F420758

General Info

Members Datasets Scaffolds Average Seq Length
357 218 353 324

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000045|Ga0070699_10000004518
Length 378
Sequence LQNAVGENQSTIHAWVMRSLQCNGGRARPRALDSRVQRKYNRPFNCEDRAFAAAFIDTRMKRILITGGAGFIGSHLVDRLLDGGDARVTVVDNFSDFYDPAVKRANIRSHLERNNFELVQADITDSWAIEHLFSRSKFDCVVHLAARAGVRPSLEDPLAYEITNVRGTFNLLEAARRNEVPRFVFGSSSSVYGVNSKVPFSEDDPVASPISPYAVTKIAGEAACHAYSHLYGLRIVCLRLFTVYGARQRPDLAIHKFARLISKGLPIPMFGDGTTRRDYTYIDDIVAGLLAAMKYNRTQFEVINLGESRTVELRRLVELIEQALGKRAIIDHQPQQPGDVPVTFADVNKARRLLGYEPATQIEDGIERFVEWFNRQPA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
3 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
4 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
204 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
205 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0
Rhizoplane 1.12
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6586487 2162886012 Bacteria 1045
2 JGI25406J46586_10001120 3300003203 Bacteria 12551
3 Ga0055541_1012409 3300003841 Unclassified 1223
4 Ga0065704_10085044 3300005289 Bacteria 3268
5 Ga0065704_10094803 3300005289 Bacteria 2523
6 Ga0065704_10126843 3300005289 Bacteria 1684
7 Ga0070658_10009053 3300005327 Bacteria 8008
8 Ga0070676_10049451 3300005328 Bacteria 2461
9 Ga0070676_10184295 3300005328 Bacteria 1359
10 Ga0070683_100013813 3300005329 Bacteria 7051
11 Ga0068869_100286698 3300005334 Bacteria 1326
12 Ga0070680_100104039 3300005336 Bacteria 2359
13 Ga0070682_100000466 3300005337 Bacteria 25458
14 Ga0068868_100101915 3300005338 Bacteria 2324
15 Ga0068868_100199044 3300005338 Unclassified 1669
16 Ga0070689_100032809 3300005340 Bacteria 3952
17 Ga0070689_100042044 3300005340 Bacteria 3509
18 Ga0070691_10094733 3300005341 Bacteria 1476
19 Ga0070687_100083315 3300005343 Bacteria 1751
20 Ga0070692_10032581 3300005345 Bacteria 2621
21 Ga0070675_100052642 3300005354 Unclassified 3347
22 Ga0070675_100403047 3300005354 Bacteria 1220
23 Ga0070671_100088281 3300005355 Bacteria 2595
24 Ga0070671_100121276 3300005355 Bacteria 2200
25 Ga0070671_100180555 3300005355 Bacteria 1786
26 Ga0070673_100070288 3300005364 Bacteria 2809
27 Ga0070673_100308251 3300005364 Bacteria 1396
28 Ga0070688_100036641 3300005365 Unclassified 2985
29 Ga0070703_10000360 3300005406 Bacteria 19664
30 Ga0070709_10000006 3300005434 Bacteria 186534
31 Ga0070709_10136654 3300005434 Bacteria 1679
32 Ga0070714_100185468 3300005435 Bacteria 1895
33 Ga0070711_100000013 3300005439 Bacteria 161148
34 Ga0070705_100000113 3300005440 Bacteria 46060
35 Ga0070705_100199269 3300005440 Bacteria 1371
36 Ga0070700_100147294 3300005441 Bacteria 1606
37 Ga0070700_100245234 3300005441 Bacteria 1282
38 Ga0070694_100015685 3300005444 Bacteria 4763
39 Ga0070694_100063517 3300005444 Bacteria 2525
40 Ga0070708_100000103 3300005445 Bacteria 56127
41 Ga0070708_100012650 3300005445 Bacteria 6892
42 Ga0070663_100080891 3300005455 Bacteria 2387
43 Ga0070678_100173952 3300005456 Unclassified 1756
44 Ga0070681_10006732 3300005458 Bacteria 11183
45 Ga0070685_10187069 3300005466 Unclassified 1337
46 Ga0070706_100000570 3300005467 Bacteria 43048
47 Ga0070706_100001771 3300005467 Bacteria 22361
48 Ga0070706_100214397 3300005467 Bacteria 1797
49 Ga0070707_100027845 3300005468 Bacteria 5376
50 Ga0070699_100000045 3300005518 Bacteria 125943
51 Ga0070699_100001144 3300005518 Bacteria 24667
52 Ga0070699_100158762 3300005518 Bacteria 2001
53 Ga0070679_100164096 3300005530 Bacteria 2195
54 Ga0070684_100224849 3300005535 Bacteria 1713
55 Ga0068853_100000079 3300005539 Bacteria 66544
56 Ga0068853_100007263 3300005539 Bacteria 8872
57 Ga0068853_100116655 3300005539 Unclassified 2377
58 Ga0068853_100319124 3300005539 Bacteria 1440
59 Ga0070672_100084278 3300005543 Bacteria 2552
60 Ga0070672_100170836 3300005543 Bacteria 1808
61 Ga0070686_100068741 3300005544 Bacteria 2311
62 Ga0070696_100000014 3300005546 Bacteria 77159
63 Ga0070696_100001961 3300005546 Bacteria 13533
64 Ga0070696_100041801 3300005546 Bacteria 3168
65 Ga0070693_100002572 3300005547 Bacteria 8364
66 Ga0070704_100008577 3300005549 Bacteria 6139
67 Ga0070704_100034284 3300005549 Bacteria 3440
68 Ga0070664_100045791 3300005564 Unclassified 3694
69 Ga0070664_100132324 3300005564 Bacteria 2191
70 Ga0068857_100055791 3300005577 Unclassified 3506
71 Ga0068859_100009778 3300005617 Bacteria 9687
72 Ga0068859_100033561 3300005617 Bacteria 5154
73 Ga0068859_100068223 3300005617 Bacteria 3591
74 Ga0068859_100542145 3300005617 Unclassified 1258
75 Ga0068864_100120394 3300005618 Unclassified 2347
76 Ga0068864_100277199 3300005618 Bacteria 1564
77 Ga0068861_100069805 3300005719 Bacteria 2719
78 Ga0068861_100170116 3300005719 Unclassified 1805
79 Ga0068870_10010234 3300005840 Unclassified 4299
80 Ga0068870_10056418 3300005840 Bacteria 2096
81 Ga0068863_100054751 3300005841 Unclassified 3779
82 Ga0068858_100140103 3300005842 Unclassified 2270
83 Ga0068860_100015886 3300005843 Bacteria 7347
84 Ga0070717_10069324 3300006028 Bacteria 2937
85 Ga0070717_10091174 3300006028 Bacteria 2573
86 Ga0070717_10234756 3300006028 Bacteria 1615
87 Ga0097621_100065163 3300006237 Bacteria 2997
88 Ga0097621_100106577 3300006237 Bacteria 2364
89 Ga0068871_100150210 3300006358 Bacteria 1986
90 Ga0068871_100224491 3300006358 Bacteria 1629
91 Ga0075428_100034515 3300006844 Bacteria 5579
92 Ga0075430_100062150 3300006846 Bacteria 3137
93 Ga0075430_100068442 3300006846 Bacteria 2978
94 Ga0075431_100170930 3300006847 Bacteria 2233
95 Ga0075433_10037566 3300006852 Bacteria 4179
96 Ga0075433_10222236 3300006852 Bacteria 1677
97 Ga0075434_100162782 3300006871 Bacteria 2251
98 Ga0075429_100032313 3300006880 Bacteria 4549
