F420044

General Info

Members Datasets Scaffolds Average Seq Length
355 201 354 178

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100025692|Ga0070699_1000256922
Length 211
Sequence MSLAERRECVEQLAYAGRGSHEVLGERGTKNTPVTMIFKETNLAGVIEVTLDHRSDERGFFARSWCETEFADHGLNPRLVQCNVSFNVSKGTLRGMHYQDEPYPEAKLVRCTQGAIYDVAMDLRRQSATFKRWFGAVLSAENRHMLYIPEGCAHGFLTLTDNTEVFYQMSEFYQPESARGVRFDDPAFRIVWPEKVEVISERDRTYPNFEA

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
119 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
124 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
127 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 1.13
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10019127 3300002459 Bacteria 1418
2 JGI25407J50210_10004743 3300003373 Bacteria 3318
3 Ga0070670_100008590 3300005331 Bacteria 8713
4 Ga0070689_100489165 3300005340 Unclassified 1052
5 Ga0070687_100081226 3300005343 Bacteria 1769
6 Ga0070671_100715476 3300005355 Unclassified 869
7 Ga0070709_10084445 3300005434 Unclassified 2080
8 Ga0070709_10647457 3300005434 Bacteria 818
9 Ga0070714_100061676 3300005435 Bacteria 3221
10 Ga0070713_100036833 3300005436 Bacteria 3952
11 Ga0070711_100094735 3300005439 Unclassified 2159
12 Ga0070705_100096945 3300005440 Bacteria 1852
13 Ga0070705_100641188 3300005440 Bacteria 827
14 Ga0070694_100003717 3300005444 Bacteria 9097
15 Ga0070708_100064449 3300005445 Bacteria 3283
16 Ga0070708_100704559 3300005445 Unclassified 950
17 Ga0070663_100483642 3300005455 Unclassified 1025
18 Ga0070706_100004114 3300005467 Bacteria 14152
19 Ga0070706_100880984 3300005467 Bacteria 827
20 Ga0070707_100003707 3300005468 Bacteria 14408
21 Ga0070707_100098810 3300005468 Unclassified 2827
22 Ga0070707_100234774 3300005468 Bacteria 1785
23 Ga0070698_100000421 3300005471 Bacteria 45224
24 Ga0070698_100012476 3300005471 Bacteria 8994
25 Ga0070698_100053517 3300005471 Unclassified 4102
26 Ga0070699_100007663 3300005518 Bacteria 9386
27 Ga0070699_100011287 3300005518 Bacteria 7717
28 Ga0070699_100025692 3300005518 Bacteria 5076
29 Ga0070699_100025905 3300005518 Bacteria 5056
30 Ga0070699_100049956 3300005518 Bacteria 3620
31 Ga0070699_100613233 3300005518 Bacteria 992
32 Ga0070697_100009482 3300005536 Bacteria 7608
33 Ga0070697_100038588 3300005536 Bacteria 3860
34 Ga0070697_100131130 3300005536 Bacteria 2102
35 Ga0070697_100225118 3300005536 Viruses 1599
36 Ga0070696_100000070 3300005546 Bacteria 49576
37 Ga0070696_100041904 3300005546 Bacteria 3165
38 Ga0070693_100000653 3300005547 Bacteria 15287
39 Ga0070704_100003430 3300005549 Bacteria 9086
40 Ga0070704_100166071 3300005549 Unclassified 1750
41 Ga0070704_100255965 3300005549 Bacteria 1440
42 Ga0068857_100173038 3300005577 Bacteria 1963
43 Ga0068861_100018447 3300005719 Bacteria 4971
44 Ga0068870_10037227 3300005840 Bacteria 2507
45 Ga0068860_100298752 3300005843 Bacteria 1577
46 Ga0068862_101591409 3300005844 Bacteria 660
47 Ga0081455_10002275 3300005937 Bacteria 22911
48 Ga0081455_10006967 3300005937 Bacteria 12010
49 Ga0081455_10007276 3300005937 Bacteria 11682
50 Ga0081455_10014788 3300005937 Bacteria 7614
