F420630

General Info

Members Datasets Scaffolds Average Seq Length
356 248 712 418

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0024735|Ga0496121_0024735_3843_5336
Length 485
Sequence MTSTVSPAGRPGGLRRSLRRLAVDTRPLAIPAYRRTFLGQGTAVVGTMVTEVAAPVQIYDISGSSFAVGLAGLVSLIPMVVFGLYGGAVADAVDRRTLYLSSSLLTWTVTLVLLTQSLLGARSVALILCLVGVQAAGFAVSSSVRGAVVPALVPVELVPAANSLNYTAFTLGAVLGPLVAGVLLGFPHGFSYAYAADAVLFTAALYATFRLPSLRPAVSAGRPGLRSVLDGLGFIGGNPVLLMSFLVDIAAMVLAMPRALFPEAAATRFHGGVGLLYSAIALGSVVAGLTSGWIGRVRRQGVVLTVAVLGWAAAVSAAGFAHVYWLAVLLLAVAGAADLVSAVCRQTILQTYVPDTMRGRLQGVFTVVVAGGPRLGDLRAGVMAAVTTLTVAWSGSAILCVGVVLVAAVAVRPFWHYDTGRAGLPAQRADSAGSDAALVGDRDGGGTVADAELGVEIDEVGLDGGLADQRLAGGGLVRGAGGEEA

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
119 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2517572101 Frankia sp. DC12 Isolate Nodule
211 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
212 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
213 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
214 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
215 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
216 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
217 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
218 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
219 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
220 2858882152 Micromonospora noduli MED15 Isolate Nodule
221 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
222 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
223 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
224 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
225 2867369537 Streptomyces sp. Z26 Isolate Unclassified
226 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
227 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
228 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
229 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
230 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
231 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
232 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
233 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
234 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
235 2891562705 Microbispora tritici MT50 Isolate Unclassified
236 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
237 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
238 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
239 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
240 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
241 8002784119 Frankia sp. AgB1.9 Isolate Nodule
242 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
243 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
244 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
245 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
246 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
247 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
248 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0.28
Isolates 10.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 1.97
Rhizoplane 3.93
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0024735 3300048924 Bacteria 5731
2 rootH1_10077758 3300003316 Bacteria 2447
3 Ga0070676_10045912 3300005328 Bacteria 2545
4 Ga0070670_100031412 3300005331 Bacteria 4573
5 Ga0070680_100050170 3300005336 Bacteria 3403
6 Ga0070682_100005154 3300005337 Bacteria 7261
7 Ga0068868_100009234 3300005338 Bacteria 7088
8 Ga0070691_10002512 3300005341 Bacteria 8162
9 Ga0070687_100040473 3300005343 Bacteria 2348
10 Ga0070692_10009917 3300005345 Bacteria 4314