99 Ga0075429_100056523 3300006880 Bacteria 3416
100 Ga0068865_100060458 3300006881 Bacteria 2653
101 Ga0075436_100000869 3300006914 Bacteria 20079
102 Ga0075436_100041855 3300006914 Unclassified 3160
103 Ga0075436_100068962 3300006914 Bacteria 2443
104 Ga0097620_100009777 3300006931 Bacteria 9687
105 Ga0097620_100033561 3300006931 Bacteria 5154
106 Ga0097620_100068221 3300006931 Bacteria 3591
107 Ga0097620_100542109 3300006931 Unclassified 1258
108 Ga0075435_100468716 3300007076 Unclassified 1087
109 Ga0105240_10054126 3300009093 Bacteria 5031
110 Ga0105240_10189278 3300009093 Bacteria 2421
111 Ga0111539_10059105 3300009094 Bacteria 4547
112 Ga0111539_10125700 3300009094 Bacteria 3005
113 Ga0111539_10312743 3300009094 Unclassified 1828
114 Ga0111539_10564703 3300009094 Unclassified 1325
115 Ga0105245_10001633 3300009098 Bacteria 20408
116 Ga0105245_10104387 3300009098 Bacteria 2627
117 Ga0114129_10013102 3300009147 Bacteria 11810
118 Ga0114129_10032891 3300009147 Bacteria 7328
119 Ga0114129_10074985 3300009147 Bacteria 4710
120 Ga0114129_10076419 3300009147 Bacteria 4662
121 Ga0114129_10099522 3300009147 Unclassified 4024
122 Ga0114129_10465292 3300009147 Bacteria 1657
123 Ga0114129_10832344 3300009147 Bacteria 1175
124 Ga0105241_10039091 3300009174 Bacteria 3578
125 Ga0105238_10049741 3300009551 Bacteria 4221
126 Ga0105238_10078645 3300009551 Bacteria 3288
127 Ga0105249_10090715 3300009553 Unclassified 2857
128 Ga0105249_10152721 3300009553 Unclassified 2224
129 Ga0105249_10287613 3300009553 Bacteria 1644
130 Ga0105239_10030156 3300010375 Bacteria 5963
131 Ga0105246_10075600 3300011119 Bacteria 2385
132 Ga0157373_10028701 3300013100 Bacteria 4013
133 Ga0157373_10044581 3300013100 Unclassified 3166
134 Ga0157373_10060926 3300013100 Bacteria 2673
135 Ga0157369_10032425 3300013105 Bacteria 5746
136 Ga0157369_10033177 3300013105 Bacteria 5676
137 Ga0157374_10000818 3300013296 Bacteria 27312
138 Ga0157378_10080414 3300013297 Bacteria 2944
139 Ga0157378_10091427 3300013297 Bacteria 2767
140 Ga0163162_10056295 3300013306 Bacteria 3961
141 Ga0163162_10376465 3300013306 Bacteria 1553
142 Ga0157372_10040055 3300013307 Bacteria 5174
143 Ga0157372_10065712 3300013307 Unclassified 4074
144 Ga0157372_10118783 3300013307 Bacteria 3034
145 Ga0157375_10184060 3300013308 Bacteria 2241
146 Ga0157375_10342482 3300013308 Bacteria 1660
147 Ga0163163_10052805 3300014325 Bacteria 4011
148 Ga0163163_10186675 3300014325 Bacteria 2121
149 Ga0157380_10013382 3300014326 Bacteria 5979
150 Ga0157380_10013975 3300014326 Bacteria 5863
151 Ga0157380_10025882 3300014326 Unclassified 4452
152 Ga0157380_10103915 3300014326 Unclassified 2371
153 Ga0157376_10053355 3300014969 Unclassified 3366
154 Ga0163161_10010285 3300017792 Bacteria 6480
155 Ga0213876_10026573 3300021384 Bacteria 3052
156 Ga0213876_10037534 3300021384 Bacteria 2556
157 Ga0213876_10104597 3300021384 Bacteria 1501
158 Ga0209566_100059 3300025225 Bacteria 199785
159 Ga0207653_10000036 3300025885 Bacteria 101828
160 Ga0207682_10061932 3300025893 Unclassified 1567
161 Ga0207699_10000003 3300025906 Bacteria 577076
162 Ga0207645_10029324 3300025907 Bacteria 3549
163 Ga0207643_10001089 3300025908 Bacteria 16080
164 Ga0207643_10051046 3300025908 Bacteria 2347
165 Ga0207684_10000600 3300025910 Bacteria 43049
166 Ga0207684_10114691 3300025910 Bacteria 2307
167 Ga0207654_10057539 3300025911 Bacteria 2260
168 Ga0207707_10015582 3300025912 Bacteria 6622
169 Ga0207695_10098850 3300025913 Bacteria 2917
170 Ga0207671_10062500 3300025914 Bacteria 2765
171 Ga0207663_10000226 3300025916 Bacteria 25174
172 Ga0207660_10139987 3300025917 Bacteria 1849
173 Ga0207662_10090003 3300025918 Bacteria 1886
174 Ga0207652_10239774 3300025921 Bacteria 1634
175 Ga0207646_10024867 3300025922 Bacteria 5482
176 Ga0207650_10099541 3300025925 Unclassified 2235
177 Ga0207650_10209684 3300025925 Bacteria 1564
178 Ga0207659_10037028 3300025926 Bacteria 3385
179 Ga0207659_10165747 3300025926 Unclassified 1739
180 Ga0207687_10001007 3300025927 Bacteria 19122
181 Ga0207644_10064719 3300025931 Bacteria 2657
182 Ga0207644_10222893 3300025931 Bacteria 1495
183 Ga0207686_10062195 3300025934 Bacteria 2370
184 Ga0207670_10111996 3300025936 Unclassified 1968
185 Ga0207665_10008788 3300025939 Bacteria 6642
186 Ga0207711_10235929 3300025941 Bacteria 1676
187 Ga0207661_10010245 3300025944 Bacteria 6742
188 Ga0207679_10040161 3300025945 Bacteria 3347
189 Ga0207679_10091909 3300025945 Unclassified 2350
190 Ga0207667_10253704 3300025949 Bacteria 1799
191 Ga0207651_10112747 3300025960 Unclassified 2045
192 Ga0207651_10349754 3300025960 Bacteria 1244
193 Ga0207712_10007548 3300025961 Bacteria 6870
194 Ga0207712_10091040 3300025961 Bacteria 2246
195 Ga0207712_10189962 3300025961 Bacteria 1621
196 Ga0207712_10409841 3300025961 Bacteria 1141
197 Ga0207677_10038318 3300026023 Bacteria 3142
198 Ga0207703_10118260 3300026035 Unclassified 2272
199 Ga0207703_10353590 3300026035 Bacteria 1353
200 Ga0207639_10000046 3300026041 Bacteria 134165
201 Ga0207639_10082243 3300026041 Bacteria 2552
202 Ga0207639_10190363 3300026041 Bacteria 1752
203 Ga0207708_10038247 3300026075 Bacteria 3655
204 Ga0207702_10485969 3300026078 Bacteria 1202
205 Ga0207641_10033968 3300026088 Bacteria 4240
206 Ga0207641_10110727 3300026088 Unclassified 2434
207 Ga0207641_10240488 3300026088 Bacteria 1687
208 Ga0207676_10022933 3300026095 Bacteria 4596
209 Ga0207676_10033476 3300026095 Bacteria 3883
210 Ga0207676_10053543 3300026095 Bacteria 3159
211 Ga0207676_10262679 3300026095 Bacteria 1559
212 Ga0207674_10097593 3300026116 Unclassified 2922
213 Ga0207674_10168303 3300026116 Bacteria 2145
214 Ga0207674_10169278 3300026116 Bacteria 2139
