 Ga0105247_105310181 196
82 3300009148 Ga0105243_10098560 Ga0105243_100985603 196
83 3300009148 Ga0105243_10601193 Ga0105243_106011932 196
84 3300009553 Ga0105249_10116862 Ga0105249_101168621 196
85 3300013297 Ga0157378_10116453 Ga0157378_101164533 196
86 3300013306 Ga0163162_10005722 Ga0163162_100057224 196
87 3300013308 Ga0157375_10014387 Ga0157375_100143872 196
88 3300014326 Ga0157380_10032105 Ga0157380_100321053 196
89 3300014968 Ga0157379_10057790 Ga0157379_100577903 196
90 3300017792 Ga0163161_10091220 Ga0163161_100912202 196
91 3300025923 Ga0207681_10086067 Ga0207681_100860672 196
92 3300025935 Ga0207709_10054839 Ga0207709_100548392 196
93 3300025938 Ga0207704_10000547 Ga0207704_1000054713 196
94 3300025940 Ga0207691_10046211 Ga0207691_100462112 196
95 3300025961 Ga0207712_10089790 Ga0207712_100897903 196
96 3300025972 Ga0207668_10035340 Ga0207668_100353403 196
97 3300026035 Ga0207703_10247819 Ga0207703_102478192 196
98 3300026075 Ga0207708_10002518 Ga0207708_100025184 196
99 3300026088 Ga0207641_10508877 Ga0207641_105088772 196
100 3300026089 Ga0207648_10008777 Ga0207648_100087773 196
101 3300026118 Ga0207675_100005164 Ga0207675_1000051642 196
102 3300028380 Ga0268265_10157462 Ga0268265_101574622 196
103 3300028380 Ga0268265_10430628 Ga0268265_104306282 196
104 3300028381 Ga0268264_10002908 Ga0268264_100029089 196
105 3300028381 Ga0268264_10155875 Ga0268264_101558753 196
106 3300005338 Ga0068868_100255493 Ga0068868_1002554932 197
107 3300005353 Ga0070669_100177880 Ga0070669_1001778802 197
108 3300005355 Ga0070671_100055325 Ga0070671_1000553254 197
109 3300005617 Ga0068859_100060940 Ga0068859_1000609402 197
110 3300005618 Ga0068864_100596426 Ga0068864_1005964262 197
111 3300006931 Ga0097620_100060937 Ga0097620_1000609372 197
112 3300009551 Ga0105238_10657454 Ga0105238_106574542 197
113 3300013306 Ga0163162_10609054 Ga0163162_106090542 197
114 3300014325 Ga0163163_11001425 Ga0163163_110014252 197
115 3300014497 Ga0182008_10221965 Ga0182008_102219651 197
116 3300025925 Ga0207650_10613692 Ga0207650_106136922 197
117 3300025927 Ga0207687_10111731 Ga0207687_101117312 197
118 3300025931 Ga0207644_10230252 Ga0207644_102302522 197
119 3300026023 Ga0207677_10131803 Ga0207677_101318032 197
120 3300026088 Ga0207641_10153996 Ga0207641_101539961 197
121 3300028794 Ga0307515_10104042 Ga0307515_101040422 197
122 3300031456 Ga0307513_10009006 Ga0307513_100090063 197
123 3300042127 Ga0450890_029208 Ga0450890_029208_111_758 197
124 3300042156 Ga0439446_0090474 Ga0439446_0090474_192_845 197
125 3300046660 Ga0495625_0016801 Ga0495625_0016801_2700_3356 197
126 3300005366 Ga0070659_100190186 Ga0070659_1001901862 198
127 3300005457 Ga0070662_100093108 Ga0070662_1000931082 198
128 3300005539 Ga0068853_100111399 Ga0068853_1001113993 198
129 3300005578 Ga0068854_100070785 Ga0068854_1000707852 198
130 3300005616 Ga0068852_100291118 Ga0068852_1002911182 198
131 3300006048 Ga0075363_100113715 Ga0075363_1001137152 198
132 3300006058 Ga0075432_10081914 Ga0075432_100819142 198
133 3300006177 Ga0075362_10029082 Ga0075362_100290823 198