11 Ga0070668_100038647 3300005347 Bacteria 3649
12 Ga0070675_100026137 3300005354 Bacteria 4683
13 Ga0070671_100045128 3300005355 Bacteria 3663
14 Ga0070659_100119333 3300005366 Bacteria 2134
15 Ga0070667_100027507 3300005367 Bacteria 4732
16 Ga0070714_100049718 3300005435 Bacteria 3569
17 Ga0070710_10043274 3300005437 Bacteria 2493
18 Ga0070711_100186975 3300005439 Bacteria 1589
19 Ga0070700_100000218 3300005441 Bacteria 31966
20 Ga0070700_100045126 3300005441 Bacteria 2718
21 Ga0070663_100011135 3300005455 Bacteria 5632
22 Ga0070678_100015518 3300005456 Bacteria 4845
23 Ga0070662_100027469 3300005457 Bacteria 3950
24 Ga0070681_10004529 3300005458 Bacteria 13263
25 Ga0070685_10083481 3300005466 Bacteria 1919
26 Ga0070684_100096244 3300005535 Bacteria 2639
27 Ga0070693_100008393 3300005547 Bacteria 5090
28 Ga0070704_100116037 3300005549 Bacteria 2047
29 Ga0068855_100058435 3300005563 Bacteria 4516
30 Ga0068854_100092539 3300005578 Bacteria 2252
31 Ga0068856_100013117 3300005614 Bacteria 8029
32 Ga0068856_100018011 3300005614 Bacteria 6848
33 Ga0070702_100008822 3300005615 Bacteria 4902
34 Ga0068859_100003593 3300005617 Bacteria 15804
35 Ga0068859_100022772 3300005617 Bacteria 6282
36 Ga0068861_100020662 3300005719 Bacteria 4720
37 Ga0068870_10007303 3300005840 Bacteria 4924
38 Ga0068863_100000326 3300005841 Bacteria 48264
39 Ga0068863_100002558 3300005841 Bacteria 18059
40 Ga0068860_100092901 3300005843 Bacteria 2875
41 Ga0081455_10003985 3300005937 Bacteria 16759
42 Ga0081538_10001722 3300005981 Bacteria 22265
43 Ga0081538_10013347 3300005981 Bacteria 6511
44 Ga0081538_10015299 3300005981 Bacteria 5948
45 Ga0081539_10000638 3300005985 Bacteria 70891
46 Ga0081539_10008555 3300005985 Bacteria 8857
47 Ga0081539_10009590 3300005985 Bacteria 8046
48 Ga0070717_10095591 3300006028 Bacteria 2515
49 Ga0075365_10132911 3300006038 Bacteria 1723
50 Ga0097621_100213620 3300006237 Bacteria 1679
51 Ga0068871_100087817 3300006358 Bacteria 2586
52 Ga0075430_100000905 3300006846 Bacteria 23229
53 Ga0075433_10016370 3300006852 Bacteria 6109
54 Ga0075433_10049728 3300006852 Bacteria 3647
55 Ga0075434_100005990 3300006871 Bacteria 11127
56 Ga0075429_100179472 3300006880 Bacteria 1855
57 Ga0097620_100003593 3300006931 Bacteria 15804
58 Ga0097620_100022772 3300006931 Bacteria 6282
59 Ga0075435_100003754 3300007076 Bacteria 10346
60 Ga0105240_10399638 3300009093 Bacteria 1548
61 Ga0111539_10019608 3300009094 Bacteria 8344
62 Ga0105245_10051218 3300009098 Bacteria 3701
63 Ga0105247_10027240 3300009101 Bacteria 3456
64 Ga0114129_10210660 3300009147 Bacteria 2627
65 Ga0114129_10488941 3300009147 Bacteria 1609
66 Ga0114129_10548683 3300009147 Bacteria 1503
67 Ga0105241_10068630 3300009174 Bacteria 2747
68 Ga0105237_10036902 3300009545 Bacteria 4943
69 Ga0105239_10050048 3300010375 Bacteria 4583
70 Ga0105246_10007831 3300011119 Bacteria 6554
71 Ga0157373_10063675 3300013100 Bacteria 2611
72 Ga0157370_10118851 3300013104 Bacteria 2468
73 Ga0163162_10032230 3300013306 Bacteria 5203
74 Ga0157372_10000043 3300013307 Bacteria 153958
75 Ga0182008_10011611 3300014497 Bacteria 4678
76 Ga0157377_10001663 3300014745 Bacteria 9688
77 Ga0157379_10053977 3300014968 Bacteria 3591
78 Ga0206356_11249198 3300020070 Bacteria 3691
79 Ga0207692_10053746 3300025898 Bacteria 2053
80 Ga0207710_10043203 3300025900 Bacteria 2004
81 Ga0207688_10010279 3300025901 Bacteria 5093
82 Ga0207699_10021040 3300025906 Bacteria 3508
83 Ga0207645_10045361 3300025907 Bacteria 2810
84 Ga0207643_10000126 3300025908 Bacteria 52316
85 Ga0207705_10007797 3300025909 Bacteria 7859
86 Ga0207707_10025955 3300025912 Bacteria 5122
87 Ga0207693_10051002 3300025915 Bacteria 3248