215 Ga0207674_10302945 3300026116 Bacteria 1547
216 Ga0207675_100187339 3300026118 Unclassified 1984
217 Ga0207683_10035553 3300026121 Bacteria 4333
218 Ga0207428_10046547 3300027907 Bacteria 3488
219 Ga0268265_10391427 3300028380 Bacteria 1282
220 Ga0268264_10009927 3300028381 Bacteria 7881
221 Ga0268264_10211363 3300028381 Bacteria 1781
222 Ga0307517_10037419 3300028786 Bacteria 5419
223 Ga0307515_10005412 3300028794 Bacteria 25871
224 Ga0307513_10005491 3300031456 Bacteria 16738
225 Ga0307509_10000429 3300031507 Bacteria 70665
226 Ga0307509_10050566 3300031507 Bacteria 4449
227 Ga0316579_10127537 3300031691 Bacteria 1224
228 Ga0316578_10073722 3300031728 Bacteria 2023
229 Ga0307516_10023189 3300031730 Bacteria 6366
230 Ga0307405_10001881 3300031731 Bacteria 9017
231 Ga0307405_10011050 3300031731 Bacteria 4712
232 Ga0316577_10000007 3300031733 Bacteria 41115
233 Ga0316577_10000484 3300031733 Bacteria 15689
234 Ga0307413_10000482 3300031824 Bacteria 13035
235 Ga0307413_10007455 3300031824 Bacteria 5082
236 Ga0307413_10121468 3300031824 Bacteria 1770
237 Ga0307410_10001582 3300031852 Bacteria 10425
238 Ga0307410_10003010 3300031852 Bacteria 8317
239 Ga0307410_10008719 3300031852 Bacteria 5641
240 Ga0307410_10076122 3300031852 Bacteria 2342
241 Ga0307410_10247713 3300031852 Bacteria 1384
242 Ga0307406_10028488 3300031901 Bacteria 3375
243 Ga0307406_10046519 3300031901 Bacteria 2730
244 Ga0307406_10301038 3300031901 Bacteria 1232
245 Ga0307406_10350850 3300031901 Bacteria 1153
246 Ga0307407_10000453 3300031903 Bacteria 12553
247 Ga0307407_10016953 3300031903 Bacteria 3641
248 Ga0307407_10025207 3300031903 Bacteria 3131
249 Ga0307409_100001611 3300031995 Bacteria 11291
250 Ga0307409_100003384 3300031995 Bacteria 8649
251 Ga0307409_100036880 3300031995 Bacteria 3598
252 Ga0307409_100124423 3300031995 Bacteria 2190
253 Ga0307416_100024527 3300032002 Bacteria 4405
254 Ga0307416_100044031 3300032002 Bacteria 3501
255 Ga0307416_100077495 3300032002 Bacteria 2792
256 Ga0307416_100122907 3300032002 Bacteria 2318
257 Ga0307414_10019254 3300032004 Bacteria 4226
258 Ga0307414_10024011 3300032004 Bacteria 3879
259 Ga0307411_10006280 3300032005 Bacteria 5930
260 Ga0307411_10010027 3300032005 Bacteria 5023
261 Ga0307411_10016769 3300032005 Bacteria 4153
262 Ga0307411_10087192 3300032005 Bacteria 2167
263 Ga0307415_100024071 3300032126 Bacteria 3794
264 Ga0373940_0020787 3300035088 Bacteria 1671
265 Ga0373949_0018045 3300035090 Bacteria 1596
266 Ga0373951_0001401 3300035091 Bacteria 6343
267 Ga0316582_0040525 3300036647 Bacteria 2907
268 Ga0395899_0043920 3300037312 Bacteria 3331
269 Ga0395905_0200751 3300037471 Bacteria 1870
270 Ga0395905_0434204 3300037471 Bacteria 1210
271 Ga0316581_0019701 3300037588 Bacteria 1970
272 Ga0395901_0345035 3300038443 Bacteria 1538
273 Ga0242420_001287 3300038996 Bacteria 3297
274 Ga0436365_0058572 3300039437 Bacteria 10762
275 Ga0436365_0345372 3300039437 Bacteria 7989
276 Ga0436365_0380920 3300039437 Bacteria 2612
277 Ga0436365_0882434 3300039437 Bacteria 1559
278 Ga0436360_0207401 3300039438 Bacteria 7071
279 Ga0436361_0772272 3300039447 Bacteria 1200
280 Ga0436361_0856632 3300039447 Bacteria 14995
281 Ga0436362_0700213 3300039453 Bacteria 6879
282 Ga0451577_0000858 3300042876 Bacteria 45245
283 Ga0453683_0049261 3300044673 Unclassified 2641
284 Ga0466957_0182903 3300044842 Unclassified 1370
285 Ga0466958_0047520 3300045836 Bacteria 2591
286 Ga0495663_0000129 3300046525 Bacteria 31242
287 Ga0495598_0000030 3300046537 Bacteria 22060
288 Ga0495636_0000039 3300047318 Bacteria 56199
289 Ga0495686_0004789 3300047472 Bacteria 10929
290 Ga0496102_0262972 3300048905 Bacteria 1627
291 Ga0496105_0002488 3300048908 Bacteria 13348
292 Ga0496108_0026337 3300048911 Bacteria 4796
293 Ga0496112_0302830 3300048915 Bacteria 1544
294 Ga0501034_0204197 3300049571 Bacteria 1933
295 Ga0501038_0002741 3300049574 Bacteria 16415
296 Ga0501040_0015204 3300049576 Bacteria 5085
297 Ga0501041_0156045 3300049577 Bacteria 1426
298 Ga0501043_0132565 3300049579 Bacteria 1953
299 Ga0501047_0000396 3300049581 Bacteria 48912
300 Ga0501047_0007709 3300049581 Bacteria 10138
301 Ga0501067_0048200 3300049583 Bacteria 2363
302 Ga0501070_0009928 3300049586 Bacteria 8048
303 Ga0501070_0125572 3300049586 Bacteria 2120
304 Ga0501070_0292479 3300049586 Bacteria 1327
305 Ga0501071_0305306 3300049587 Bacteria 1207
306 Ga0501072_0075634 3300049588 Unclassified 2663
307 Ga0501202_012922 3300049652 Bacteria 1582
308 Ga0501249_013488 3300049679 Bacteria 1737
309 Ga0501079_0101624 3300049741 Bacteria 2230
310 Ga0501081_0071936 3300049743 Bacteria 2411
311 Ga0501035_0249876 3300049822 Bacteria 1506
312 Ga0501044_0002570 3300049823 Bacteria 20675
313 Ga0501212_002100 3300049851 Unclassified 2365
314 nmdc:mga05p37_145015_c1 3300050507 Bacteria 2908
315 nmdc:mga05p37_44706_c1 3300050507 Bacteria 5449
316 nmdc:mga05p37_48354_c1 3300050507 Bacteria 5232
317 nmdc:mga05p37_681023_c1 3300050507 Bacteria 1146
318 nmdc:mga05p37_979_c1 3300050507 Bacteria 32457
319 nmdc:mga09592_176488_c1 3300050508 Bacteria 1848
320 nmdc:mga09592_223803_c1 3300050508 Unclassified 1630
321 nmdc:mga09592_28338_c1 3300050508 Bacteria 4652
322 nmdc:mga0qj67_29303_c1 3300050509 Bacteria 4276
323 nmdc:mga08y16_123017_c1 3300050511 Bacteria 2700
324 nmdc:mga08y16_161696_c1 3300050511 Bacteria 2327
325 nmdc:mga08y16_237739_c1 3300050511 Unclassified 1883
326 nmdc:mga08y16_386343_c1 3300050511 Bacteria 1434
327 nmdc:mga0rr50_50166_c1 3300050513 Unclassified 3091
328 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
329 nmdc:mga08x19_582_c1 3300050514 Bacteria 23727
330 nmdc:mga08x19_59577_c1 3300050514 Unclassified 2472
