F420391

General Info

Members Datasets Scaffolds Average Seq Length
356 197 356 221

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100090217|Ga0070683_1000902172
Length 255
Sequence MGARGLEKPSPEPCNDRIYVDCRVPRALNPSPFFVADSSKKKRSPYTKDRGTLGAFEGETITRRRLITGGALAAXXVATAAVGLPALGFALGPVFEKTEHQGWQDVGPEADFNPSTYVPKVITIDPNIGEAGKTTIYVRRATDKDRSPSDKGKAPLPYVAISTRCAHLGCPVRYVQAAERFICPCHGGVYDSQGKVVGGPPVRPLDRFYTRVVAGRVQVGQRFSVNSKLERFSPRDPSNHLDGLWQYLYPSRPTT

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
87 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
113 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
114 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 2.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 11.52
Rhizosphere 84.83
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001648 3300000549 Bacteria 3282
2 JGI25407J50210_10001313 3300003373 Bacteria 5587
3 JGI25407J50210_10002380 3300003373 Bacteria 4423
4 Ga0070676_10545928 3300005328 Bacteria 829
5 Ga0070683_100090217 3300005329 Bacteria 2877
6 Ga0070683_100275533 3300005329 Bacteria 1600
7 Ga0070680_100008825 3300005336 Bacteria 7731
8 Ga0070680_100806721 3300005336 Bacteria 809
9 Ga0070682_100066697 3300005337 Bacteria 2290
10 Ga0068868_100335300 3300005338 Bacteria 1292
11 Ga0068868_100528072 3300005338 Bacteria 1037
12 Ga0070691_10171321 3300005341 Bacteria 1125
13 Ga0070661_100006067 3300005344 Bacteria 8316
14 Ga0070671_100327310 3300005355 Bacteria 1306
15 Ga0070659_100070582 3300005366 Bacteria 2775
16 Ga0070709_10068835 3300005434 Bacteria 2278
17 Ga0070714_100209580 3300005435 Bacteria 1786
18 Ga0070713_100010729 3300005436 Bacteria 6635
19 Ga0070713_100224001 3300005436 Bacteria 1707
20 Ga0070710_10003912 3300005437 Bacteria 7057
21 Ga0070711_100000405 3300005439 Bacteria 22335
22 Ga0070711_100079695 3300005439 Bacteria 2330
23 Ga0070711_100193374 3300005439 Bacteria 1565
24 Ga0070663_100616883 3300005455 Bacteria 914
25 Ga0070681_10007190 3300005458 Bacteria 10848
26 Ga0070685_10268974 3300005466 Bacteria 1137
27 Ga0070679_100003327 3300005530 Bacteria 14715
28 Ga0070679_100831173 3300005530 Bacteria 867
29 Ga0070684_100321293 3300005535 Bacteria 1422
30 Ga0068853_100083492 3300005539 Bacteria 2799
31 Ga0070696_100522987 3300005546 Bacteria 947
32 Ga0068855_100169170 3300005563 Bacteria 2476
33 Ga0068857_100058653 3300005577 Bacteria 3419
34 Ga0068856_100016566 3300005614 Bacteria 7134
35 Ga0068856_100052759 3300005614 Bacteria 4011
36 Ga0068856_100466242 3300005614 Bacteria 1284
37 Ga0068856_101164392 3300005614 Bacteria 788
38 Ga0068852_100066510 3300005616 Bacteria 3147
39 Ga0068864_100516466 3300005618 Bacteria 1151
40 Ga0081455_10009917 3300005937 Bacteria 9744
41 Ga0081538_10000013 3300005981 Bacteria 151925
42 Ga0081538_10000027 3300005981 Bacteria 125924
43 Ga0081538_10001407 3300005981 Bacteria 24723
44 Ga0081538_10004036 3300005981 Bacteria 13655
45 Ga0081538_10007118 3300005981 Bacteria 9718
46 Ga0081538_10007244 3300005981 Bacteria 9619
47 Ga0081538_10007380 3300005981 Bacteria 9520
48 Ga0081538_10014100 3300005981 Bacteria 6280
49 Ga0081538_10029388 3300005981 Bacteria 3755
50 Ga0081538_10030723 3300005981 Bacteria 3640
51 Ga0081538_10046345 3300005981 Bacteria 2682
52 Ga0081538_10068197 3300005981 Bacteria 1980
53 Ga0081540_1000551 3300005983 Bacteria 36299
54 Ga0075432_10003667 3300006058 Bacteria 5230
55 Ga0070716_100108374 3300006173 Bacteria 1716
56 Ga0070712_100044602 3300006175 Bacteria 3058
57 Ga0070712_100217041 3300006175 Bacteria 1512
58 Ga0070712_100369865 3300006175 Bacteria 1178
59 Ga0075428_100205637 3300006844 Bacteria 2127
60 Ga0075428_100258223 3300006844 Bacteria 1877
61 Ga0075428_100307894 3300006844 Bacteria 1703
62 Ga0075428_100434941 3300006844 Bacteria 1406
63 Ga0075428_100617197 3300006844 Bacteria 1157
64 Ga0075430_100004531 3300006846 Bacteria 11701
65 Ga0075430_100006972 3300006846 Bacteria 9526
66 Ga0075430_100108922 3300006846 Bacteria 2310
67 Ga0075430_100240429 3300006846 Bacteria 1500
68 Ga0075430_100316208 3300006846 Bacteria 1291
69 Ga0075431_100027253 3300006847 Bacteria 5861
70 Ga0075431_100126006 3300006847 Bacteria 2642
71 Ga0075431_100365056 3300006847 Bacteria 1450
72 Ga0075433_10391782 3300006852 Bacteria 1226
73 Ga0075434_101118081 3300006871 Unclassified 801
74 Ga0075429_100023625 3300006880 Bacteria 5334
75 Ga0105240_10110985 3300009093 Bacteria 3318
76 Ga0111539_10019441 3300009094 Bacteria 8383
77 Ga0111539_10330998 3300009094 Bacteria 1773
78 Ga0111539_10857013 3300009094 Bacteria 1057
79 Ga0105245_10045611 3300009098 Bacteria 3915
80 Ga0105245_10161330 3300009098 Bacteria 2128
81 Ga0105245_11281467 3300009098 Bacteria 782
82 Ga0114129_10084694 3300009147 Bacteria 4401
83 Ga0114129_10131469 3300009147 Bacteria 3437
84 Ga0114129_10307917 3300009147 Bacteria 2109
85 Ga0105237_10000570 3300009545 Bacteria 51568
86 Ga0105237_10050352 3300009545 Bacteria 4185
87 Ga0105238_10207964 3300009551 Bacteria 1933
88 Ga0157370_10011051 3300013104 Bacteria 9468
89 Ga0157369_10028494 3300013105 Bacteria 6182
90 Ga0157369_10151260 3300013105 Bacteria 2453
91 Ga0157372_10040278 3300013307 Bacteria 5159
92 Ga0157372_10205217 3300013307 Bacteria 2284