88 Ga0207662_10022676 3300025918 Bacteria 3602
89 Ga0207657_10020055 3300025919 Bacteria 6332
90 Ga0207649_10054799 3300025920 Bacteria 2483
91 Ga0207652_10020046 3300025921 Bacteria 5506
92 Ga0207694_10013288 3300025924 Bacteria 6200
93 Ga0207650_10003292 3300025925 Bacteria 11116
94 Ga0207659_10015369 3300025926 Bacteria 4958
95 Ga0207644_10019508 3300025931 Bacteria 4600
96 Ga0207690_10087006 3300025932 Bacteria 2198
97 Ga0207706_10005109 3300025933 Bacteria 12250
98 Ga0207691_10027884 3300025940 Bacteria 5292
99 Ga0207711_10031635 3300025941 Bacteria 4468
100 Ga0207689_10006391 3300025942 Bacteria 10431
101 Ga0207661_10018031 3300025944 Bacteria 5240
102 Ga0207679_10060012 3300025945 Bacteria 2824
103 Ga0207667_10082225 3300025949 Bacteria 3336
104 Ga0207667_10323890 3300025949 Bacteria 1574
105 Ga0207678_10000821 3300026067 Bacteria 28462
106 Ga0207708_10000011 3300026075 Bacteria 214227
107 Ga0207702_10002877 3300026078 Bacteria 16096
108 Ga0207702_10024026 3300026078 Bacteria 5057
109 Ga0207702_10291773 3300026078 Bacteria 1545
110 Ga0207641_10016238 3300026088 Bacteria 6097
111 Ga0207648_10058761 3300026089 Bacteria 3353
112 Ga0207676_10012629 3300026095 Bacteria 6058
113 Ga0207683_10000844 3300026121 Bacteria 28105
114 Ga0207698_10017008 3300026142 Bacteria 4922
115 Ga0207698_10222011 3300026142 Bacteria 1708
116 Ga0207428_10001624 3300027907 Bacteria 23341
117 Ga0207428_10037359 3300027907 Bacteria 3951
118 Ga0307512_10003334 3300030522 Bacteria 18844
119 Ga0307513_10002467 3300031456 Bacteria 25604
120 Ga0307405_10082446 3300031731 Bacteria 2105
121 Ga0307410_10003704 3300031852 Bacteria 7733
122 Ga0307410_10011974 3300031852 Bacteria 4989
123 Ga0307410_10025024 3300031852 Bacteria 3738
124 Ga0307406_10001195 3300031901 Bacteria 14526
125 Ga0307406_10025933 3300031901 Bacteria 3513
126 Ga0307407_10000396 3300031903 Bacteria 13225
127 Ga0307407_10009452 3300031903 Bacteria 4542
128 Ga0307409_100001320 3300031995 Bacteria 12024
129 Ga0307409_100012152 3300031995 Bacteria 5471
130 Ga0307409_100049483 3300031995 Bacteria 3205
131 Ga0307409_100128642 3300031995 Bacteria 2159
132 Ga0307409_100252573 3300031995 Bacteria 1613
133 Ga0307416_100012815 3300032002 Bacteria 5670
134 Ga0307416_100034866 3300032002 Bacteria 3836
135 Ga0307416_100094935 3300032002 Bacteria 2573
136 Ga0307416_100108113 3300032002 Bacteria 2442
137 Ga0307414_10005399 3300032004 Bacteria 7036
138 Ga0307411_10024543 3300032005 Bacteria 3596
139 Ga0307411_10068241 3300032005 Bacteria 2396
140 Ga0307415_100001821 3300032126 Bacteria 10443
141 Ga0307415_100002930 3300032126 Bacteria 8563
142 Ga0307415_100070560 3300032126 Bacteria 2453
143 Ga0395898_0011157 3300037466 Bacteria 9356
144 Ga0395898_0131973 3300037466 Bacteria 2392
145 Ga0395905_0091028 3300037471 Bacteria 2860
146 Ga0395901_0016431 3300038443 Bacteria 7538
147 Ga0395901_0026527 3300038443 Bacteria 5949
148 Ga0395901_0255011 3300038443 Bacteria 1827
149 Ga0439443_004328 3300042003 Bacteria 1842
150 Ga0439448_0000825 3300042005 Bacteria 7542
151 Ga0439450_000281 3300042008 Bacteria 6252
152 Ga0439454_001510 3300042011 Bacteria 2257
153 Ga0439455_0004994 3300042012 Bacteria 2668
154 Ga0439463_001117 3300042016 Bacteria 7193
155 Ga0439435_0002895 3300042436 Bacteria 3487
156 Ga0439444_0002316 3300042437 Bacteria 2588
157 Ga0439444_0002516 3300042437 Bacteria 2512
158 Ga0439464_0000258 3300042439 Bacteria 9834
159 Ga0439460_0005520 3300042461 Bacteria 3108
160 Ga0450916_000302 3300042530 Bacteria 3952
161 Ga0439440_0000041 3300042993 Bacteria 16365
162 Ga0466965_0105721 3300044683 Bacteria 1443
163 Ga0466961_0024468 3300044693 Bacteria 3884