331 Ga0500635_0003221 3300053080 Bacteria 4090
332 Ga0495619_0048925 3300053085 Bacteria 2786
333 Ga0500578_0158279 3300053086 Bacteria 1407
334 Ga0500646_0005817 3300053090 Bacteria 3126
335 Ga0500583_0096061 3300053092 Bacteria 1447
336 Ga0500566_0000504 3300053094 Bacteria 21787
337 Ga0500566_0084782 3300053094 Bacteria 1758
338 Ga0500640_003597 3300053095 Bacteria 5459
339 Ga0500654_062133 3300053099 Bacteria 1902
340 Ga0500554_000192 3300053102 Bacteria 12823
341 Ga0500572_003433 3300053111 Bacteria 3626
342 Ga0500595_000091 3300053119 Bacteria 62164
343 Ga0500607_090907 3300053121 Bacteria 1536
344 Ga0500608_000424 3300053122 Bacteria 16047
345 Ga0500614_000721 3300053123 Bacteria 8464
346 Ga0500559_0005628 3300053136 Bacteria 5740
347 Ga0500564_064581 3300053138 Bacteria 1657
348 Ga0500568_0006333 3300053139 Bacteria 5953
349 Ga0500603_003108 3300053150 Bacteria 3579
350 Ga0500601_005962 3300053737 Bacteria 1342
351 Ga0501084_0028676 3300054114 Bacteria 4654
352 Ga0501082_0024155 3300060353 Bacteria 5243
353 Ga0530510_0290527 3300061734 Bacteria 1222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003841 Ga0055541_1012409 Ga0055541_10124092 276
2 3300026116 Ga0207674_10097593 Ga0207674_100975934 292
3 3300031691 Ga0316579_10127537 Ga0316579_101275372 298
4 3300031733 Ga0316577_10000484 Ga0316577_1000048410 298
5 3300049652 Ga0501202_012922 Ga0501202_012922_419_1342 307
6 3300006846 Ga0075430_100068442 Ga0075430_1000684424 308
7 3300009094 Ga0111539_10059105 Ga0111539_100591052 308
8 3300050511 nmdc:mga08y16_161696_c1 nmdc:mga08y16_161696_c1_210_1136 308
9 3300049571 Ga0501034_0204197 Ga0501034_0204197_384_1331 309
10 3300031728 Ga0316578_10073722 Ga0316578_100737222 310
11 3300031733 Ga0316577_10000007 Ga0316577_1000000720 310
12 3300037588 Ga0316581_0019701 Ga0316581_0019701_172_1119 310
13 3300049581 Ga0501047_0007709 Ga0501047_0007709_8041_9000 311
14 3300049822 Ga0501035_0249876 Ga0501035_0249876_477_1436 311
15 iso_pu_bacteria 2687453257 2688068694 312
16 iso_pu_bacteria 2889415604 2889416946 312
17 iso_pu_bacteria 2920107658 2920113423 312
18 3300006880 Ga0075429_100032313 Ga0075429_1000323133 313
19 3300009094 Ga0111539_10125700 Ga0111539_101257002 313
20 3300049583 Ga0501067_0048200 Ga0501067_0048200_174_1127 313
21 3300049586 Ga0501070_0125572 Ga0501070_0125572_61_1014 313
22 3300049586 Ga0501070_0292479 Ga0501070_0292479_199_1152 313
23 3300049587 Ga0501071_0305306 Ga0501071_0305306_167_1120 313
24 3300050508 nmdc:mga09592_28338_c1 nmdc:mga09592_28338_c1_1577_2530 313
25 3300050511 nmdc:mga08y16_386343_c1 nmdc:mga08y16_386343_c1_349_1302 313
26 3300060353 Ga0501082_0024155 Ga0501082_0024155_3100_4053 313
27 iso_pu_bacteria 2920107658 2920115065 313
28 3300005289 Ga0065704_10085044 Ga0065704_100850443 314
29 3300005441 Ga0070700_100245234 Ga0070700_1002452341 314
30 3300005539 Ga0068853_100000079 Ga0068853_10000007914 314
31 3300006844 Ga0075428_100034515 Ga0075428_1000345153 314
32 3300021384 Ga0213876_10037534 Ga0213876_100375342 314
33 3300026041 Ga0207639_10000046 Ga0207639_1000004636 314
34 3300037312 Ga0395899_0043920 Ga0395899_0043920_1539_2558 314
35 3300037471 Ga0395905_0434204 Ga0395905_0434204_27_971 314
36 3300039437 Ga0436365_0380920 Ga0436365_0380920_577_1605 314
37 3300047318 Ga0495636_0000039 Ga0495636_0000039_19795_20739 314
38 3300006914 Ga0075436_100000869 Ga0075436_1000008693 315
39 3300007076 Ga0075435_100468716 Ga0075435_1004687161 315
40 3300044842 Ga0466957_0182903 Ga0466957_0182903_153_1151 315
41 3300045836 Ga0466958_0047520 Ga0466958_0047520_754_1752 315
42 3300046525 Ga0495663_0000129 Ga0495663_0000129_19082_20047 315
43 3300050513 nmdc:mga0rr50_50166_c1 nmdc:mga0rr50_50166_c1_848_1795 315
44 3300050514 nmdc:mga08x19_582_c1 nmdc:mga08x19_582_c1_1033_1980 315
45 3300053095 Ga0500640_003597 Ga0500640_003597_711_1691 315
46 3300053102 Ga0500554_000192 Ga0500554_000192_9523_10503 315
47 3300053111 Ga0500572_003433 Ga0500572_003433_2114_3094 315
48 3300053119 Ga0500595_000091 Ga0500595_000091_48088_49068 315
49 3300053121 Ga0500607_090907 Ga0500607_090907_437_1417 315
50 3300053123 Ga0500614_000721 Ga0500614_000721_6776_7756 315
51 3300053136 Ga0500559_0005628 Ga0500559_0005628_3965_4945 315
52 3300053737 Ga0500601_005962 Ga0500601_005962_86_1066 315
53 3300013297 Ga0157378_10080414 Ga0157378_100804143 316
54 3300021384 Ga0213876_10104597 Ga0213876_101045972 316
55 3300031507 Ga0307509_10000429 Ga0307509_1000042951 316
56 3300031730 Ga0307516_10023189 Ga0307516_100231892 316
57 3300039437 Ga0436365_0345372 Ga0436365_0345372_292_1242 316
58 3300039437 Ga0436365_0882434 Ga0436365_0882434_292_1242 316
59 3300039447 Ga0436361_0772272 Ga0436361_0772272_75_1028 316
60 3300042876 Ga0451577_0000858 Ga0451577_0000858_10378_11337 316
61 3300049851 Ga0501212_002100 Ga0501212_002100_62_1012 316
62 3300053080 Ga0500635_0003221 Ga0500635_0003221_2589_3557 316
63 3300053086 Ga0500578_0158279 Ga0500578_0158279_117_1085 316
64 3300053094 Ga0500566_0000504 Ga0500566_0000504_13095_14063 316
65 3300053138 Ga0500564_064581 Ga0500564_064581_257_1225 316
66 3300053150 Ga0500603_003108 Ga0500603_003108_566_1534 316
67 3300003203 JGI25406J46586_10001120 JGI25406J46586_100011209 317
68 3300005289 Ga0065704_10126843 Ga0065704_101268432 317
69 3300005617 Ga0068859_100542145 Ga0068859_1005421451 317
70 3300005719 Ga0068861_100069805 Ga0068861_1000698051 317
71 3300006880 Ga0075429_100056523 Ga0075429_1000565233 317
72 3300006931 Ga0097620_100542109 Ga0097620_1005421091 317
73 3300009094 Ga0111539_10564703 Ga0111539_105647032 317
74 3300009147 Ga0114129_10099522 Ga0114129_100995223 317
75 3300025911 Ga0207654_10057539 Ga0207654_100575392 317