93 Ga0163163_10080567 3300014325 Bacteria 3256
94 Ga0163163_10142196 3300014325 Bacteria 2442
95 Ga0163163_10464183 3300014325 Bacteria 1327
96 Ga0157380_10253813 3300014326 Bacteria 1593
97 Ga0157379_10001599 3300014968 Bacteria 18677
98 Ga0197907_10931326 3300020069 Bacteria 773
99 Ga0206356_10327084 3300020070 Bacteria 2033
100 Ga0206349_1346323 3300020075 Bacteria 1019
101 Ga0206351_10043517 3300020077 Bacteria 999
102 Ga0206354_10229405 3300020081 Bacteria 3522
103 Ga0206354_11398881 3300020081 Bacteria 1167
104 Ga0206353_11411494 3300020082 Bacteria 1271
105 Ga0206353_11522601 3300020082 Bacteria 5028
106 Ga0213874_10001235 3300021377 Bacteria 5264
107 Ga0213876_10005122 3300021384 Bacteria 7228
108 Ga0213876_10031544 3300021384 Bacteria 2796
109 Ga0224712_10242948 3300022467 Bacteria 830
110 Ga0207692_10002495 3300025898 Bacteria 7069
111 Ga0207692_10214954 3300025898 Bacteria 1137
112 Ga0207699_10043118 3300025906 Bacteria 2619
113 Ga0207705_10175952 3300025909 Bacteria 1613
114 Ga0207707_10062940 3300025912 Bacteria 3229
115 Ga0207671_10000491 3300025914 Bacteria 53763
116 Ga0207671_10063308 3300025914 Bacteria 2748
117 Ga0207693_10008731 3300025915 Bacteria 8283
118 Ga0207693_10069761 3300025915 Bacteria 2750
119 Ga0207693_10132357 3300025915 Bacteria 1960
120 Ga0207693_10263296 3300025915 Bacteria 1352
121 Ga0207693_10292445 3300025915 Bacteria 1277
122 Ga0207663_10000240 3300025916 Bacteria 24147
123 Ga0207660_10008920 3300025917 Bacteria 6488
124 Ga0207649_10007634 3300025920 Bacteria 5881
125 Ga0207652_10004034 3300025921 Bacteria 11985
126 Ga0207694_10122044 3300025924 Bacteria 2081
127 Ga0207687_10645794 3300025927 Bacteria 895
128 Ga0207700_10013851 3300025928 Bacteria 5265
129 Ga0207644_10230065 3300025931 Bacteria 1473
130 Ga0207690_10215395 3300025932 Bacteria 1466
131 Ga0207665_10039220 3300025939 Bacteria 3157
132 Ga0207661_10003963 3300025944 Bacteria 10341
133 Ga0207661_10098963 3300025944 Bacteria 2445
134 Ga0207679_10022668 3300025945 Bacteria 4280
135 Ga0207667_10394370 3300025949 Bacteria 1409
136 Ga0207639_10069307 3300026041 Bacteria 2751
137 Ga0207678_10539788 3300026067 Bacteria 1019
138 Ga0207702_10123905 3300026078 Bacteria 2317
139 Ga0207698_10029483 3300026142 Bacteria 3931
140 Ga0207428_10052877 3300027907 Bacteria 3241
141 Ga0207428_10392065 3300027907 Bacteria 1017
142 Ga0265337_1003639 3300028556 Bacteria 6616
143 Ga0265326_10000328 3300028558 Bacteria 20400
144 Ga0265319_1000059 3300028563 Bacteria 86975
145 Ga0265319_1000125 3300028563 Bacteria 57338
146 Ga0265319_1036428 3300028563 Bacteria 1682
147 Ga0265318_10001579 3300028577 Bacteria 13183
148 Ga0265318_10032624 3300028577 Bacteria 2014
149 Ga0265318_10055648 3300028577 Bacteria 1480
150 Ga0265322_10005924 3300028654 Bacteria 3602
151 Ga0265322_10080843 3300028654 Bacteria 922
152 Ga0265336_10000017 3300028666 Bacteria 231370
153 Ga0265336_10128953 3300028666 Bacteria 753
154 Ga0265338_10000044 3300028800 Bacteria 223643
155 Ga0265338_10011035 3300028800 Bacteria 10485
156 Ga0265338_10084009 3300028800 Bacteria 2660
157 Ga0265338_10307100 3300028800 Bacteria 1152
158 Ga0265324_10009676 3300029957 Bacteria 3752
159 Ga0265328_10094601 3300031239 Unclassified 1105
160 Ga0265320_10093790 3300031240 Bacteria 1388
161 Ga0265340_10000003 3300031247 Bacteria 320583
162 Ga0265339_10081787 3300031249 Bacteria 1706
163 Ga0265327_10002548 3300031251 Bacteria 18951
164 Ga0265327_10019013 3300031251 Bacteria 4239
165 Ga0265327_10038200 3300031251 Bacteria 2622
166 Ga0265316_10051074 3300031344 Bacteria 3249
167 Ga0265313_10151930 3300031595 Bacteria 989
168 Ga0265314_10072978 3300031711 Bacteria 2290
169 Ga0307405_10274350 3300031731 Bacteria 1266
170 Ga0307413_10143938 3300031824 Bacteria 1651
171 Ga0307410_10009348 3300031852 Bacteria 5494
172 Ga0307410_10030286 3300031852 Bacteria 3457
173 Ga0307410_10230520 3300031852 Bacteria 1430
174 Ga0307410_10491339 3300031852 Bacteria 1008
175 Ga0307406_10134060 3300031901 Bacteria 1743
176 Ga0307406_10267656 3300031901 Unclassified 1296
177 Ga0307412_10264024 3300031911 Bacteria 1344
178 Ga0307409_100006101 3300031995 Bacteria 7043
179 Ga0307409_100112684 3300031995 Bacteria 2284
180 Ga0307409_100262949 3300031995 Bacteria 1584
181 Ga0307409_100840834 3300031995 Bacteria 928
182 Ga0307416_100122351 3300032002 Bacteria 2322
183 Ga0307416_100331136 3300032002 Bacteria 1530
184 Ga0307416_100411836 3300032002 Bacteria 1393
185 Ga0307416_100426166 3300032002 Bacteria 1372
186 Ga0307416_100501184 3300032002 Bacteria 1279
187 Ga0307416_100788436 3300032002 Bacteria 1045
188 Ga0307414_10296744 3300032004 Bacteria 1365
189 Ga0307411_10047557 3300032005 Bacteria 2774
190 Ga0307415_100079102 3300032126 Bacteria 2341
191 Ga0307415_100091685 3300032126 Bacteria 2201
192 Ga0307415_100657675 3300032126 Bacteria 940
193 Ga0373959_0051301 3300034820 Unclassified 891
194 Ga0373938_0076498 3300034957 Unclassified 809
195 Ga0373928_0046693 3300035084 Bacteria 1011
196 Ga0373949_0009255 3300035090 Bacteria 2159
197 Ga0373941_0029346 3300035115 Bacteria 1622
198 Ga0373946_0147048 3300035171 Bacteria 1097
199 Ga0373962_0007267 3300035242 Bacteria 2711
200 Ga0395899_0018790 3300037312 Bacteria 5252