51 Ga0081538_10001180 3300005981 Bacteria 27546
52 Ga0081538_10008658 3300005981 Bacteria 8602
53 Ga0081538_10024992 3300005981 Bacteria 4234
54 Ga0081539_10058578 3300005985 Bacteria 2125
55 Ga0075432_10122453 3300006058 Unclassified 978
56 Ga0070715_10090659 3300006163 Bacteria 1406
57 Ga0070715_10218522 3300006163 Unclassified 978
58 Ga0070716_100084645 3300006173 Bacteria 1902
59 Ga0070716_100093545 3300006173 Unclassified 1825
60 Ga0075366_10073644 3300006195 Bacteria 2036
61 Ga0075428_100046298 3300006844 Bacteria 4778
62 Ga0075428_100229562 3300006844 Bacteria 2003
63 Ga0075430_100378732 3300006846 Bacteria 1168
64 Ga0075430_100439003 3300006846 Bacteria 1077
65 Ga0075430_100487359 3300006846 Bacteria 1017
66 Ga0075431_100030386 3300006847 Bacteria 5565
67 Ga0075431_100113559 3300006847 Bacteria 2796
68 Ga0075431_100165163 3300006847 Unclassified 2276
69 Ga0075431_101304321 3300006847 Bacteria 687
70 Ga0075433_10007886 3300006852 Bacteria 8468
71 Ga0075433_10093422 3300006852 Bacteria 2661
72 Ga0075433_10192590 3300006852 Bacteria 1814
73 Ga0075433_10810956 3300006852 Unclassified 818
74 Ga0075434_100036850 3300006871 Bacteria 4838
75 Ga0075434_100063066 3300006871 Bacteria 3689
76 Ga0075434_100084558 3300006871 Bacteria 3172
77 Ga0075434_100257948 3300006871 Unclassified 1762
78 Ga0075434_101180538 3300006871 Bacteria 778
79 Ga0075429_100008472 3300006880 Bacteria 8952
80 Ga0075429_100141737 3300006880 Bacteria 2104
81 Ga0075436_100005554 3300006914 Bacteria 8666
82 Ga0075436_100449256 3300006914 Unclassified 938
83 Ga0075435_100144526 3300007076 Bacteria 1997
84 Ga0075435_100247518 3300007076 Bacteria 1517
85 Ga0075435_100545207 3300007076 Bacteria 1004
86 Ga0105240_10059398 3300009093 Unclassified 4773
87 Ga0111539_10002204 3300009094 Bacteria 26011
88 Ga0111539_10010935 3300009094 Bacteria 11423
89 Ga0111539_10013138 3300009094 Bacteria 10357
90 Ga0111539_10360570 3300009094 Unclassified 1692
91 Ga0111539_11184092 3300009094 Bacteria 888
92 Ga0111539_12538748 3300009094 Bacteria 594
93 Ga0114129_10013718 3300009147 Bacteria 11548
94 Ga0114129_10014963 3300009147 Bacteria 11053
95 Ga0114129_10019473 3300009147 Bacteria 9664
96 Ga0114129_10053539 3300009147 Bacteria 5660
97 Ga0114129_10075872 3300009147 Bacteria 4681
98 Ga0114129_10104064 3300009147 Bacteria 3923
99 Ga0114129_10142048 3300009147 Bacteria 3290
100 Ga0114129_10320353 3300009147 Bacteria 2061
101 Ga0114129_10589334 3300009147 Bacteria 1442
102 Ga0114129_11010126 3300009147 Bacteria 1047
103 Ga0105243_10069015 3300009148 Bacteria 2850
104 Ga0105241_10869402 3300009174 Unclassified 835
105 Ga0105242_10082681 3300009176 Bacteria 2688
106 Ga0105248_10502261 3300009177 Unclassified 1367
107 Ga0105248_11096497 3300009177 Unclassified 900
108 Ga0105237_10249847 3300009545 Bacteria 1775
109 Ga0105238_11349945 3300009551 Unclassified 739
110 Ga0105249_10595022 3300009553 Bacteria 1160
111 Ga0105246_10353168 3300011119 Bacteria 1205
112 Ga0157374_10343604 3300013296 Bacteria 1482
113 Ga0157375_10302600 3300013308 Bacteria 1763
114 Ga0157375_10701852 3300013308 Bacteria 1165