134 3300006195 Ga0075366_10109104 Ga0075366_101091042 198
135 3300006353 Ga0075370_10043137 Ga0075370_100431372 198
136 3300009148 Ga0105243_10613230 Ga0105243_106132302 198
137 3300009545 Ga0105237_10134440 Ga0105237_101344403 198
138 3300010375 Ga0105239_10398951 Ga0105239_103989512 198
139 3300025908 Ga0207643_10115102 Ga0207643_101151023 198
140 3300025914 Ga0207671_10305717 Ga0207671_103057172 198
141 3300025931 Ga0207644_10232676 Ga0207644_102326762 198
142 3300025932 Ga0207690_10258614 Ga0207690_102586142 198
143 3300025933 Ga0207706_10027452 Ga0207706_100274523 198
144 3300025935 Ga0207709_10373676 Ga0207709_103736762 198
145 3300025942 Ga0207689_10020951 Ga0207689_100209515 198
146 3300025961 Ga0207712_10206344 Ga0207712_102063443 198
147 3300025986 Ga0207658_10354068 Ga0207658_103540682 198
148 3300026035 Ga0207703_10145720 Ga0207703_101457202 198
149 3300026142 Ga0207698_10218449 Ga0207698_102184492 198
150 3300028794 Ga0307515_10000665 Ga0307515_1000066538 198
151 3300028794 Ga0307515_10005007 Ga0307515_1000500715 198
152 3300028794 Ga0307515_10005346 Ga0307515_1000534617 198
153 3300030522 Ga0307512_10012137 Ga0307512_100121379 198
154 3300031456 Ga0307513_10015133 Ga0307513_100151339 198
155 3300031616 Ga0307508_10000004 Ga0307508_10000004167 198
156 3300031649 Ga0307514_10008619 Ga0307514_100086198 198
157 3300031730 Ga0307516_10004352 Ga0307516_1000435211 198
158 3300041452 Ga0451793_0299115 Ga0451793_0299115_307_948 198
159 3300041458 Ga0451798_0188138 Ga0451798_0188138_177_818 198
160 3300041459 Ga0451800_1462287 Ga0451800_1462287_289_930 198
161 3300046519 Ga0495632_0113834 Ga0495632_0113834_22_663 198
162 3300046522 Ga0495643_0231284 Ga0495643_0231284_198_839 198
163 3300046660 Ga0495625_0015391 Ga0495625_0015391_3806_4447 198
164 3300047472 Ga0495686_0272992 Ga0495686_0272992_278_919 198
165 3300050489 nmdc:mga03683_106456_c1 nmdc:mga03683_106456_c1_148_801 198
166 3300050489 nmdc:mga03683_41144_c1 nmdc:mga03683_41144_c1_1162_1827 198
167 3300050491 nmdc:mga00v17_86246_c1 nmdc:mga00v17_86246_c1_119_784 198
168 3300050493 nmdc:mga0k408_122045_c1 nmdc:mga0k408_122045_c1_142_807 198
169 3300050493 nmdc:mga0k408_137367_c1 nmdc:mga0k408_137367_c1_195_833 198
170 3300050494 nmdc:mga06z11_30637_c1 nmdc:mga06z11_30637_c1_661_1326 198
171 3300050496 nmdc:mga07m45_3774_c1 nmdc:mga07m45_3774_c1_1280_1945 198
172 3300050516 nmdc:mga0sz30_158329_c1 nmdc:mga0sz30_158329_c1_204_869 198
173 3300002774 JGI25150J39212_1009532 JGI25150J39212_10095323 199
174 3300002987 JGI25159J45721_1000497 JGI25159J45721_10004979 199
175 3300003215 JGI25153J46596_10001000 JGI25153J46596_1000100011 199
176 3300003316 rootH1_10055684 rootH1_100556842 199
177 3300003322 rootL2_10022546 rootL2_100225463 199
178 3300003354 JGI25160J50197_1000228 JGI25160J50197_10002288 199
179 3300003374 JGI25161J50226_1000171 JGI25161J50226_10001718 199
180 3300004625 Ga0055543_1001492 Ga0055543_10014923 199
181 3300005262 Ga0065165_1008858 Ga0065165_10088584 199
182 3300005331 Ga0070670_100067427 Ga0070670_1000674274 199