201 Ga0395899_0352107 3300037312 Bacteria 985
202 Ga0395900_0013545 3300037418 Bacteria 8330
203 Ga0395900_0026894 3300037418 Bacteria 5888
204 Ga0395900_0457902 3300037418 Bacteria 1231
205 Ga0395900_0458033 3300037418 Bacteria 1231
206 Ga0395900_0458933 3300037418 Bacteria 1229
207 Ga0395900_0604337 3300037418 Bacteria 1037
208 Ga0395900_0677206 3300037418 Bacteria 966
209 Ga0395898_0002534 3300037466 Bacteria 21425
210 Ga0395898_0052768 3300037466 Bacteria 3972
211 Ga0395898_0055150 3300037466 Bacteria 3877
212 Ga0395898_1258744 3300037466 Unclassified 670
213 Ga0395905_0008086 3300037471 Bacteria 10388
214 Ga0395905_0116453 3300037471 Bacteria 2512
215 Ga0395905_0332050 3300037471 Bacteria 1411
216 Ga0436364_0621345 3300037853 Bacteria 7403
217 Ga0436364_1063043 3300037853 Bacteria 809
218 Ga0395901_0006182 3300038443 Bacteria 12133
219 Ga0395901_0043084 3300038443 Bacteria 4682
220 Ga0395901_0101725 3300038443 Bacteria 3015
221 Ga0395901_0190091 3300038443 Bacteria 2153
222 Ga0395901_0272280 3300038443 Bacteria 1761
223 Ga0395901_0321905 3300038443 Bacteria 1600
224 Ga0395901_0497366 3300038443 Bacteria 1242
225 Ga0395901_0844434 3300038443 Bacteria 902
226 Ga0436365_0190537 3300039437 Bacteria 23352
227 Ga0436365_1275231 3300039437 Bacteria 930
228 Ga0436365_1387307 3300039437 Bacteria 1067
229 Ga0436360_1265240 3300039438 Bacteria 795
230 Ga0436363_1265155 3300039450 Bacteria 80087
231 Ga0451853_3178938 3300041512 Bacteria 1056
232 Ga0439458_0107843 3300042157 Bacteria 727
233 Ga0466969_0046381 3300044656 Bacteria 2155
234 Ga0466966_0095542 3300044684 Bacteria 1841
235 Ga0466966_0179952 3300044684 Bacteria 1283
236 Ga0466963_0334078 3300044694 Bacteria 1067
237 Ga0466968_0222038 3300044735 Bacteria 890
238 Ga0466968_0322194 3300044735 Bacteria 747
239 Ga0466960_0082647 3300044901 Bacteria 1622
240 Ga0466959_0020436 3300045049 Bacteria 4879
241 Ga0466959_0076116 3300045049 Bacteria 2424
242 Ga0466959_0125414 3300045049 Bacteria 1823
243 Ga0466958_0103239 3300045836 Bacteria 1775
244 Ga0466967_0022011 3300045976 Bacteria 5191
245 Ga0466967_0218519 3300045976 Bacteria 1810
246 Ga0466967_0629590 3300045976 Bacteria 1060
247 Ga0495653_0000183 3300046463 Bacteria 51182
248 Ga0495650_0000049 3300046471 Bacteria 325092
249 Ga0495582_0303961 3300046473 Bacteria 917
250 Ga0495605_0089448 3300046474 Bacteria 1429
251 Ga0495618_0000153 3300046514 Bacteria 49173
252 Ga0495630_0000162 3300046517 Bacteria 52137
253 Ga0495631_0118199 3300046518 Bacteria 1140
254 Ga0495637_0215741 3300046520 Bacteria 700
255 Ga0495645_0000032 3300046543 Bacteria 106333
256 Ga0495657_0000016 3300046675 Bacteria 183127
257 Ga0495646_0067226 3300046680 Bacteria 2119
258 Ga0495600_0072467 3300046809 Bacteria 2250
259 Ga0495660_0333757 3300046810 Bacteria 678
260 Ga0495676_0087979 3300047321 Bacteria 2332
261 Ga0495684_0005756 3300047471 Bacteria 9646
262 Ga0495684_0006647 3300047471 Bacteria 8967
263 Ga0495684_0381325 3300047471 Bacteria 994
264 Ga0495686_0082144 3300047472 Bacteria 1967
265 Ga0496100_0001928 3300048903 Bacteria 10372
266 Ga0496101_0122073 3300048904 Bacteria 1970
267 Ga0496101_0318829 3300048904 Bacteria 1219
268 Ga0496102_0927696 3300048905 Bacteria 792
269 Ga0496103_0259608 3300048906 Bacteria 1118
270 Ga0496103_0369332 3300048906 Bacteria 922
271 Ga0496104_0221054 3300048907 Bacteria 1806
272 Ga0496105_0046827 3300048908 Bacteria 3569
273 Ga0496105_0272887 3300048908 Bacteria 1365
274 Ga0496108_0121345 3300048911 Bacteria 2242
275 Ga0496108_0411086 3300048911 Bacteria 1182
276 Ga0496108_0426105 3300048911 Bacteria 1159
277 Ga0496109_0003569 3300048912 Bacteria 12993
278 Ga0496109_0011389 3300048912 Bacteria 7643
279 Ga0496109_0012295 3300048912 Bacteria 7389
280 Ga0496109_0017181 3300048912 Bacteria 6336
281 Ga0496109_0050275 3300048912 Unclassified 3797
282 Ga0496109_0110380 3300048912 Bacteria 2557
283 Ga0496110_0028781 3300048913 Bacteria 4776
284 Ga0496110_0196447 3300048913 Bacteria 1832
285 Ga0496110_0361570 3300048913 Unclassified 1322
286 Ga0496110_0394655 3300048913 Bacteria 1261
287 Ga0496110_0539428 3300048913 Bacteria 1060
288 Ga0496111_0144088 3300048914 Bacteria 1766
289 Ga0496111_0161391 3300048914 Bacteria 1664
290 Ga0496111_0421926 3300048914 Unclassified 985
291 Ga0496112_0003642 3300048915 Bacteria 12833
292 Ga0496112_0010040 3300048915 Bacteria 8571
293 Ga0496112_0193608 3300048915 Bacteria 1994
294 Ga0496112_0272440 3300048915 Bacteria 1641
295 Ga0496112_0302138 3300048915 Bacteria 1546
296 Ga0496112_0337801 3300048915 Bacteria 1450
297 Ga0496112_0354671 3300048915 Unclassified 1409
298 Ga0496112_0983141 3300048915 Bacteria 764
299 Ga0496113_0011846 3300048916 Bacteria 5843
300 Ga0496113_0283127 3300048916 Bacteria 1326
301 Ga0496114_0621351 3300048917 Bacteria 952
302 Ga0496114_0888217 3300048917 Bacteria 772
303 Ga0496115_0000149 3300048918 Bacteria 64799
304 Ga0496115_0000302 3300048918 Bacteria 42002
305 Ga0496115_0101261 3300048918 Bacteria 2362
306 Ga0496119_0090942 3300048922 Bacteria 1734
307 Ga0496121_0030447 3300048924 Bacteria 4956
308 Ga0501034_0034403 3300049571 Bacteria 5136
309 Ga0501038_0373140 3300049574 Bacteria 1108