164 Ga0466963_0011707 3300044694 Bacteria 5348
165 Ga0466963_0035058 3300044694 Bacteria 3267
166 Ga0466964_0025175 3300044706 Bacteria 2322
167 Ga0466971_0025009 3300044719 Bacteria 2667
168 Ga0466971_0082084 3300044719 Bacteria 1471
169 Ga0466970_0007402 3300044765 Bacteria 5500
170 Ga0466957_0030805 3300044842 Bacteria 3203
171 Ga0466957_0120531 3300044842 Bacteria 1672
172 Ga0466960_0018727 3300044901 Bacteria 3039
173 Ga0466960_0018967 3300044901 Bacteria 3023
174 Ga0466959_0050287 3300045049 Bacteria 3060
175 Ga0466959_0103234 3300045049 Bacteria 2040
176 Ga0466959_0127198 3300045049 Bacteria 1808
177 Ga0466959_0175552 3300045049 Bacteria 1501
178 Ga0466958_0001232 3300045836 Bacteria 11992
179 Ga0466958_0018157 3300045836 Bacteria 4077
180 Ga0466958_0055411 3300045836 Bacteria 2406
181 Ga0466967_0008874 3300045976 Bacteria 7414
182 Ga0466967_0009810 3300045976 Bacteria 7141
183 Ga0495592_0083333 3300046454 Bacteria 2309
184 Ga0495605_0011120 3300046474 Bacteria 5028
185 Ga0495594_0050215 3300046499 Bacteria 2294
186 Ga0495620_0004439 3300046515 Bacteria 7909
187 Ga0495631_0054165 3300046518 Bacteria 1750
188 Ga0495643_0008421 3300046522 Bacteria 6528
189 Ga0495648_0030461 3300046524 Bacteria 3567
190 Ga0495652_0030582 3300046529 Bacteria 4721
191 Ga0495597_0014254 3300046542 Bacteria 3788
192 Ga0495656_0019830 3300046615 Bacteria 2600
193 Ga0495668_0029528 3300046616 Bacteria 3097
194 Ga0495624_0073378 3300046690 Bacteria 2127
195 Ga0495649_0010517 3300046694 Bacteria 5455
196 Ga0495589_0007693 3300046794 Bacteria 5640
197 Ga0495687_013416 3300047443 Bacteria 4279
198 Ga0495685_023784 3300047447 Bacteria 2110
199 Ga0495593_0015849 3300047673 Bacteria 4258
200 Ga0496101_0011436 3300048904 Bacteria 5889
201 Ga0496102_0048432 3300048905 Bacteria 3864
202 Ga0496104_0022800 3300048907 Bacteria 5751
203 Ga0496105_0050628 3300048908 Bacteria 3431
204 Ga0496106_0009849 3300048909 Bacteria 7057
205 Ga0496107_0021980 3300048910 Bacteria 4506
206 Ga0496108_0009344 3300048911 Bacteria 7939
207 Ga0496110_0001863 3300048913 Bacteria 15575
208 Ga0496111_0010154 3300048914 Bacteria 6304
209 Ga0496112_0043821 3300048915 Bacteria 4381
210 Ga0496112_0244560 3300048915 Bacteria 1746
211 Ga0496113_0026679 3300048916 Bacteria 4133
212 Ga0496113_0034905 3300048916 Bacteria 3673
213 Ga0496114_0016099 3300048917 Bacteria 6018
214 Ga0496116_0001319 3300048919 Bacteria 28310
215 Ga0496118_0006052 3300048921 Bacteria 13477
216 Ga0496118_0055161 3300048921 Bacteria 3002
217 Ga0496119_0014161 3300048922 Bacteria 6266
218 Ga0501031_0001618 3300049568 Bacteria 14079
219 Ga0501031_0012220 3300049568 Bacteria 5597
220 Ga0501031_0032844 3300049568 Bacteria 3384
221 Ga0501031_0047549 3300049568 Bacteria 2797
222 Ga0501032_0013624 3300049569 Bacteria 5776
223 Ga0501032_0064624 3300049569 Bacteria 2449
224 Ga0501033_0030737 3300049570 Bacteria 4035
225 Ga0501033_0067677 3300049570 Bacteria 2626
226 Ga0501033_0076556 3300049570 Bacteria 2456
227 Ga0501034_0091028 3300049571 Bacteria 3048
228 Ga0501034_0161878 3300049571 Bacteria 2208
229 Ga0501034_0162149 3300049571 Bacteria 2206
230 Ga0501034_0237296 3300049571 Bacteria 1771
231 Ga0501036_0000173 3300049572 Bacteria 42312
232 Ga0501036_0002518 3300049572 Bacteria 14377
233 Ga0501036_0039673 3300049572 Bacteria 3984
234 Ga0501036_0085484 3300049572 Bacteria 2666
235 Ga0501036_0152465 3300049572 Bacteria 1949
236 Ga0501037_0043873 3300049573 Bacteria 3286
237 Ga0501037_0079952 3300049573 Bacteria 2373
238 Ga0501037_0098836 3300049573 Bacteria 2108
239 Ga0501038_0002795 3300049574 Bacteria 16242
240 Ga0501038_0017260 3300049574 Bacteria 6523
241 Ga0501039_0000296 3300049575 Bacteria 35355