183 3300005334 Ga0068869_100040889 Ga0068869_1000408893 199
184 3300005354 Ga0070675_100021795 Ga0070675_1000217954 199
185 3300005355 Ga0070671_100078110 Ga0070671_1000781102 199
186 3300005364 Ga0070673_100072513 Ga0070673_1000725133 199
187 3300005367 Ga0070667_100009522 Ga0070667_1000095222 199
188 3300005445 Ga0070708_100424516 Ga0070708_1004245161 199
189 3300005459 Ga0068867_100005799 Ga0068867_1000057993 199
190 3300005543 Ga0070672_100029058 Ga0070672_1000290583 199
191 3300005563 Ga0068855_100531634 Ga0068855_1005316342 199
192 3300005577 Ga0068857_100118714 Ga0068857_1001187143 199
193 3300005614 Ga0068856_100103891 Ga0068856_1001038913 199
194 3300005718 Ga0068866_10091245 Ga0068866_100912452 199
195 3300006038 Ga0075365_10127184 Ga0075365_101271842 199
196 3300006048 Ga0075363_100020904 Ga0075363_1000209042 199
197 3300006178 Ga0075367_10043091 Ga0075367_100430913 199
198 3300006186 Ga0075369_10008083 Ga0075369_100080833 199
199 3300006186 Ga0075369_10205025 Ga0075369_102050252 199
200 3300006195 Ga0075366_10026925 Ga0075366_100269253 199
201 3300006195 Ga0075366_10043857 Ga0075366_100438573 199
202 3300006195 Ga0075366_10113681 Ga0075366_101136812 199
203 3300006353 Ga0075370_10001269 Ga0075370_1000126912 199
204 3300006353 Ga0075370_10010249 Ga0075370_100102495 199
205 3300006881 Ga0068865_100035742 Ga0068865_1000357424 199
206 3300006881 Ga0068865_100083618 Ga0068865_1000836183 199
207 3300009098 Ga0105245_10588931 Ga0105245_105889312 199
208 3300009148 Ga0105243_10381340 Ga0105243_103813402 199
209 3300009551 Ga0105238_10462312 Ga0105238_104623122 199
210 3300013296 Ga0157374_10671798 Ga0157374_106717981 199
211 3300013297 Ga0157378_11003855 Ga0157378_110038551 199
212 3300014969 Ga0157376_10293701 Ga0157376_102937012 199
213 3300021361 Ga0213872_10052175 Ga0213872_100521753 199
214 3300025245 Ga0207425_1017241 Ga0207425_10172412 199
215 3300025284 Ga0209130_1000440 Ga0209130_10004408 199
216 3300025297 Ga0209758_1000089 Ga0209758_10000898 199
217 3300025298 Ga0209050_1002543 Ga0209050_10025439 199
218 3300025302 Ga0207426_1000428 Ga0207426_10004288 199
219 3300025893 Ga0207682_10163781 Ga0207682_101637812 199
220 3300025907 Ga0207645_10018834 Ga0207645_100188343 199
221 3300025907 Ga0207645_10094174 Ga0207645_100941743 199
222 3300025924 Ga0207694_10489255 Ga0207694_104892552 199
223 3300025925 Ga0207650_10117049 Ga0207650_101170493 199
224 3300025926 Ga0207659_10028443 Ga0207659_100284433 199
225 3300025931 Ga0207644_10123819 Ga0207644_101238193 199
226 3300025934 Ga0207686_10565981 Ga0207686_105659812 199
227 3300025935 Ga0207709_10231119 Ga0207709_102311192 199
228 3300025938 Ga0207704_10032218 Ga0207704_100322183 199
229 3300025940 Ga0207691_10060400 Ga0207691_100604004 199
230 3300025942 Ga0207689_10021325 Ga0207689_100213254 199
231 3300025960 Ga0207651_10017995 Ga0207651_100179952 199
232 3300025986 Ga0207658_10417066 Ga0207658_104170662 199
233 3300026078 Ga0207702_10055560 Ga0207702_100555603 199
234 3300026088 Ga0207641_10121034 Ga0207641_101210342 199