310 Ga0501068_0195408 3300049584 Bacteria 1283
311 Ga0501069_0210211 3300049585 Bacteria 1129
312 Ga0501071_0341660 3300049587 Bacteria 1138
313 Ga0501072_0217470 3300049588 Bacteria 1523
314 Ga0501075_0132997 3300049591 Bacteria 1895
315 Ga0501076_0085258 3300049592 Bacteria 2538
316 Ga0501076_0182702 3300049592 Bacteria 1710
317 Ga0501077_0154744 3300049593 Bacteria 1455
318 Ga0501077_0252254 3300049593 Bacteria 1122
319 Ga0501079_0126083 3300049741 Bacteria 1992
320 Ga0501079_1047769 3300049741 Bacteria 643
321 Ga0501080_0852854 3300049742 Bacteria 796
322 Ga0501083_0170885 3300049744 Bacteria 1421
323 Ga0501045_0058642 3300049824 Bacteria 2819
324 nmdc:mga05p37_1188405_c1 3300050507 Bacteria 789
325 nmdc:mga05p37_223720_c1 3300050507 Bacteria 2270
326 nmdc:mga05p37_330365_c1 3300050507 Bacteria 1801
327 nmdc:mga05p37_72004_c1 3300050507 Bacteria 4253
328 nmdc:mga05p37_90274_c1 3300050507 Bacteria 3776
329 nmdc:mga09592_173788_c1 3300050508 Bacteria 1863
330 nmdc:mga09592_205143_c1 3300050508 Bacteria 1707
331 nmdc:mga09592_208519_c1 3300050508 Bacteria 1693
332 nmdc:mga09592_34829_c1 3300050508 Bacteria 4211
333 nmdc:mga0qj67_163297_c1 3300050509 Bacteria 1808
334 nmdc:mga0qj67_19172_c1 3300050509 Bacteria 5225
335 nmdc:mga0qj67_255922_c1 3300050509 Bacteria 1420
336 nmdc:mga0qj67_383316_c1 3300050509 Bacteria 1135
337 nmdc:mga0qj67_4318_c1 3300050509 Bacteria 10302
338 nmdc:mga06r32_105703_c1 3300050510 Bacteria 2766
339 nmdc:mga06r32_279514_c1 3300050510 Bacteria 1656
340 nmdc:mga06r32_291660_c1 3300050510 Bacteria 1618
341 nmdc:mga06r32_76136_c1 3300050510 Bacteria 3258
342 nmdc:mga06r32_814935_c1 3300050510 Bacteria 893
343 nmdc:mga08y16_134142_c1 3300050511 Bacteria 2573
344 nmdc:mga08y16_156802_c1 3300050511 Bacteria 2366
345 nmdc:mga0n895_1166565_c1 3300050512 Unclassified 745
346 nmdc:mga0a205_605608_c1 3300050515 Bacteria 948
347 Ga0495601_0000142 3300053077 Bacteria 40763
348 Ga0495612_0000091 3300053078 Bacteria 39413
349 Ga0495655_0048208 3300053083 Bacteria 1117
350 Ga0495619_0060985 3300053085 Bacteria 2509
351 Ga0495619_0110315 3300053085 Bacteria 1880
352 Ga0500616_0013344 3300053153 Bacteria 4774
353 Ga0501084_0134309 3300054114 Bacteria 2083
354 Ga0501084_0197178 3300054114 Bacteria 1699
355 Ga0501082_0397323 3300060353 Bacteria 1203
356 Ga0530510_0129219 3300061734 Bacteria 1858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1063043 Ga0436364_1063043_130_708 185
2 3300044694 Ga0466963_0334078 Ga0466963_0334078_447_1016 185
3 3300044735 Ga0466968_0322194 Ga0466968_0322194_15_596 185
4 3300046520 Ga0495637_0215741 Ga0495637_0215741_110_676 186
5 3300046810 Ga0495660_0333757 Ga0495660_0333757_35_601 186
6 3300049741 Ga0501079_1047769 Ga0501079_1047769_26_592 186
7 3300037466 Ga0395898_1258744 Ga0395898_1258744_55_618 187
8 3300038443 Ga0395901_0497366 Ga0395901_0497366_278_841 187
9 3300028800 Ga0265338_10084009 Ga0265338_100840092 191
10 3300031711 Ga0265314_10072978 Ga0265314_100729783 191
11 3300048912 Ga0496109_0050275 Ga0496109_0050275_3091_3699 191
12 3300048915 Ga0496112_0983141 Ga0496112_0983141_113_721 191
13 3300005981 Ga0081538_10068197 Ga0081538_100681973 192
14 3300005336 Ga0070680_100806721 Ga0070680_1008067211 200
15 3300005338 Ga0068868_100528072 Ga0068868_1005280722 200
16 3300005530 Ga0070679_100831173 Ga0070679_1008311731 200
17 3300005614 Ga0068856_100016566 Ga0068856_1000165666 200
18 3300005614 Ga0068856_100466242 Ga0068856_1004662422 200
19 3300005614 Ga0068856_101164392 Ga0068856_1011643921 200
20 3300009098 Ga0105245_10161330 Ga0105245_101613303 200
21 3300013105 Ga0157369_10151260 Ga0157369_101512601 200
22 3300013307 Ga0157372_10205217 Ga0157372_102052173 200
23 3300021377 Ga0213874_10001235 Ga0213874_100012354 200
24 3300021384 Ga0213876_10031544 Ga0213876_100315444 200
25 3300026078 Ga0207702_10123905 Ga0207702_101239053 200
26 3300039438 Ga0436360_1265240 Ga0436360_1265240_77_697 200
27 3300039450 Ga0436363_1265155 Ga0436363_1265155_35852_36475 200
28 3300044735 Ga0466968_0222038 Ga0466968_0222038_190_813 200
29 3300005981 Ga0081538_10014100 Ga0081538_100141002 201
30 3300005981 Ga0081538_10030723 Ga0081538_100307233 201
31 3300006847 Ga0075431_100126006 Ga0075431_1001260063 202
32 3300014325 Ga0163163_10080567 Ga0163163_100805672 202
33 3300039437 Ga0436365_1387307 Ga0436365_1387307_112_720 202
34 3300048911 Ga0496108_0411086 Ga0496108_0411086_212_820 202
35 3300048913 Ga0496110_0028781 Ga0496110_0028781_2248_2856 202
36 3300048914 Ga0496111_0144088 Ga0496111_0144088_1145_1753 202
37 3300048915 Ga0496112_0272440 Ga0496112_0272440_866_1474 202
38 3300049591 Ga0501075_0132997 Ga0501075_0132997_1198_1824 206
39 3300042157 Ga0439458_0107843 Ga0439458_0107843_86_715 208
40 3300048915 Ga0496112_0354671 Ga0496112_0354671_295_921 208
41 3300020081 Ga0206354_11398881 Ga0206354_113988812 213
42 3300048913 Ga0496110_0361570 Ga0496110_0361570_359_1000 213
43 3300048914 Ga0496111_0421926 Ga0496111_0421926_74_715 213
44 3300014968 Ga0157379_10001599 Ga0157379_1000159917 215
45 3300032002 Ga0307416_100788436 Ga0307416_1007884361 215
46 3300032126 Ga0307415_100657675 Ga0307415_1006576752 215
47 3300037418 Ga0395900_0604337 Ga0395900_0604337_205_891 215