242 Ga0501039_0002109 3300049575 Bacteria 14725
243 Ga0501039_0052122 3300049575 Bacteria 3166
244 Ga0501040_0000043 3300049576 Bacteria 58077
245 Ga0501040_0000156 3300049576 Bacteria 37580
246 Ga0501040_0100962 3300049576 Bacteria 2012
247 Ga0501041_0000533 3300049577 Bacteria 19652
248 Ga0501041_0004552 3300049577 Bacteria 8044
249 Ga0501042_0000251 3300049578 Bacteria 26158
250 Ga0501042_0000443 3300049578 Bacteria 21205
251 Ga0501042_0019542 3300049578 Bacteria 4706
252 Ga0501043_0002108 3300049579 Bacteria 16979
253 Ga0501043_0022240 3300049579 Bacteria 4974
254 Ga0501043_0055114 3300049579 Bacteria 3123
255 Ga0501043_0086013 3300049579 Bacteria 2470
256 Ga0501046_0001173 3300049580 Bacteria 25488
257 Ga0501046_0001509 3300049580 Bacteria 22194
258 Ga0501046_0035204 3300049580 Bacteria 4036
259 Ga0501047_0006189 3300049581 Bacteria 11254
260 Ga0501047_0008380 3300049581 Bacteria 9758
261 Ga0501047_0030306 3300049581 Bacteria 5216
262 Ga0501047_0051228 3300049581 Bacteria 3988
263 Ga0501047_0059717 3300049581 Bacteria 3682
264 Ga0501047_0067138 3300049581 Bacteria 3457
265 Ga0501047_0109765 3300049581 Bacteria 2641
266 Ga0501048_0000980 3300049582 Bacteria 21151
267 Ga0501048_0001117 3300049582 Bacteria 20152
268 Ga0501048_0005805 3300049582 Bacteria 9389
269 Ga0501068_0015961 3300049584 Bacteria 4326
270 Ga0501068_0029601 3300049584 Bacteria 3243
271 Ga0501069_0018200 3300049585 Bacteria 3790
272 Ga0501071_0000125 3300049587 Bacteria 30943
273 Ga0501071_0010490 3300049587 Bacteria 6211
274 Ga0501072_0019558 3300049588 Bacteria 5236
275 Ga0501074_0001895 3300049590 Bacteria 14365
276 Ga0501074_0002820 3300049590 Bacteria 12163
277 Ga0501074_0039491 3300049590 Bacteria 3418
278 Ga0501075_0000330 3300049591 Bacteria 26716
279 Ga0501075_0012150 3300049591 Bacteria 6113
280 Ga0501075_0032618 3300049591 Bacteria 3870
281 Ga0501076_0000405 3300049592 Bacteria 26951
282 Ga0501076_0012561 3300049592 Bacteria 6335
283 Ga0501076_0022089 3300049592 Bacteria 4887
284 Ga0501077_0000836 3300049593 Bacteria 18631
285 Ga0501079_0000196 3300049741 Bacteria 35038
286 Ga0501079_0000574 3300049741 Bacteria 24275
287 Ga0501080_0051993 3300049742 Bacteria 3813
288 Ga0501081_0001449 3300049743 Bacteria 14521
289 Ga0501081_0015754 3300049743 Bacteria 4991
290 Ga0501035_0008802 3300049822 Bacteria 9401
291 Ga0501035_0036662 3300049822 Bacteria 4443
292 Ga0501035_0187874 3300049822 Bacteria 1777
293 Ga0501044_0019727 3300049823 Bacteria 7204
294 Ga0501044_0129630 3300049823 Bacteria 2517
295 Ga0501045_0000314 3300049824 Bacteria 28309
296 Ga0501045_0000933 3300049824 Bacteria 19093
297 Ga0501045_0009609 3300049824 Bacteria 6770
298 Ga0501045_0051091 3300049824 Bacteria 3017
299 nmdc:mga09592_12370_c1 3300050508 Bacteria 6951
300 nmdc:mga09592_125478_c1 3300050508 Bacteria 2206
301 nmdc:mga08y16_15093_c1 3300050511 Bacteria 8123
302 nmdc:mga08y16_21637_c1 3300050511 Bacteria 6790
303 nmdc:mga0n895_3433_c1 3300050512 Bacteria 12787
304 nmdc:mga0rr50_66283_c1 3300050513 Bacteria 2739
305 nmdc:mga0a205_15739_c1 3300050515 Bacteria 7070
306 nmdc:mga0a205_92027_c1 3300050515 Bacteria 2931
307 Ga0500644_0004664 3300053088 Bacteria 3438
308 Ga0500600_0054565 3300053149 Bacteria 2252
309 Ga0501084_0002166 3300054114 Bacteria 15732
310 Ga0501084_0006013 3300054114 Bacteria 9977
311 Ga0501082_0000347 3300060353 Bacteria 40918
312 Ga0501082_0000420 3300060353 Bacteria 37552
313 Ga0501082_0123034 3300060353 Bacteria 2249
314 Ga0466962_0043296 3300061719 Bacteria 2154
315 Ga0530510_0000061 3300061734 Bacteria 52912
316 Ga0530510_0010833 3300061734 Bacteria 6395
317 Ga0530510_0061664 3300061734 Bacteria 2715