235 3300026089 Ga0207648_10005351 Ga0207648_100053513 199
236 3300026116 Ga0207674_10108501 Ga0207674_101085012 199
237 3300026116 Ga0207674_10372480 Ga0207674_103724802 199
238 3300027876 Ga0209974_10058851 Ga0209974_100588512 199
239 3300028380 Ga0268265_10771353 Ga0268265_107713532 199
240 3300028786 Ga0307517_10002655 Ga0307517_1000265511 199
241 3300028786 Ga0307517_10122551 Ga0307517_101225512 199
242 3300028786 Ga0307517_10131414 Ga0307517_101314143 199
243 3300028786 Ga0307517_10133734 Ga0307517_101337342 199
244 3300028786 Ga0307517_10257045 Ga0307517_102570452 199
245 3300028794 Ga0307515_10000011 Ga0307515_10000011574 199
246 3300028794 Ga0307515_10000997 Ga0307515_1000099737 199
247 3300028794 Ga0307515_10008674 Ga0307515_1000867417 199
248 3300028794 Ga0307515_10087129 Ga0307515_100871292 199
249 3300028794 Ga0307515_10119028 Ga0307515_101190283 199
250 3300028794 Ga0307515_10148546 Ga0307515_101485463 199
251 3300028794 Ga0307515_10214259 Ga0307515_102142592 199
252 3300028794 Ga0307515_10301779 Ga0307515_103017792 199
253 3300030522 Ga0307512_10152205 Ga0307512_101522052 199
254 3300031456 Ga0307513_10000034 Ga0307513_10000034113 199
255 3300031456 Ga0307513_10002789 Ga0307513_1000278914 199
256 3300031456 Ga0307513_10029154 Ga0307513_100291544 199
257 3300031456 Ga0307513_10062826 Ga0307513_100628264 199
258 3300031456 Ga0307513_10070848 Ga0307513_100708483 199
259 3300031456 Ga0307513_10127486 Ga0307513_101274863 199
260 3300031456 Ga0307513_10183720 Ga0307513_101837202 199
261 3300031456 Ga0307513_10184632 Ga0307513_101846322 199
262 3300031456 Ga0307513_10275514 Ga0307513_102755141 199
263 3300031507 Ga0307509_10004612 Ga0307509_1000461215 199
264 3300031507 Ga0307509_10005248 Ga0307509_1000524811 199
265 3300031507 Ga0307509_10012825 Ga0307509_100128258 199
266 3300031507 Ga0307509_10088383 Ga0307509_100883833 199
267 3300031507 Ga0307509_10264081 Ga0307509_102640812 199
268 3300031616 Ga0307508_10000450 Ga0307508_1000045034 199
269 3300031616 Ga0307508_10012836 Ga0307508_100128369 199
270 3300031616 Ga0307508_10108530 Ga0307508_101085301 199
271 3300031649 Ga0307514_10000694 Ga0307514_1000069417 199
272 3300031649 Ga0307514_10056450 Ga0307514_100564503 199
273 3300031649 Ga0307514_10136611 Ga0307514_101366111 199
274 3300031730 Ga0307516_10016764 Ga0307516_100167643 199
275 3300031730 Ga0307516_10021101 Ga0307516_100211014 199
276 3300031730 Ga0307516_10182774 Ga0307516_101827742 199
277 3300031730 Ga0307516_10271153 Ga0307516_102711532 199
278 3300031730 Ga0307516_10481353 Ga0307516_104813531 199
279 3300031852 Ga0307410_10761279 Ga0307410_107612791 199
280 3300031911 Ga0307412_10854984 Ga0307412_108549842 199
281 3300032002 Ga0307416_100226827 Ga0307416_1002268273 199
282 3300033179 Ga0307507_10047573 Ga0307507_100475734 199
283 3300033179 Ga0307507_10076797 Ga0307507_100767973 199
284 3300033180 Ga0307510_10000109 Ga0307510_1000010949 199
285 3300033180 Ga0307510_10010346 Ga0307510_100103468 199
286 3300033180 Ga0307510_10015813 Ga0307510_100158139 199