48 3300037418 Ga0395900_0677206 Ga0395900_0677206_21_707 215
49 3300038443 Ga0395901_0190091 Ga0395901_0190091_623_1309 215
50 3300038443 Ga0395901_0272280 Ga0395901_0272280_676_1362 215
51 3300045049 Ga0466959_0125414 Ga0466959_0125414_1096_1782 215
52 3300045976 Ga0466967_0629590 Ga0466967_0629590_293_979 215
53 3300046471 Ga0495650_0000049 Ga0495650_0000049_74318_75004 215
54 3300047472 Ga0495686_0082144 Ga0495686_0082144_666_1352 215
55 3300048904 Ga0496101_0318829 Ga0496101_0318829_76_762 215
56 3300048906 Ga0496103_0259608 Ga0496103_0259608_55_741 215
57 3300048911 Ga0496108_0426105 Ga0496108_0426105_242_928 215
58 3300048915 Ga0496112_0010040 Ga0496112_0010040_6984_7670 215
59 3300048922 Ga0496119_0090942 Ga0496119_0090942_209_895 215
60 3300048924 Ga0496121_0030447 Ga0496121_0030447_492_1178 215
61 3300049571 Ga0501034_0034403 Ga0501034_0034403_811_1497 215
62 3300049744 Ga0501083_0170885 Ga0501083_0170885_18_704 215
63 3300053153 Ga0500616_0013344 Ga0500616_0013344_960_1646 215
64 3300005439 Ga0070711_100193374 Ga0070711_1001933741 216
65 3300006173 Ga0070716_100108374 Ga0070716_1001083741 216
66 3300006175 Ga0070712_100217041 Ga0070712_1002170412 216
67 3300020077 Ga0206351_10043517 Ga0206351_100435171 216
68 3300025898 Ga0207692_10214954 Ga0207692_102149541 216
69 3300025915 Ga0207693_10292445 Ga0207693_102924452 216
70 3300025939 Ga0207665_10039220 Ga0207665_100392202 216
71 3300037312 Ga0395899_0352107 Ga0395899_0352107_57_743 216
72 3300037418 Ga0395900_0026894 Ga0395900_0026894_2654_3388 216
73 3300037418 Ga0395900_0458933 Ga0395900_0458933_253_939 216
74 3300037466 Ga0395898_0002534 Ga0395898_0002534_15484_16218 216
75 3300037466 Ga0395898_0052768 Ga0395898_0052768_76_762 216
76 3300037471 Ga0395905_0116453 Ga0395905_0116453_1776_2462 216
77 3300038443 Ga0395901_0101725 Ga0395901_0101725_312_998 216
78 3300044656 Ga0466969_0046381 Ga0466969_0046381_549_1286 216
79 3300045049 Ga0466959_0020436 Ga0466959_0020436_1973_2710 216
80 3300045049 Ga0466959_0076116 Ga0466959_0076116_939_1649 216
81 3300048912 Ga0496109_0003569 Ga0496109_0003569_9922_10593 216
82 3300005329 Ga0070683_100090217 Ga0070683_1000902172 217
83 3300005329 Ga0070683_100275533 Ga0070683_1002755332 217
84 3300005336 Ga0070680_100008825 Ga0070680_1000088258 217
85 3300005337 Ga0070682_100066697 Ga0070682_1000666972 217
86 3300005338 Ga0068868_100335300 Ga0068868_1003353002 217
87 3300005341 Ga0070691_10171321 Ga0070691_101713211 217
88 3300005344 Ga0070661_100006067 Ga0070661_1000060675 217
89 3300005355 Ga0070671_100327310 Ga0070671_1003273102 217
90 3300005366 Ga0070659_100070582 Ga0070659_1000705824 217
91 3300005434 Ga0070709_10068835 Ga0070709_100688353 217
92 3300005435 Ga0070714_100209580 Ga0070714_1002095802 217
93 3300005436 Ga0070713_100010729 Ga0070713_1000107293 217
94 3300005436 Ga0070713_100224001 Ga0070713_1002240012 217
95 3300005437 Ga0070710_10003912 Ga0070710_100039126 217
96 3300005439 Ga0070711_100000405 Ga0070711_10000040520 217
97 3300005439 Ga0070711_100079695 Ga0070711_1000796953 217
98 3300005458 Ga0070681_10007190 Ga0070681_1000719015 217
99 3300005466 Ga0070685_10268974 Ga0070685_102689742 217
100 3300005530 Ga0070679_100003327 Ga0070679_10000332719 217
101 3300005535 Ga0070684_100321293 Ga0070684_1003212932 217
102 3300005539 Ga0068853_100083492 Ga0068853_1000834923 217
103 3300005563 Ga0068855_100169170 Ga0068855_1001691702 217
104 3300005577 Ga0068857_100058653 Ga0068857_1000586534 217
105 3300005614 Ga0068856_100052759 Ga0068856_1000527593 217
106 3300005616 Ga0068852_100066510 Ga0068852_1000665102 217
107 3300005937 Ga0081455_10009917 Ga0081455_100099175 217
108 3300005983 Ga0081540_1000551 Ga0081540_100055115 217
109 3300006175 Ga0070712_100044602 Ga0070712_1000446023 217
110 3300006175 Ga0070712_100369865 Ga0070712_1003698652 217
111 3300009094 Ga0111539_10857013 Ga0111539_108570132 217
112 3300009098 Ga0105245_10045611 Ga0105245_100456115 217
113 3300009098 Ga0105245_11281467 Ga0105245_112814671 217
114 3300009545 Ga0105237_10000570 Ga0105237_1000057048 217
115 3300009545 Ga0105237_10050352 Ga0105237_100503525 217
116 3300009551 Ga0105238_10207964 Ga0105238_102079643 217
117 3300013104 Ga0157370_10011051 Ga0157370_100110512 217
118 3300013105 Ga0157369_10028494 Ga0157369_100284944 217
119 3300013307 Ga0157372_10040278 Ga0157372_100402783 217
120 3300014325 Ga0163163_10464183 Ga0163163_104641831 217
121 3300020069 Ga0197907_10931326 Ga0197907_109313261 217
122 3300020070 Ga0206356_10327084 Ga0206356_103270843 217
123 3300020075 Ga0206349_1346323 Ga0206349_13463232 217
124 3300020081 Ga0206354_10229405 Ga0206354_102294054 217
125 3300020082 Ga0206353_11411494 Ga0206353_114114942 217
126 3300020082 Ga0206353_11522601 Ga0206353_115226015 217
127 3300021384 Ga0213876_10005122 Ga0213876_100051222 217
128 3300022467 Ga0224712_10242948 Ga0224712_102429481 217
129 3300025898 Ga0207692_10002495 Ga0207692_100024952 217
130 3300025906 Ga0207699_10043118 Ga0207699_100431183 217
131 3300025909 Ga0207705_10175952 Ga0207705_101759523 217
132 3300025912 Ga0207707_10062940 Ga0207707_100629402 217
133 3300025914 Ga0207671_10000491 Ga0207671_100004917 217
134 3300025914 Ga0207671_10063308 Ga0207671_100633082 217