318 2517764602 2517572101 Bacteria 6884336
319 2676489935 2675903060 Bacteria 10051191
320 2731907335 2731639228 Bacteria 4187555
321 2772641470 2772190715 Bacteria 6959372
322 2799183872 2799112218 Bacteria 4315149
323 2855676548 2855670206 Bacteria 7120389
324 2855683402 2855676851 Bacteria 7063653
325 2856746442 2856741275 Bacteria 8096094
326 2857294982 2857288857 Bacteria 7189066
327 2858852146 2858848962 Bacteria 6963058
328 2858888338 2858882152 Bacteria 7230291
329 2858893253 2858888857 Bacteria 7060307
330 2858899096 2858895516 Bacteria 7378898
331 2867313510 2867312974 Bacteria 7058875
332 2867322668 2867319477 Bacteria 7069771
333 2867370391 2867369537 Bacteria 6501581
334 2869055289 2869048445 Bacteria 6875584
335 2869062568 2869061728 Bacteria 7112407
336 2869074563 2869068681 Bacteria 7205615
337 2873314393 2873314349 Bacteria 8512634
338 2880493976 2880489317 Bacteria 7096270
339 2880498364 2880495981 Bacteria 7340502
340 2884694766 2884693830 Bacteria 11273186
341 2891403736 2891395885 Bacteria 9251614
342 2891559771 2891554331 Bacteria 8812224
343 2891568482 2891562705 Bacteria 8039471
344 2895436369 2895427314 Bacteria 13147766
345 2895447198 2895442618 Bacteria 11027144
346 2929220394 2929219909 Bacteria 6984360
347 2929226949 2929226422 Bacteria 7248583
348 3003005544 3002998708 Bacteria 11715108
349 8002790372 8002784119 Bacteria 9788632
350 8003835783 8003830390 Bacteria 6541657
351 8053945847 8053945823 Bacteria 8962862
352 8054710073 8054704163 Bacteria 7247792
353 8054728288 8054727385 Bacteria 7558670
354 8054735321 8054734606 Bacteria 6947278
355 8055071178 8055066027 Bacteria 9479577
356 8055175979 8055172936 Bacteria 9305943
357 Ga0496121_0024735
358 rootH1_10077758
359 Ga0070676_10045912
360 Ga0070670_100031412
361 Ga0070680_100050170
362 Ga0070682_100005154
363 Ga0068868_100009234
364 Ga0070691_10002512
365 Ga0070687_100040473
366 Ga0070692_10009917
367 Ga0070668_100038647
368 Ga0070675_100026137
369 Ga0070671_100045128
370 Ga0070659_100119333
371 Ga0070667_100027507
372 Ga0070714_100049718
373 Ga0070710_10043274
374 Ga0070711_100186975
375 Ga0070700_100000218
376 Ga0070700_100045126
377 Ga0070663_100011135
378 Ga0070678_100015518
379 Ga0070662_100027469
380 Ga0070681_10004529
381 Ga0070685_10083481
382 Ga0070684_100096244
383 Ga0070693_100008393
384 Ga0070704_100116037
385 Ga0068855_100058435
386 Ga0068854_100092539
387 Ga0068856_100013117
388 Ga0068856_100018011
389 Ga0070702_100008822
390 Ga0068859_100003593
391 Ga0068859_100022772
392 Ga0068861_100020662
393 Ga0068870_10007303
394 Ga0068863_100000326
395 Ga0068863_100002558
396 Ga0068860_100092901
397 Ga0081455_10003985
398 Ga0081538_10001722
399 Ga0081538_10013347
400 Ga0081538_10015299
401 Ga0081539_10000638
402 Ga0081539_10008555
403 Ga0081539_10009590
404 Ga0070717_10095591
405 Ga0075365_10132911
406 Ga0097621_100213620
407 Ga0068871_100087817
408 Ga0075430_100000905
409 Ga0075433_10016370
410 Ga0075433_10049728
411 Ga0075434_100005990
412 Ga0075429_100179472
413 Ga0097620_100003593
414 Ga0097620_100022772
415 Ga0075435_100003754
416 Ga0105240_10399638
417 Ga0111539_10019608
418 Ga0105245_10051218
419 Ga0105247_10027240
420 Ga0114129_10210660
421 Ga0114129_10488941
422 Ga0114129_10548683
423 Ga0105241_10068630
424 Ga0105237_10036902
425 Ga0105239_10050048
426 Ga0105246_10007831
427 Ga0157373_10063675
428 Ga0157370_10118851
429 Ga0163162_10032230
430 Ga0157372_10000043
431 Ga0182008_10011611
432 Ga0157377_10001663
433 Ga0157379_10053977
434 Ga0206356_11249198
435 Ga0207692_10053746
436 Ga0207710_10043203
437 Ga0207688_10010279
438 Ga0207699_10021040
439 Ga0207645_10045361
440 Ga0207643_10000126