76 3300025961 Ga0207712_10007548 Ga0207712_1000754811 317
77 3300025961 Ga0207712_10189962 Ga0207712_101899622 317
78 3300026088 Ga0207641_10033968 Ga0207641_100339683 317
79 3300026088 Ga0207641_10240488 Ga0207641_102404882 317
80 3300027907 Ga0207428_10046547 Ga0207428_100465471 317
81 3300028381 Ga0268264_10009927 Ga0268264_100099275 317
82 3300028794 Ga0307515_10005412 Ga0307515_100054126 317
83 3300031901 Ga0307406_10028488 Ga0307406_100284882 317
84 3300035091 Ga0373951_0001401 Ga0373951_0001401_1660_2613 317
85 3300036647 Ga0316582_0040525 Ga0316582_0040525_1763_2725 317
86 3300048905 Ga0496102_0262972 Ga0496102_0262972_11_967 317
87 3300049579 Ga0501043_0132565 Ga0501043_0132565_129_1127 317
88 3300049581 Ga0501047_0000396 Ga0501047_0000396_10754_11752 317
89 3300049586 Ga0501070_0009928 Ga0501070_0009928_1445_2443 317
90 3300049823 Ga0501044_0002570 Ga0501044_0002570_17919_18917 317
91 3300050508 nmdc:mga09592_223803_c1 nmdc:mga09592_223803_c1_380_1336 317
92 3300050509 nmdc:mga0qj67_29303_c1 nmdc:mga0qj67_29303_c1_2779_3732 317
93 3300053092 Ga0500583_0096061 Ga0500583_0096061_287_1264 317
94 3300005338 Ga0068868_100199044 Ga0068868_1001990442 318
95 3300005340 Ga0070689_100042044 Ga0070689_1000420443 318
96 3300005354 Ga0070675_100403047 Ga0070675_1004030471 318
97 3300005355 Ga0070671_100121276 Ga0070671_1001212763 318
98 3300005456 Ga0070678_100173952 Ga0070678_1001739522 318
99 3300005543 Ga0070672_100084278 Ga0070672_1000842783 318
100 3300005543 Ga0070672_100170836 Ga0070672_1001708362 318
101 3300005544 Ga0070686_100068741 Ga0070686_1000687411 318
102 3300005617 Ga0068859_100033561 Ga0068859_1000335613 318
103 3300005618 Ga0068864_100120394 Ga0068864_1001203943 318
104 3300005840 Ga0068870_10010234 Ga0068870_100102347 318
105 3300005843 Ga0068860_100015886 Ga0068860_1000158863 318
106 3300006028 Ga0070717_10069324 Ga0070717_100693242 318
107 3300006237 Ga0097621_100106577 Ga0097621_1001065772 318
108 3300006358 Ga0068871_100150210 Ga0068871_1001502103 318
109 3300006847 Ga0075431_100170930 Ga0075431_1001709302 318
110 3300006852 Ga0075433_10222236 Ga0075433_102222362 318
111 3300006881 Ga0068865_100060458 Ga0068865_1000604584 318
112 3300006931 Ga0097620_100033561 Ga0097620_1000335613 318
113 3300009098 Ga0105245_10104387 Ga0105245_101043871 318
114 3300009147 Ga0114129_10013102 Ga0114129_100131028 318
115 3300009147 Ga0114129_10032891 Ga0114129_100328915 318
116 3300009147 Ga0114129_10465292 Ga0114129_104652922 318
117 3300009147 Ga0114129_10832344 Ga0114129_108323441 318
118 3300009553 Ga0105249_10287613 Ga0105249_102876132 318
119 3300013306 Ga0163162_10376465 Ga0163162_103764652 318
120 3300013308 Ga0157375_10184060 Ga0157375_101840601 318
121 3300014325 Ga0163163_10186675 Ga0163163_101866753 318
122 3300014326 Ga0157380_10013382 Ga0157380_100133825 318
123 3300017792 Ga0163161_10010285 Ga0163161_100102855 318
124 3300025893 Ga0207682_10061932 Ga0207682_100619322 318
125 3300025908 Ga0207643_10051046 Ga0207643_100510462 318
126 3300025925 Ga0207650_10209684 Ga0207650_102096842 318
127 3300025926 Ga0207659_10037028 Ga0207659_100370281 318
128 3300025926 Ga0207659_10165747 Ga0207659_101657471 318
129 3300025931 Ga0207644_10222893 Ga0207644_102228931 318
130 3300025934 Ga0207686_10062195 Ga0207686_100621953 318
131 3300025941 Ga0207711_10235929 Ga0207711_102359292 318
132 3300025961 Ga0207712_10409841 Ga0207712_104098411 318
133 3300026095 Ga0207676_10033476 Ga0207676_100334763 318
134 3300026095 Ga0207676_10262679 Ga0207676_102626793 318
135 3300026121 Ga0207683_10035553 Ga0207683_100355534 318
136 3300028381 Ga0268264_10211363 Ga0268264_102113633 318
137 3300031456 Ga0307513_10005491 Ga0307513_100054915 318
138 3300048915 Ga0496112_0302830 Ga0496112_0302830_421_1413 318
139 3300050507 nmdc:mga05p37_145015_c1 nmdc:mga05p37_145015_c1_236_1192 318
140 3300050507 nmdc:mga05p37_48354_c1 nmdc:mga05p37_48354_c1_776_1732 318
141 3300050507 nmdc:mga05p37_681023_c1 nmdc:mga05p37_681023_c1_41_997 318
142 3300053094 Ga0500566_0084782 Ga0500566_0084782_730_1710 318
143 3300005328 Ga0070676_10049451 Ga0070676_100494512 319
144 3300005334 Ga0068869_100286698 Ga0068869_1002866982 319
145 3300005336 Ga0070680_100104039 Ga0070680_1001040392 319
146 3300005341 Ga0070691_10094733 Ga0070691_100947332 319
147 3300005343 Ga0070687_100083315 Ga0070687_1000833152 319
148 3300005364 Ga0070673_100070288 Ga0070673_1000702883 319
149 3300005364 Ga0070673_100308251 Ga0070673_1003082512 319
150 3300005441 Ga0070700_100147294 Ga0070700_1001472942 319
151 3300005444 Ga0070694_100015685 Ga0070694_1000156853 319
152 3300005444 Ga0070694_100063517 Ga0070694_1000635172 319
153 3300005518 Ga0070699_100000045 Ga0070699_10000004518 319
154 3300005518 Ga0070699_100158762 Ga0070699_1001587623 319
155 3300005546 Ga0070696_100000014 Ga0070696_10000001470 319
156 3300005546 Ga0070696_100041801 Ga0070696_1000418012 319
157 3300005617 Ga0068859_100009778 Ga0068859_1000097787 319
158 3300005840 Ga0068870_10056418 Ga0068870_100564182 319
159 3300006237 Ga0097621_100065163 Ga0097621_1000651632 319
160 3300006931 Ga0097620_100009777 Ga0097620_1000097773 319
161 3300011119 Ga0105246_10075600 Ga0105246_100756002 319
162 3300013307 Ga0157372_10118783 Ga0157372_101187832 319
163 3300014326 Ga0157380_10103915 Ga0157380_101039152 319
164 3300021384 Ga0213876_10026573 Ga0213876_100265733 319
165 3300025907 Ga0207645_10029324 Ga0207645_100293242 319
166 3300025908 Ga0207643_10001089 Ga0207643_100010894 319
167 3300025918 Ga0207662_10090003 Ga0207662_100900032 319
168 3300025939 Ga0207665_10008788 Ga0207665_100087882 319
169 3300025960 Ga0207651_10112747 Ga0207651_101127472 319
170 3300025960 Ga0207651_10349754 Ga0207651_103497541 319