135 3300025915 Ga0207693_10008731 Ga0207693_100087314 217
136 3300025915 Ga0207693_10069761 Ga0207693_100697613 217
137 3300025915 Ga0207693_10132357 Ga0207693_101323572 217
138 3300025915 Ga0207693_10263296 Ga0207693_102632962 217
139 3300025916 Ga0207663_10000240 Ga0207663_100002407 217
140 3300025917 Ga0207660_10008920 Ga0207660_100089205 217
141 3300025920 Ga0207649_10007634 Ga0207649_100076344 217
142 3300025921 Ga0207652_10004034 Ga0207652_100040343 217
143 3300025924 Ga0207694_10122044 Ga0207694_101220442 217
144 3300025927 Ga0207687_10645794 Ga0207687_106457942 217
145 3300025928 Ga0207700_10013851 Ga0207700_100138512 217
146 3300025931 Ga0207644_10230065 Ga0207644_102300653 217
147 3300025932 Ga0207690_10215395 Ga0207690_102153952 217
148 3300025944 Ga0207661_10003963 Ga0207661_100039634 217
149 3300025944 Ga0207661_10098963 Ga0207661_100989632 217
150 3300025945 Ga0207679_10022668 Ga0207679_100226684 217
151 3300025949 Ga0207667_10394370 Ga0207667_103943702 217
152 3300026041 Ga0207639_10069307 Ga0207639_100693073 217
153 3300026142 Ga0207698_10029483 Ga0207698_100294834 217
154 3300028556 Ga0265337_1003639 Ga0265337_10036394 217
155 3300028558 Ga0265326_10000328 Ga0265326_100003285 217
156 3300028563 Ga0265319_1000059 Ga0265319_100005955 217
157 3300028563 Ga0265319_1000125 Ga0265319_100012550 217
158 3300028563 Ga0265319_1036428 Ga0265319_10364282 217
159 3300028577 Ga0265318_10001579 Ga0265318_1000157915 217
160 3300028577 Ga0265318_10032624 Ga0265318_100326242 217
161 3300028577 Ga0265318_10055648 Ga0265318_100556482 217
162 3300028654 Ga0265322_10005924 Ga0265322_100059243 217
163 3300028654 Ga0265322_10080843 Ga0265322_100808432 217
164 3300028666 Ga0265336_10000017 Ga0265336_1000001798 217
165 3300028666 Ga0265336_10128953 Ga0265336_101289531 217
166 3300028800 Ga0265338_10000044 Ga0265338_1000004498 217
167 3300028800 Ga0265338_10011035 Ga0265338_100110359 217
168 3300028800 Ga0265338_10307100 Ga0265338_103071001 217
169 3300029957 Ga0265324_10009676 Ga0265324_100096764 217
170 3300031239 Ga0265328_10094601 Ga0265328_100946011 217
171 3300031240 Ga0265320_10093790 Ga0265320_100937902 217
172 3300031247 Ga0265340_10000003 Ga0265340_10000003214 217
173 3300031249 Ga0265339_10081787 Ga0265339_100817873 217
174 3300031251 Ga0265327_10002548 Ga0265327_1000254816 217
175 3300031251 Ga0265327_10019013 Ga0265327_100190132 217
176 3300031251 Ga0265327_10038200 Ga0265327_100382002 217
177 3300031344 Ga0265316_10051074 Ga0265316_100510743 217
178 3300031595 Ga0265313_10151930 Ga0265313_101519302 217
179 3300031901 Ga0307406_10134060 Ga0307406_101340602 217
180 3300035171 Ga0373946_0147048 Ga0373946_0147048_171_839 217
181 3300037418 Ga0395900_0458033 Ga0395900_0458033_354_1028 217
182 3300037853 Ga0436364_0621345 Ga0436364_0621345_5111_5785 217
183 3300038443 Ga0395901_0321905 Ga0395901_0321905_764_1453 217
184 3300038443 Ga0395901_0844434 Ga0395901_0844434_153_842 217
185 3300039437 Ga0436365_0190537 Ga0436365_0190537_4834_5508 217
186 3300044684 Ga0466966_0095542 Ga0466966_0095542_649_1329 217
187 3300044684 Ga0466966_0179952 Ga0466966_0179952_178_873 217
188 3300044901 Ga0466960_0082647 Ga0466960_0082647_14_682 217
189 3300045836 Ga0466958_0103239 Ga0466958_0103239_460_1128 217
190 3300045976 Ga0466967_0218519 Ga0466967_0218519_412_1101 217
191 3300046463 Ga0495653_0000183 Ga0495653_0000183_13430_14098 217
192 3300046473 Ga0495582_0303961 Ga0495582_0303961_192_857 217
193 3300046514 Ga0495618_0000153 Ga0495618_0000153_17847_18515 217
194 3300046517 Ga0495630_0000162 Ga0495630_0000162_22255_22935 217
195 3300046518 Ga0495631_0118199 Ga0495631_0118199_136_810 217
196 3300046543 Ga0495645_0000032 Ga0495645_0000032_83523_84191 217
197 3300046675 Ga0495657_0000016 Ga0495657_0000016_86154_86834 217
198 3300046680 Ga0495646_0067226 Ga0495646_0067226_642_1322 217
199 3300046809 Ga0495600_0072467 Ga0495600_0072467_896_1558 217
200 3300047321 Ga0495676_0087979 Ga0495676_0087979_373_1074 217
201 3300047471 Ga0495684_0005756 Ga0495684_0005756_8387_9067 217
202 3300047471 Ga0495684_0006647 Ga0495684_0006647_5581_6246 217
203 3300047471 Ga0495684_0381325 Ga0495684_0381325_152_817 217
204 3300048903 Ga0496100_0001928 Ga0496100_0001928_8881_9546 217
205 3300048904 Ga0496101_0122073 Ga0496101_0122073_899_1588 217
206 3300048905 Ga0496102_0927696 Ga0496102_0927696_99_764 217
207 3300048906 Ga0496103_0369332 Ga0496103_0369332_124_789 217
208 3300048907 Ga0496104_0221054 Ga0496104_0221054_685_1374 217
209 3300048908 Ga0496105_0046827 Ga0496105_0046827_1697_2386 217
210 3300048908 Ga0496105_0272887 Ga0496105_0272887_264_953 217
211 3300048912 Ga0496109_0011389 Ga0496109_0011389_1664_2353 217
212 3300048912 Ga0496109_0017181 Ga0496109_0017181_620_1309 217
213 3300048913 Ga0496110_0196447 Ga0496110_0196447_511_1200 217
214 3300048913 Ga0496110_0394655 Ga0496110_0394655_516_1181 217
215 3300048915 Ga0496112_0003642 Ga0496112_0003642_2947_3636 217
216 3300048915 Ga0496112_0193608 Ga0496112_0193608_569_1258 217
217 3300048915 Ga0496112_0337801 Ga0496112_0337801_325_1017 217
218 3300048916 Ga0496113_0011846 Ga0496113_0011846_3177_3866 217
219 3300048916 Ga0496113_0283127 Ga0496113_0283127_266_955 217