441 Ga0207705_10007797
442 Ga0207707_10025955
443 Ga0207693_10051002
444 Ga0207662_10022676
445 Ga0207657_10020055
446 Ga0207649_10054799
447 Ga0207652_10020046
448 Ga0207694_10013288
449 Ga0207650_10003292
450 Ga0207659_10015369
451 Ga0207644_10019508
452 Ga0207690_10087006
453 Ga0207706_10005109
454 Ga0207691_10027884
455 Ga0207711_10031635
456 Ga0207689_10006391
457 Ga0207661_10018031
458 Ga0207679_10060012
459 Ga0207667_10082225
460 Ga0207667_10323890
461 Ga0207678_10000821
462 Ga0207708_10000011
463 Ga0207702_10002877
464 Ga0207702_10024026
465 Ga0207702_10291773
466 Ga0207641_10016238
467 Ga0207648_10058761
468 Ga0207676_10012629
469 Ga0207683_10000844
470 Ga0207698_10017008
471 Ga0207698_10222011
472 Ga0207428_10001624
473 Ga0207428_10037359
474 Ga0307512_10003334
475 Ga0307513_10002467
476 Ga0307405_10082446
477 Ga0307410_10003704
478 Ga0307410_10011974
479 Ga0307410_10025024
480 Ga0307406_10001195
481 Ga0307406_10025933
482 Ga0307407_10000396
483 Ga0307407_10009452
484 Ga0307409_100001320
485 Ga0307409_100012152
486 Ga0307409_100049483
487 Ga0307409_100128642
488 Ga0307409_100252573
489 Ga0307416_100012815
490 Ga0307416_100034866
491 Ga0307416_100094935
492 Ga0307416_100108113
493 Ga0307414_10005399
494 Ga0307411_10024543
495 Ga0307411_10068241
496 Ga0307415_100001821
497 Ga0307415_100002930
498 Ga0307415_100070560
499 Ga0395898_0011157
500 Ga0395898_0131973
501 Ga0395905_0091028
502 Ga0395901_0016431
503 Ga0395901_0026527
504 Ga0395901_0255011
505 Ga0439443_004328
506 Ga0439448_0000825
507 Ga0439450_000281
508 Ga0439454_001510
509 Ga0439455_0004994
510 Ga0439463_001117
511 Ga0439435_0002895
512 Ga0439444_0002316
513 Ga0439444_0002516
514 Ga0439464_0000258
515 Ga0439460_0005520
516 Ga0450916_000302
517 Ga0439440_0000041
518 Ga0466965_0105721
519 Ga0466961_0024468
520 Ga0466963_0011707
521 Ga0466963_0035058
522 Ga0466964_0025175
523 Ga0466971_0025009
524 Ga0466971_0082084
525 Ga0466970_0007402
526 Ga0466957_0030805
527 Ga0466957_0120531
528 Ga0466960_0018727
529 Ga0466960_0018967
530 Ga0466959_0050287
531 Ga0466959_0103234
532 Ga0466959_0127198
533 Ga0466959_0175552
534 Ga0466958_0001232
535 Ga0466958_0018157
536 Ga0466958_0055411
537 Ga0466967_0008874
538 Ga0466967_0009810
539 Ga0495592_0083333
540 Ga0495605_0011120
541 Ga0495594_0050215
542 Ga0495620_0004439
543 Ga0495631_0054165
544 Ga0495643_0008421
545 Ga0495648_0030461
546 Ga0495652_0030582
547 Ga0495597_0014254
548 Ga0495656_0019830
549 Ga0495668_0029528
550 Ga0495624_0073378
551 Ga0495649_0010517
552 Ga0495589_0007693
553 Ga0495687_013416
554 Ga0495685_023784
555 Ga0495593_0015849
556 Ga0496101_0011436
557 Ga0496102_0048432
558 Ga0496104_0022800
559 Ga0496105_0050628
560 Ga0496106_0009849
561 Ga0496107_0021980
562 Ga0496108_0009344
563 Ga0496110_0001863
564 Ga0496111_0010154
565 Ga0496112_0043821
566 Ga0496112_0244560
567 Ga0496113_0026679
568 Ga0496113_0034905
569 Ga0496114_0016099
570 Ga0496116_0001319
571 Ga0496118_0006052
572 Ga0496118_0055161
573 Ga0496119_0014161
574 Ga0501031_0001618
575 Ga0501031_0012220
576 Ga0501031_0032844
577 Ga0501031_0047549
578 Ga0501032_0013624
579 Ga0501032_0064624
580 Ga0501033_0030737
581 Ga0501033_0067677
582 Ga0501033_0076556
583 Ga0501034_0091028
584 Ga0501034_0161878
585 Ga0501034_0162149
586 Ga0501034_0237296
587 Ga0501036_0000173
588 Ga0501036_0002518
589 Ga0501036_0039673
590 Ga0501036_0085484
591 Ga0501036_0152465
592 Ga0501037_0043873
593 Ga0501037_0079952
594 Ga0501037_0098836
595 Ga0501038_0002795
596 Ga0501038_0017260
597 Ga0501039_0000296
598 Ga0501039_0002109
599 Ga0501039_0052122
600 Ga0501040_0000043
601 Ga0501040_0000156
602 Ga0501040_0100962
603 Ga0501041_0000533