171 3300026035 Ga0207703_10353590 Ga0207703_103535902 319
172 3300026041 Ga0207639_10082243 Ga0207639_100822432 319
173 3300026075 Ga0207708_10038247 Ga0207708_100382473 319
174 3300026095 Ga0207676_10022933 Ga0207676_100229333 319
175 3300028380 Ga0268265_10391427 Ga0268265_103914272 319
176 3300028786 Ga0307517_10037419 Ga0307517_100374193 319
177 3300031507 Ga0307509_10050566 Ga0307509_100505662 319
178 3300031901 Ga0307406_10301038 Ga0307406_103010381 319
179 3300031901 Ga0307406_10350850 Ga0307406_103508501 319
180 3300032004 Ga0307414_10024011 Ga0307414_100240112 319
181 3300032005 Ga0307411_10010027 Ga0307411_100100277 319
182 3300035088 Ga0373940_0020787 Ga0373940_0020787_524_1522 319
183 3300035090 Ga0373949_0018045 Ga0373949_0018045_545_1543 319
184 3300038996 Ga0242420_001287 Ga0242420_001287_1372_2331 319
185 3300039437 Ga0436365_0058572 Ga0436365_0058572_3841_4800 319
186 3300048911 Ga0496108_0026337 Ga0496108_0026337_978_1937 319
187 3300053090 Ga0500646_0005817 Ga0500646_0005817_144_1148 319
188 3300053099 Ga0500654_062133 Ga0500654_062133_50_1054 319
189 3300005467 Ga0070706_100214397 Ga0070706_1002143971 320
190 3300005468 Ga0070707_100027845 Ga0070707_1000278452 320
191 3300006358 Ga0068871_100224491 Ga0068871_1002244911 320
192 3300009147 Ga0114129_10076419 Ga0114129_100764192 320
193 3300025922 Ga0207646_10024867 Ga0207646_100248671 320
194 3300031731 Ga0307405_10001881 Ga0307405_100018812 320
195 3300031824 Ga0307413_10121468 Ga0307413_101214682 320
196 3300031852 Ga0307410_10008719 Ga0307410_100087192 320
197 3300031901 Ga0307406_10046519 Ga0307406_100465192 320
198 3300031903 Ga0307407_10016953 Ga0307407_100169533 320
199 3300031995 Ga0307409_100124423 Ga0307409_1001244232 320
200 3300032002 Ga0307416_100122907 Ga0307416_1001229072 320
201 3300032004 Ga0307414_10019254 Ga0307414_100192542 320
202 3300032005 Ga0307411_10006280 Ga0307411_100062804 320
203 3300038443 Ga0395901_0345035 Ga0395901_0345035_63_1052 320
204 3300044673 Ga0453683_0049261 Ga0453683_0049261_1530_2492 320
205 3300047472 Ga0495686_0004789 Ga0495686_0004789_8043_9056 320
206 3300050507 nmdc:mga05p37_979_c1 nmdc:mga05p37_979_c1_6487_7449 320
207 3300005289 Ga0065704_10094803 Ga0065704_100948032 321
208 3300005327 Ga0070658_10009053 Ga0070658_100090533 321
209 3300005337 Ga0070682_100000466 Ga0070682_10000046619 321
210 3300005355 Ga0070671_100088281 Ga0070671_1000882813 321
211 3300005406 Ga0070703_10000360 Ga0070703_1000036014 321
212 3300005440 Ga0070705_100000113 Ga0070705_1000001138 321
213 3300005445 Ga0070708_100012650 Ga0070708_1000126504 321
214 3300005467 Ga0070706_100000570 Ga0070706_10000057026 321
215 3300005546 Ga0070696_100001961 Ga0070696_10000196112 321
216 3300005547 Ga0070693_100002572 Ga0070693_1000025724 321
217 3300005549 Ga0070704_100034284 Ga0070704_1000342843 321
218 3300006852 Ga0075433_10037566 Ga0075433_100375665 321
219 3300006871 Ga0075434_100162782 Ga0075434_1001627822 321
220 3300014326 Ga0157380_10025882 Ga0157380_100258824 321
221 3300025885 Ga0207653_10000036 Ga0207653_1000003626 321
222 3300025910 Ga0207684_10000600 Ga0207684_1000060011 321
223 3300025931 Ga0207644_10064719 Ga0207644_100647193 321
224 3300026116 Ga0207674_10168303 Ga0207674_101683032 321
225 3300037471 Ga0395905_0200751 Ga0395905_0200751_167_1132 321
226 3300039438 Ga0436360_0207401 Ga0436360_0207401_1609_2583 321
227 3300039447 Ga0436361_0856632 Ga0436361_0856632_10260_11234 321
228 3300039453 Ga0436362_0700213 Ga0436362_0700213_1804_2778 321
229 3300050514 nmdc:mga08x19_59577_c1 nmdc:mga08x19_59577_c1_463_1428 321
230 3300053085 Ga0495619_0048925 Ga0495619_0048925_290_1297 321
231 3300053122 Ga0500608_000424 Ga0500608_000424_181_1188 321
232 3300053139 Ga0500568_0006333 Ga0500568_0006333_1412_2461 321
233 3300005445 Ga0070708_100000103 Ga0070708_10000010331 322
234 3300005467 Ga0070706_100001771 Ga0070706_10000177111 322
235 3300005518 Ga0070699_100001144 Ga0070699_1000011443 322
236 3300005618 Ga0068864_100277199 Ga0068864_1002771992 322
237 3300006028 Ga0070717_10091174 Ga0070717_100911742 322
238 3300006846 Ga0075430_100062150 Ga0075430_1000621502 322
239 3300009147 Ga0114129_10074985 Ga0114129_100749854 322
240 3300025910 Ga0207684_10114691 Ga0207684_101146912 322
241 3300025945 Ga0207679_10040161 Ga0207679_100401613 322
242 3300032002 Ga0307416_100077495 Ga0307416_1000774952 322
243 3300046537 Ga0495598_0000030 Ga0495598_0000030_20939_21907 322
244 3300050507 nmdc:mga05p37_44706_c1 nmdc:mga05p37_44706_c1_4016_4984 322
245 3300050508 nmdc:mga09592_176488_c1 nmdc:mga09592_176488_c1_394_1362 322
246 3300050511 nmdc:mga08y16_123017_c1 nmdc:mga08y16_123017_c1_359_1327 322
247 3300005328 Ga0070676_10184295 Ga0070676_101842951 323
248 3300005329 Ga0070683_100013813 Ga0070683_1000138134 323
249 3300005338 Ga0068868_100101915 Ga0068868_1001019152 323
250 3300005345 Ga0070692_10032581 Ga0070692_100325812 323
251 3300005434 Ga0070709_10136654 Ga0070709_101366541 323
252 3300005435 Ga0070714_100185468 Ga0070714_1001854682 323
253 3300005539 Ga0068853_100007263 Ga0068853_1000072637 323
254 3300005539 Ga0068853_100319124 Ga0068853_1003191242 323
255 3300006028 Ga0070717_10234756 Ga0070717_102347561 323
256 3300009093 Ga0105240_10189278 Ga0105240_101892782 323
257 3300009098 Ga0105245_10001633 Ga0105245_100016335 323
258 3300009551 Ga0105238_10049741 Ga0105238_100497413 323
259 3300009551 Ga0105238_10078645 Ga0105238_100786453 323
260 3300010375 Ga0105239_10030156 Ga0105239_100301561 323
261 3300013100 Ga0157373_10060926 Ga0157373_100609263 323
262 3300013296 Ga0157374_10000818 Ga0157374_100008183 323
263 3300014325 Ga0163163_10052805 Ga0163163_100528053 323