115 Ga0157376_10028152 3300014969 Bacteria 4463
116 Ga0213872_10009438 3300021361 Unclassified 4678
117 Ga0213876_10257606 3300021384 Bacteria 927
118 Ga0207699_10055315 3300025906 Unclassified 2360
119 Ga0207699_10062036 3300025906 Unclassified 2252
120 Ga0207643_10006388 3300025908 Bacteria 6311
121 Ga0207684_10026968 3300025910 Bacteria 4898
122 Ga0207684_10036018 3300025910 Bacteria 4201
123 Ga0207684_11075796 3300025910 Bacteria 670
124 Ga0207663_10077944 3300025916 Unclassified 2159
125 Ga0207646_10004780 3300025922 Bacteria 14543
126 Ga0207646_10009041 3300025922 Bacteria 9898
127 Ga0207646_10042761 3300025922 Bacteria 4070
128 Ga0207646_10384028 3300025922 Bacteria 1269
129 Ga0207650_10011743 3300025925 Bacteria 6039
130 Ga0207664_10063211 3300025929 Bacteria 2958
131 Ga0207644_10653712 3300025931 Unclassified 875
132 Ga0207709_10038274 3300025935 Bacteria 2855
133 Ga0207665_10006478 3300025939 Bacteria 7769
134 Ga0207689_10470070 3300025942 Bacteria 1052
135 Ga0207667_10001271 3300025949 Bacteria 31677
136 Ga0207712_10640492 3300025961 Unclassified 923
137 Ga0207674_10215909 3300026116 Bacteria 1866
138 Ga0207675_100043532 3300026118 Bacteria 4192
139 Ga0207428_10007306 3300027907 Bacteria 10092
140 Ga0207428_10015102 3300027907 Bacteria 6686
141 Ga0207428_10038696 3300027907 Bacteria 3875
142 Ga0207428_10087840 3300027907 Unclassified 2418
143 Ga0207428_10425233 3300027907 Bacteria 970
144 Ga0268265_10251047 3300028380 Bacteria 1567
145 Ga0268265_10437188 3300028380 Bacteria 1219
146 Ga0268265_11348863 3300028380 Bacteria 714
147 Ga0268264_10488918 3300028381 Bacteria 1198
148 Ga0265326_10000135 3300028558 Archaea 38204
149 Ga0265319_1021456 3300028563 Bacteria 2372
150 Ga0265319_1062807 3300028563 Bacteria 1202
151 Ga0265334_10001044 3300028573 Archaea 13647
152 Ga0265334_10047759 3300028573 Bacteria 1650
153 Ga0265318_10177878 3300028577 Bacteria 779
154 Ga0265323_10007219 3300028653 Bacteria 4632
155 Ga0265336_10000249 3300028666 Archaea 38232
156 Ga0265336_10015488 3300028666 Bacteria 2505
157 Ga0307515_10031589 3300028794 Bacteria 8819
158 Ga0265338_10000406 3300028800 Archaea 77267
159 Ga0265338_10015145 3300028800 Bacteria 8505
160 Ga0265338_10274699 3300028800 Bacteria 1234
161 Ga0265338_10340300 3300028800 Bacteria 1081
162 Ga0265324_10000272 3300029957 Archaea 38220
163 Ga0265330_10002824 3300031235 Bacteria 9299
164 Ga0265320_10006623 3300031240 Bacteria 7280
165 Ga0265325_10011178 3300031241 Bacteria 5166
166 Ga0265325_10045715 3300031241 Bacteria 2274
167 Ga0265340_10000040 3300031247 Archaea 58470
168 Ga0265340_10107517 3300031247 Unclassified 1292
169 Ga0265339_10003266 3300031249 Archaea 11356
170 Ga0265339_10005415 3300031249 Bacteria 8503
171 Ga0265339_10226327 3300031249 Bacteria 913
172 Ga0265331_10000071 3300031250 Archaea 150739
173 Ga0265316_10002063 3300031344 Bacteria 21156
174 Ga0265316_10024631 3300031344 Bacteria 5035
175 Ga0265316_10030045 3300031344 Bacteria 4461
176 Ga0265316_10419771 3300031344 Bacteria 962
177 Ga0307408_100110079 3300031548 Bacteria 2114
178 Ga0307408_100489060 3300031548 Bacteria 1075