604 Ga0501041_0004552
605 Ga0501042_0000251
606 Ga0501042_0000443
607 Ga0501042_0019542
608 Ga0501043_0002108
609 Ga0501043_0022240
610 Ga0501043_0055114
611 Ga0501043_0086013
612 Ga0501046_0001173
613 Ga0501046_0001509
614 Ga0501046_0035204
615 Ga0501047_0006189
616 Ga0501047_0008380
617 Ga0501047_0030306
618 Ga0501047_0051228
619 Ga0501047_0059717
620 Ga0501047_0067138
621 Ga0501047_0109765
622 Ga0501048_0000980
623 Ga0501048_0001117
624 Ga0501048_0005805
625 Ga0501068_0015961
626 Ga0501068_0029601
627 Ga0501069_0018200
628 Ga0501071_0000125
629 Ga0501071_0010490
630 Ga0501072_0019558
631 Ga0501074_0001895
632 Ga0501074_0002820
633 Ga0501074_0039491
634 Ga0501075_0000330
635 Ga0501075_0012150
636 Ga0501075_0032618
637 Ga0501076_0000405
638 Ga0501076_0012561
639 Ga0501076_0022089
640 Ga0501077_0000836
641 Ga0501079_0000196
642 Ga0501079_0000574
643 Ga0501080_0051993
644 Ga0501081_0001449
645 Ga0501081_0015754
646 Ga0501035_0008802
647 Ga0501035_0036662
648 Ga0501035_0187874
649 Ga0501044_0019727
650 Ga0501044_0129630
651 Ga0501045_0000314
652 Ga0501045_0000933
653 Ga0501045_0009609
654 Ga0501045_0051091
655 nmdc:mga09592_12370_c1
656 nmdc:mga09592_125478_c1
657 nmdc:mga08y16_15093_c1
658 nmdc:mga08y16_21637_c1
659 nmdc:mga0n895_3433_c1
660 nmdc:mga0rr50_66283_c1
661 nmdc:mga0a205_15739_c1
662 nmdc:mga0a205_92027_c1
663 Ga0500644_0004664
664 Ga0500600_0054565
665 Ga0501084_0002166
666 Ga0501084_0006013
667 Ga0501082_0000347
668 Ga0501082_0000420
669 Ga0501082_0123034
670 Ga0466962_0043296
671 Ga0530510_0000061
672 Ga0530510_0010833
673 Ga0530510_0061664
674 2517764602
675 2676489935
676 2731907335
677 2772641470
678 2799183872
679 2855676548
680 2855683402
681 2856746442
682 2857294982
683 2858852146
684 2858888338
685 2858893253
686 2858899096
687 2867313510
688 2867322668
689 2867370391
690 2869055289
691 2869062568
692 2869074563
693 2873314393
694 2880493976
695 2880498364
696 2884694766
697 2891403736
698 2891559771
699 2891568482
700 2895436369
701 2895447198
702 2929220394
703 2929226949
704 3003005544
705 8002790372
706 8003835783
707 8053945847
708 8054710073
709 8054728288
710 8054735321
711 8055071178
712 8055175979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

23

430

0.93

PF07690

MFS_1

Major Facilitator Superfamily

36

262

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dla-assembly1.cif.gz_A crystal structure of nucleoside transporter nupg (d323a mutant) 0.7631 11 389
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.7491 10 380
6vs2-assembly1.cif.gz_A protein d 0.7448 12 384
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.741 11 400
8d2w-assembly1.cif.gz_A zebrafish mfsd2a isoform b in inward open ligand 2b conformation 0.7404 14 399
ID Description Score Start End Superfamily
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8871 11 390 1.20.1250.20
af_P9WJX9_220_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8682 211 387 1.20.1250.20
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8673 11 390 1.20.1250.20
af_Q6DBX0_304_491_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.853 201 383 1.20.1250.20
af_Q4D047_16_187_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8437 218 381 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7X4BYP6-F1-model_v4 MFS transporter 0.9019 4 389 GO:0005886
GO:0022857
AF-A0A7C6QHG2-F1-model_v4 MFS transporter 0.8935 4 391 GO:0005886
GO:0022857
AF-A0A849TXH7-F1-model_v4 MFS transporter 0.8914 5 385 GO:0005886
GO:0022857
AF-A0A6N9R8W5-F1-model_v4 MFS transporter 0.8873 6 349 GO:0005886
GO:0022857
AF-A0A841H5E9-F1-model_v4 MFS family permease 0.8848 4 391 GO:0005886
GO:0022857

Map