287 3300033180 Ga0307510_10130586 Ga0307510_101305863 199
288 3300033180 Ga0307510_10250825 Ga0307510_102508252 199
289 3300035170 Ga0373943_0299605 Ga0373943_0299605_207_851 199
290 3300035691 Ga0373931_0025589 Ga0373931_0025589_1030_1674 199
291 3300037068 Ga0373925_0053609 Ga0373925_0053609_429_1079 199
292 3300037068 Ga0373925_0777733 Ga0373925_0777733_11_655 199
293 3300037312 Ga0395899_0004125 Ga0395899_0004125_5503_6144 199
294 3300037312 Ga0395899_0117725 Ga0395899_0117725_252_893 199
295 3300037418 Ga0395900_0235851 Ga0395900_0235851_746_1387 199
296 3300037418 Ga0395900_0282733 Ga0395900_0282733_471_1112 199
297 3300037466 Ga0395898_0068739 Ga0395898_0068739_38_679 199
298 3300038443 Ga0395901_0006629 Ga0395901_0006629_515_1156 199
299 3300038443 Ga0395901_0077928 Ga0395901_0077928_632_1273 199
300 3300039447 Ga0436361_0787274 Ga0436361_0787274_903_1544 199
301 3300041486 Ga0451807_1539224 Ga0451807_1539224_201_875 199
302 3300042012 Ga0439455_0009099 Ga0439455_0009099_1482_2123 199
303 3300042129 Ga0450891_006364 Ga0450891_006364_368_1078 199
304 3300042532 Ga0450893_0006752 Ga0450893_0006752_993_1667 199
305 3300046452 Ga0495617_065255 Ga0495617_065255_76_744 199
306 3300046454 Ga0495592_0000160 Ga0495592_0000160_53760_54416 199
307 3300046457 Ga0495590_0015415 Ga0495590_0015415_495_1139 199
308 3300046460 Ga0495638_0224937 Ga0495638_0224937_110_754 199
309 3300046471 Ga0495650_0007081 Ga0495650_0007081_4939_5592 199
310 3300046472 Ga0495580_0261232 Ga0495580_0261232_47_688 199
311 3300046473 Ga0495582_0203705 Ga0495582_0203705_104_748 199
312 3300046512 Ga0495610_0084437 Ga0495610_0084437_459_1115 199
313 3300046515 Ga0495620_0049880 Ga0495620_0049880_789_1445 199
314 3300046517 Ga0495630_0094357 Ga0495630_0094357_1248_1892 199
315 3300046519 Ga0495632_0008995 Ga0495632_0008995_2791_3435 199
316 3300046522 Ga0495643_0080829 Ga0495643_0080829_734_1378 199
317 3300046524 Ga0495648_0137067 Ga0495648_0137067_134_778 199
318 3300046525 Ga0495663_0064978 Ga0495663_0064978_321_977 199
319 3300046528 Ga0495642_0102461 Ga0495642_0102461_492_1136 199
320 3300046530 Ga0495654_0000847 Ga0495654_0000847_21362_22003 199
321 3300046542 Ga0495597_0009596 Ga0495597_0009596_577_1221 199
322 3300046558 Ga0495633_0125802 Ga0495633_0125802_317_973 199
323 3300046648 Ga0495611_0180423 Ga0495611_0180423_163_807 199
324 3300046648 Ga0495611_0313226 Ga0495611_0313226_39_713 199
325 3300046674 Ga0495588_0043495 Ga0495588_0043495_745_1398 199
326 3300046683 Ga0495658_0042046 Ga0495658_0042046_689_1339 199
327 3300046684 Ga0495669_0156899 Ga0495669_0156899_251_907 199
328 3300046689 Ga0495613_0438273 Ga0495613_0438273_203_847 199
329 3300046694 Ga0495649_0011645 Ga0495649_0011645_1891_2535 199
330 3300047318 Ga0495636_0108085 Ga0495636_0108085_167_823 199
331 3300047321 Ga0495676_0033347 Ga0495676_0033347_2805_3449 199
332 3300047443 Ga0495687_004820 Ga0495687_004820_5313_5957 199
333 3300047443 Ga0495687_022383 Ga0495687_022383_2111_2755 199
334 3300047447 Ga0495685_078614 Ga0495685_078614_76_729 199