220 3300048917 Ga0496114_0621351 Ga0496114_0621351_204_893 217
221 3300048917 Ga0496114_0888217 Ga0496114_0888217_25_714 217
222 3300048918 Ga0496115_0000149 Ga0496115_0000149_12671_13336 217
223 3300048918 Ga0496115_0000302 Ga0496115_0000302_28932_29597 217
224 3300048918 Ga0496115_0101261 Ga0496115_0101261_38_703 217
225 3300049585 Ga0501069_0210211 Ga0501069_0210211_109_786 217
226 3300053077 Ga0495601_0000142 Ga0495601_0000142_30211_30891 217
227 3300053078 Ga0495612_0000091 Ga0495612_0000091_18472_19140 217
228 3300053085 Ga0495619_0060985 Ga0495619_0060985_1544_2209 217
229 3300053085 Ga0495619_0110315 Ga0495619_0110315_478_1167 217
230 3300005546 Ga0070696_100522987 Ga0070696_1005229871 218
231 3300009093 Ga0105240_10110985 Ga0105240_101109851 218
232 3300048911 Ga0496108_0121345 Ga0496108_0121345_1528_2208 218
233 3300048912 Ga0496109_0110380 Ga0496109_0110380_543_1223 218
234 3300003373 JGI25407J50210_10001313 JGI25407J50210_100013136 219
235 3300003373 JGI25407J50210_10002380 JGI25407J50210_100023803 219
236 3300005618 Ga0068864_100516466 Ga0068864_1005164662 219
237 3300005981 Ga0081538_10000013 Ga0081538_10000013103 219
238 3300005981 Ga0081538_10000027 Ga0081538_1000002710 219
239 3300005981 Ga0081538_10001407 Ga0081538_100014079 219
240 3300005981 Ga0081538_10004036 Ga0081538_100040363 219
241 3300005981 Ga0081538_10007244 Ga0081538_100072443 219
242 3300005981 Ga0081538_10007380 Ga0081538_100073809 219
243 3300005981 Ga0081538_10029388 Ga0081538_100293884 219
244 3300005981 Ga0081538_10046345 Ga0081538_100463454 219
245 3300006844 Ga0075428_100617197 Ga0075428_1006171972 219
246 3300006846 Ga0075430_100006972 Ga0075430_1000069723 219
247 3300006847 Ga0075431_100027253 Ga0075431_1000272536 219
248 3300006880 Ga0075429_100023625 Ga0075429_1000236253 219
249 3300009147 Ga0114129_10307917 Ga0114129_103079172 219
250 3300014325 Ga0163163_10142196 Ga0163163_101421963 219
251 3300027907 Ga0207428_10392065 Ga0207428_103920651 219
252 3300031731 Ga0307405_10274350 Ga0307405_102743502 219
253 3300031852 Ga0307410_10230520 Ga0307410_102305202 219
254 3300031995 Ga0307409_100840834 Ga0307409_1008408341 219
255 3300037312 Ga0395899_0018790 Ga0395899_0018790_425_1084 219
256 3300037418 Ga0395900_0013545 Ga0395900_0013545_4799_5458 219
257 3300037471 Ga0395905_0008086 Ga0395905_0008086_9516_10175 219
258 3300037471 Ga0395905_0332050 Ga0395905_0332050_464_1123 219
259 3300038443 Ga0395901_0006182 Ga0395901_0006182_8808_9467 219
260 3300039437 Ga0436365_1275231 Ga0436365_1275231_23_694 219
261 3300041512 Ga0451853_3178938 Ga0451853_3178938_105_764 219
262 3300048912 Ga0496109_0012295 Ga0496109_0012295_5405_6064 219
263 3300048913 Ga0496110_0539428 Ga0496110_0539428_75_734 219
264 3300048914 Ga0496111_0161391 Ga0496111_0161391_237_896 219
265 3300048915 Ga0496112_0302138 Ga0496112_0302138_648_1307 219
266 3300049588 Ga0501072_0217470 Ga0501072_0217470_336_995 219
267 3300049592 Ga0501076_0182702 Ga0501076_0182702_245_904 219
268 3300049593 Ga0501077_0154744 Ga0501077_0154744_463_1125 219
269 3300050507 nmdc:mga05p37_330365_c1 nmdc:mga05p37_330365_c1_546_1211 219
270 3300050508 nmdc:mga09592_208519_c1 nmdc:mga09592_208519_c1_336_1001 219
271 3300050509 nmdc:mga0qj67_255922_c1 nmdc:mga0qj67_255922_c1_290_949 219
272 3300050509 nmdc:mga0qj67_4318_c1 nmdc:mga0qj67_4318_c1_2005_2670 219
273 3300050510 nmdc:mga06r32_105703_c1 nmdc:mga06r32_105703_c1_817_1482 219
274 3300050510 nmdc:mga06r32_814935_c1 nmdc:mga06r32_814935_c1_56_715 219
275 3300053083 Ga0495655_0048208 Ga0495655_0048208_25_684 219
276 3300061734 Ga0530510_0129219 Ga0530510_0129219_203_862 219
277 3300005328 Ga0070676_10545928 Ga0070676_105459281 220
278 3300005455 Ga0070663_100616883 Ga0070663_1006168831 220
279 3300005981 Ga0081538_10007118 Ga0081538_1000711816 220
280 3300006058 Ga0075432_10003667 Ga0075432_100036674 220
281 3300006844 Ga0075428_100205637 Ga0075428_1002056372 220
282 3300006844 Ga0075428_100258223 Ga0075428_1002582233 220
283 3300006844 Ga0075428_100307894 Ga0075428_1003078943 220
284 3300006844 Ga0075428_100434941 Ga0075428_1004349413 220
285 3300006846 Ga0075430_100004531 Ga0075430_1000045313 220
286 3300006846 Ga0075430_100108922 Ga0075430_1001089223 220
287 3300006846 Ga0075430_100240429 Ga0075430_1002404293 220
288 3300006846 Ga0075430_100316208 Ga0075430_1003162082 220
289 3300006847 Ga0075431_100365056 Ga0075431_1003650562 220
290 3300006852 Ga0075433_10391782 Ga0075433_103917822 220
291 3300006871 Ga0075434_101118081 Ga0075434_1011180811 220
292 3300009094 Ga0111539_10019441 Ga0111539_100194415 220
293 3300009094 Ga0111539_10330998 Ga0111539_103309983 220
294 3300009147 Ga0114129_10084694 Ga0114129_100846944 220
295 3300009147 Ga0114129_10131469 Ga0114129_101314693 220
296 3300014326 Ga0157380_10253813 Ga0157380_102538133 220
297 3300026067 Ga0207678_10539788 Ga0207678_105397882 220
298 3300027907 Ga0207428_10052877 Ga0207428_100528772 220
299 3300031824 Ga0307413_10143938 Ga0307413_101439383 220
300 3300031852 Ga0307410_10009348 Ga0307410_100093481 220
301 3300031852 Ga0307410_10030286 Ga0307410_100302862 220
302 3300031852 Ga0307410_10491339 Ga0307410_104913392 220