264 3300014969 Ga0157376_10053355 Ga0157376_100533552 323
265 3300025225 Ga0209566_100059 Ga0209566_100059108 323
266 3300025927 Ga0207687_10001007 Ga0207687_1000100713 323
267 3300025944 Ga0207661_10010245 Ga0207661_100102453 323
268 3300026023 Ga0207677_10038318 Ga0207677_100383182 323
269 3300026095 Ga0207676_10053543 Ga0207676_100535433 323
270 3300031731 Ga0307405_10011050 Ga0307405_100110504 323
271 3300031824 Ga0307413_10000482 Ga0307413_1000048220 323
272 3300031824 Ga0307413_10007455 Ga0307413_100074555 323
273 3300031852 Ga0307410_10001582 Ga0307410_1000158213 323
274 3300031852 Ga0307410_10003010 Ga0307410_100030105 323
275 3300031852 Ga0307410_10076122 Ga0307410_100761222 323
276 3300031903 Ga0307407_10000453 Ga0307407_100004533 323
277 3300031903 Ga0307407_10025207 Ga0307407_100252074 323
278 3300031995 Ga0307409_100001611 Ga0307409_1000016116 323
279 3300031995 Ga0307409_100003384 Ga0307409_1000033843 323
280 3300031995 Ga0307409_100036880 Ga0307409_1000368803 323
281 3300032002 Ga0307416_100024527 Ga0307416_1000245275 323
282 3300032002 Ga0307416_100044031 Ga0307416_1000440312 323
283 3300032005 Ga0307411_10016769 Ga0307411_100167692 323
284 3300032005 Ga0307411_10087192 Ga0307411_100871922 323
285 3300032126 Ga0307415_100024071 Ga0307415_1000240712 323
286 3300048908 Ga0496105_0002488 Ga0496105_0002488_6232_7269 323
287 3300049679 Ga0501249_013488 Ga0501249_013488_663_1640 323
288 3300005340 Ga0070689_100032809 Ga0070689_1000328092 324
289 3300005354 Ga0070675_100052642 Ga0070675_1000526421 324
290 3300005355 Ga0070671_100180555 Ga0070671_1001805552 324
291 3300005365 Ga0070688_100036641 Ga0070688_1000366413 324
292 3300005434 Ga0070709_10000006 Ga0070709_1000000630 324
293 3300005439 Ga0070711_100000013 Ga0070711_10000001319 324
294 3300005440 Ga0070705_100199269 Ga0070705_1001992691 324
295 3300005455 Ga0070663_100080891 Ga0070663_1000808911 324
296 3300005458 Ga0070681_10006732 Ga0070681_1000673211 324
297 3300005466 Ga0070685_10187069 Ga0070685_101870692 324
298 3300005530 Ga0070679_100164096 Ga0070679_1001640962 324
299 3300005535 Ga0070684_100224849 Ga0070684_1002248492 324
300 3300005539 Ga0068853_100116655 Ga0068853_1001166552 324
301 3300005549 Ga0070704_100008577 Ga0070704_1000085773 324
302 3300005564 Ga0070664_100045791 Ga0070664_1000457913 324
303 3300005564 Ga0070664_100132324 Ga0070664_1001323242 324
304 3300005577 Ga0068857_100055791 Ga0068857_1000557913 324
305 3300005617 Ga0068859_100068223 Ga0068859_1000682232 324
306 3300005719 Ga0068861_100170116 Ga0068861_1001701162 324
307 3300005841 Ga0068863_100054751 Ga0068863_1000547514 324
308 3300005842 Ga0068858_100140103 Ga0068858_1001401033 324
309 3300006914 Ga0075436_100041855 Ga0075436_1000418552 324
310 3300006914 Ga0075436_100068962 Ga0075436_1000689623 324
311 3300006931 Ga0097620_100068221 Ga0097620_1000682212 324
312 3300009093 Ga0105240_10054126 Ga0105240_100541266 324
313 3300009094 Ga0111539_10312743 Ga0111539_103127431 324
314 3300009174 Ga0105241_10039091 Ga0105241_100390912 324
315 3300009553 Ga0105249_10090715 Ga0105249_100907154 324
316 3300009553 Ga0105249_10152721 Ga0105249_101527212 324
317 3300013100 Ga0157373_10028701 Ga0157373_100287014 324
318 3300013100 Ga0157373_10044581 Ga0157373_100445814 324
319 3300013105 Ga0157369_10032425 Ga0157369_100324252 324
320 3300013105 Ga0157369_10033177 Ga0157369_100331776 324
321 3300013297 Ga0157378_10091427 Ga0157378_100914272 324
322 3300013306 Ga0163162_10056295 Ga0163162_100562952 324
323 3300013307 Ga0157372_10040055 Ga0157372_100400555 324
324 3300013307 Ga0157372_10065712 Ga0157372_100657123 324
325 3300013308 Ga0157375_10342482 Ga0157375_103424822 324
326 3300014326 Ga0157380_10013975 Ga0157380_100139754 324
327 3300025906 Ga0207699_10000003 Ga0207699_10000003224 324
328 3300025912 Ga0207707_10015582 Ga0207707_100155822 324
329 3300025913 Ga0207695_10098850 Ga0207695_100988502 324
330 3300025914 Ga0207671_10062500 Ga0207671_100625002 324
331 3300025916 Ga0207663_10000226 Ga0207663_100002266 324
332 3300025917 Ga0207660_10139987 Ga0207660_101399871 324
333 3300025921 Ga0207652_10239774 Ga0207652_102397742 324
334 3300025925 Ga0207650_10099541 Ga0207650_100995412 324
335 3300025936 Ga0207670_10111996 Ga0207670_101119963 324
336 3300025945 Ga0207679_10091909 Ga0207679_100919093 324
337 3300025949 Ga0207667_10253704 Ga0207667_102537042 324
338 3300025961 Ga0207712_10091040 Ga0207712_100910401 324
339 3300026035 Ga0207703_10118260 Ga0207703_101182602 324
340 3300026041 Ga0207639_10190363 Ga0207639_101903633 324
341 3300026078 Ga0207702_10485969 Ga0207702_104859691 324
342 3300026088 Ga0207641_10110727 Ga0207641_101107273 324
343 3300026116 Ga0207674_10169278 Ga0207674_101692782 324
344 3300026116 Ga0207674_10302945 Ga0207674_103029452 324
345 3300026118 Ga0207675_100187339 Ga0207675_1001873393 324
346 3300031852 Ga0307410_10247713 Ga0307410_102477131 324
347 3300049574 Ga0501038_0002741 Ga0501038_0002741_12988_13962 324
348 3300049588 Ga0501072_0075634 Ga0501072_0075634_1190_2179 324
349 3300050511 nmdc:mga08y16_237739_c1 nmdc:mga08y16_237739_c1_836_1816 324
350 3300050514 nmdc:mga08x19_10_c1 nmdc:mga08x19_10_c1_385383_386369 324
351 3300049576 Ga0501040_0015204 Ga0501040_0015204_204_1190 325
352 3300049577 Ga0501041_0156045 Ga0501041_0156045_391_1377 325
353 3300049741 Ga0501079_0101624 Ga0501079_0101624_272_1258 325
354 3300049743 Ga0501081_0071936 Ga0501081_0071936_64_1050 325
355 3300054114 Ga0501084_0028676 Ga0501084_0028676_79_1065 325
356 3300061734 Ga0530510_0290527 Ga0530510_0290527_70_1056 325
357 2162886012 MBSR1b_contig_6586487 MBSR1b_0478.00002950 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