335 3300048091 Ga0495626_0098739 Ga0495626_0098739_248_892 199
336 3300048909 Ga0496106_0276472 Ga0496106_0276472_43_702 199
337 3300048924 Ga0496121_0132058 Ga0496121_0132058_394_1083 199
338 3300048926 Ga0496123_0119626 Ga0496123_0119626_609_1250 199
339 3300049686 Ga0501257_053619 Ga0501257_053619_196_852 199
340 3300050493 nmdc:mga0k408_111194_c2 nmdc:mga0k408_111194_c2_97_762 199
341 3300050493 nmdc:mga0k408_185209_c1 nmdc:mga0k408_185209_c1_20_676 199
342 3300050493 nmdc:mga0k408_21061_c1 nmdc:mga0k408_21061_c1_1110_1766 199
343 3300050493 nmdc:mga0k408_2566_c1 nmdc:mga0k408_2566_c1_1412_2056 199
344 3300050493 nmdc:mga0k408_98207_c1 nmdc:mga0k408_98207_c1_1007_1663 199
345 3300050494 nmdc:mga06z11_13155_c1 nmdc:mga06z11_13155_c1_1101_1757 199
346 3300050496 nmdc:mga07m45_577_c1 nmdc:mga07m45_577_c1_4021_4665 199
347 3300050516 nmdc:mga0sz30_3594_c1 nmdc:mga0sz30_3594_c1_1133_1789 199
348 3300053088 Ga0500644_0015700 Ga0500644_0015700_1097_1747 199
349 3300053090 Ga0500646_0039084 Ga0500646_0039084_545_1186 199
350 3300053092 Ga0500583_0163860 Ga0500583_0163860_73_717 199
351 3300053093 Ga0500651_0066732 Ga0500651_0066732_1058_1714 199
352 3300053118 Ga0500594_0014014 Ga0500594_0014014_1152_1808 199
353 3300053134 Ga0500658_0038284 Ga0500658_0038284_788_1432 199
354 3300053136 Ga0500559_0000864 Ga0500559_0000864_16905_17561 199
355 3300053139 Ga0500568_0013660 Ga0500568_0013660_1083_1757 199
356 3300053148 Ga0500590_057718 Ga0500590_057718_1160_1822 199
357 3300053153 Ga0500616_0088426 Ga0500616_0088426_167_817 199
358 3300053156 Ga0500622_0013090 Ga0500622_0013090_1896_2552 199
359 3300053177 Ga0500636_0184287 Ga0500636_0184287_95_751 199
360 iso_pu_bacteria 2919704043 2919705875 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06684

AA_synth

Amino acid synthesis

27

222

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.7492 3 174
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.735 3 174
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.7305 1 198
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.7202 1 198
4rh8-assembly3.cif.gz_C crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form 0.7076 2 35
ID Description Score Start End Superfamily
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.7448 3 174 3.30.1330.110
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.7303 3 174 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.7151 2 198 3.30.1330.110
4rh8C00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.7076 2 35 3.30.160.150
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.7046 2 198 3.30.1330.110
ID Description Score Start End GO Terms
AF-A0A519EKT1-F1-model_v4 Amino acid synthesis family protein 0.938 1 72
AF-A0A3D5GQ63-F1-model_v4 Amino acid synthesis family protein 0.9238 2 86
AF-A0A1D2SE76-F1-model_v4 Uncharacterized protein 0.9204 1 68
AF-A0A4Q3H5K7-F1-model_v4 deleted 0.9199 2 110
AF-A0A440UUX6-F1-model_v4 Amino acid synthesis family protein 0.9191 2 93

Feature Viewer

pLDDT pTM Quality
73.56 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map