303 3300031901 Ga0307406_10267656 Ga0307406_102676562 220
304 3300031911 Ga0307412_10264024 Ga0307412_102640243 220
305 3300031995 Ga0307409_100006101 Ga0307409_1000061015 220
306 3300031995 Ga0307409_100112684 Ga0307409_1001126843 220
307 3300031995 Ga0307409_100262949 Ga0307409_1002629492 220
308 3300032002 Ga0307416_100122351 Ga0307416_1001223513 220
309 3300032002 Ga0307416_100331136 Ga0307416_1003311362 220
310 3300032002 Ga0307416_100411836 Ga0307416_1004118362 220
311 3300032002 Ga0307416_100426166 Ga0307416_1004261662 220
312 3300032002 Ga0307416_100501184 Ga0307416_1005011842 220
313 3300032004 Ga0307414_10296744 Ga0307414_102967442 220
314 3300032005 Ga0307411_10047557 Ga0307411_100475572 220
315 3300032126 Ga0307415_100079102 Ga0307415_1000791022 220
316 3300032126 Ga0307415_100091685 Ga0307415_1000916852 220
317 3300034820 Ga0373959_0051301 Ga0373959_0051301_47_715 220
318 3300034957 Ga0373938_0076498 Ga0373938_0076498_19_687 220
319 3300035084 Ga0373928_0046693 Ga0373928_0046693_293_961 220
320 3300035090 Ga0373949_0009255 Ga0373949_0009255_713_1381 220
321 3300035115 Ga0373941_0029346 Ga0373941_0029346_329_997 220
322 3300035242 Ga0373962_0007267 Ga0373962_0007267_1283_1951 220
323 3300037418 Ga0395900_0457902 Ga0395900_0457902_370_1035 220
324 3300037466 Ga0395898_0055150 Ga0395898_0055150_1280_1945 220
325 3300038443 Ga0395901_0043084 Ga0395901_0043084_1354_2019 220
326 3300045976 Ga0466967_0022011 Ga0466967_0022011_3339_4004 220
327 3300049574 Ga0501038_0373140 Ga0501038_0373140_303_971 220
328 3300049584 Ga0501068_0195408 Ga0501068_0195408_304_972 220
329 3300049587 Ga0501071_0341660 Ga0501071_0341660_355_1023 220
330 3300049592 Ga0501076_0085258 Ga0501076_0085258_507_1175 220
331 3300049593 Ga0501077_0252254 Ga0501077_0252254_332_1000 220
332 3300049741 Ga0501079_0126083 Ga0501079_0126083_224_895 220
333 3300049742 Ga0501080_0852854 Ga0501080_0852854_41_709 220
334 3300049824 Ga0501045_0058642 Ga0501045_0058642_1070_1738 220
335 3300050507 nmdc:mga05p37_1188405_c1 nmdc:mga05p37_1188405_c1_12_680 220
336 3300050507 nmdc:mga05p37_223720_c1 nmdc:mga05p37_223720_c1_533_1201 220
337 3300050507 nmdc:mga05p37_72004_c1 nmdc:mga05p37_72004_c1_1737_2405 220
338 3300050507 nmdc:mga05p37_90274_c1 nmdc:mga05p37_90274_c1_877_1542 220
339 3300050508 nmdc:mga09592_173788_c1 nmdc:mga09592_173788_c1_832_1497 220
340 3300050508 nmdc:mga09592_205143_c1 nmdc:mga09592_205143_c1_517_1185 220
341 3300050508 nmdc:mga09592_34829_c1 nmdc:mga09592_34829_c1_34_702 220
342 3300050509 nmdc:mga0qj67_163297_c1 nmdc:mga0qj67_163297_c1_507_1175 220
343 3300050509 nmdc:mga0qj67_19172_c1 nmdc:mga0qj67_19172_c1_2688_3356 220
344 3300050509 nmdc:mga0qj67_383316_c1 nmdc:mga0qj67_383316_c1_209_880 220
345 3300050510 nmdc:mga06r32_279514_c1 nmdc:mga06r32_279514_c1_938_1606 220
346 3300050510 nmdc:mga06r32_291660_c1 nmdc:mga06r32_291660_c1_342_1010 220
347 3300050510 nmdc:mga06r32_76136_c1 nmdc:mga06r32_76136_c1_1395_2063 220
348 3300050511 nmdc:mga08y16_134142_c1 nmdc:mga08y16_134142_c1_432_1097 220
349 3300050511 nmdc:mga08y16_156802_c1 nmdc:mga08y16_156802_c1_271_939 220
350 3300050512 nmdc:mga0n895_1166565_c1 nmdc:mga0n895_1166565_c1_61_729 220
351 3300050515 nmdc:mga0a205_605608_c1 nmdc:mga0a205_605608_c1_35_700 220
352 3300054114 Ga0501084_0134309 Ga0501084_0134309_850_1518 220
353 3300054114 Ga0501084_0197178 Ga0501084_0197178_622_1293 220
354 3300060353 Ga0501082_0397323 Ga0501082_0397323_465_1136 220
355 3300000549 LJQas_1001648 LJQas_10016484 221
356 3300046474 Ga0495605_0089448 Ga0495605_0089448_106_774 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

103

210

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hf1-assembly1.cif.gz_A crystal structure of the putative tetraacyldisaccharide-1-p 4-kinase from chromobacterium violaceum. nesg target cvr39. 0.8558 130 156
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.7526 72 184
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.727 72 184
1rfs-assembly1.cif.gz_A rieske soluble fragment from spinach 0.7169 78 196
1g8k-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.7165 64 190
ID Description Score Start End Superfamily
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8188 71 186 2.20.25.680
1vf5Q02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7865 124 198 2.102.10.10
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7564 71 186 2.20.25.680
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7526 72 184 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.727 72 184 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A6J7EKW6-F1-model_v4 Unannotated protein 0.9387 105 219 GO:0016020
GO:0046872
GO:0051537
AF-A0A1W9VZI9-F1-model_v4 Rieske domain-containing protein 0.9387 122 184 GO:0016020
GO:0046872
GO:0051537
AF-A0A7V9V8K0-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.9377 74 221 GO:0016020
GO:0046872
GO:0051537
AF-A0A0F9D4B3-F1-model_v4 Rieske domain-containing protein 0.937 123 184 GO:0016020
GO:0046872
GO:0051537
AF-A0A7V9V8K0-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.9316 74 221 GO:0016020
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
87.6 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map