63

306

0.96

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

64

369

0.89

PF04321

RmlD_sub_bind

RmlD substrate binding domain

60

314

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

64

304

0.82

PF07993

NAD_binding_4

Male sterility protein

65

288

0.77

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

63

336

0.74

PF08659

KR

KR domain

62

202

0.72

PF13460

NAD_binding_10

NAD(P)H-binding

67

233

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9475 2 325
6zla-assembly2.cif.gz_D-2 crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9433 2 325
6zlk-assembly2.cif.gz_B equilibrium structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid/udp-galacturonic acid and nad 0.9431 2 325
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.9422 2 325
6zla-assembly1.cif.gz_B crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9414 2 325
ID Description Score Start End Superfamily
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 2 255 3.40.50.720
af_Q0DDZ4_1_298_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9332 48 328 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9215 1 333 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 1 333 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9183 2 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V5LUD6-F1-model_v4 Epimerase 0.9906 194 325
AF-A0A7C5I342-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9797 110 325
AF-A0A2E1CKI4-F1-model_v4 deleted 0.9785 2 325
AF-A0A1F5BWD8-F1-model_v4 Epimerase 0.9783 2 297
AF-A0A7V2IR48-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9771 2 215

Feature Viewer

pLDDT pTM Quality
92.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map