179 Ga0265313_10001858 3300031595 Bacteria 19223
180 Ga0265314_10009502 3300031711 Archaea 8200
181 Ga0265314_10035247 3300031711 Bacteria 3649
182 Ga0265342_10001393 3300031712 Bacteria 22613
183 Ga0265342_10002794 3300031712 Bacteria 14771
184 Ga0265342_10042948 3300031712 Archaea 2729
185 Ga0265342_10348742 3300031712 Unclassified 771
186 Ga0307405_10011066 3300031731 Bacteria 4710
187 Ga0307405_10190300 3300031731 Bacteria 1482
188 Ga0316577_10098841 3300031733 Bacteria 1635
189 Ga0307410_10070226 3300031852 Bacteria 2425
190 Ga0307406_10004934 3300031901 Bacteria 7270
191 Ga0307406_10388253 3300031901 Bacteria 1103
192 Ga0307407_10058035 3300031903 Bacteria 2248
193 Ga0307407_10592180 3300031903 Bacteria 825
194 Ga0307412_10378952 3300031911 Bacteria 1145
195 Ga0307412_10672887 3300031911 Bacteria 885
196 Ga0307409_100000840 3300031995 Bacteria 14150
197 Ga0307409_100167672 3300031995 Bacteria 1929
198 Ga0307416_100041393 3300032002 Bacteria 3588
199 Ga0307416_100167307 3300032002 Bacteria 2041
200 Ga0307414_10067788 3300032004 Bacteria 2558
201 Ga0307414_10401062 3300032004 Bacteria 1191
202 Ga0307415_100007195 3300032126 Bacteria 6071
203 Ga0307415_100067191 3300032126 Bacteria 2504
204 Ga0373926_0015607 3300035083 Bacteria 2590
205 Ga0373923_0445956 3300035111 Unclassified 627
206 Ga0373945_0219165 3300035116 Unclassified 795
207 Ga0373956_0206032 3300035119 Unclassified 932
208 Ga0373943_0069322 3300035170 Bacteria 1782
209 Ga0373935_0102878 3300035692 Bacteria 1885
210 Ga0373933_0000404 3300035724 Bacteria 27329
211 Ga0373937_0001737 3300036401 Bacteria 18330
212 Ga0373937_0050861 3300036401 Bacteria 3797
213 Ga0395905_0407548 3300037471 Bacteria 1255
214 Ga0395905_0432434 3300037471 Bacteria 1213
215 Ga0395901_0334214 3300038443 Bacteria 1566
216 Ga0395901_0995164 3300038443 Bacteria 815
217 Ga0400484_00615 3300038725 Bacteria 15949
218 Ga0400484_27425 3300038725 Bacteria 2237
219 Ga0400488_45007 3300038741 Bacteria 4880
220 Ga0436365_0522242 3300039437 Bacteria 1774
221 Ga0436361_0048153 3300039447 Bacteria 35068
222 Ga0439448_0041167 3300042005 Bacteria 1494
223 Ga0439448_0042255 3300042005 Bacteria 1477
224 Ga0439448_0267776 3300042005 Bacteria 604
225 Ga0439450_120352 3300042008 Unclassified 676
226 Ga0439455_0034666 3300042012 Bacteria 1271
227 Ga0439458_0044397 3300042157 Bacteria 1085
228 Ga0450916_004390 3300042530 Bacteria 1590
229 Ga0439440_0043548 3300042993 Bacteria 1101
230 Ga0439440_0127217 3300042993 Bacteria 714
231 Ga0466969_0092899 3300044656 Unclassified 1428
232 Ga0453683_0056340 3300044673 Bacteria 2460
233 Ga0453683_0068094 3300044673 Bacteria 2225
234 Ga0453683_0147763 3300044673 Bacteria 1484
235 Ga0453683_0630609 3300044673 Bacteria 700
236 Ga0466963_0708939 3300044694 Unclassified 710
237 Ga0453684_0000003 3300044712 Bacteria 1481694
238 Ga0453684_0186996 3300044712 Unclassified 2426
239 Ga0453684_0796260 3300044712 Bacteria 1020
240 Ga0451576_0000454 3300045051 Bacteria 93047
241 Ga0495590_0000594 3300046457 Bacteria 17084
242 Ga0495638_0001299 3300046460 Bacteria 23183
243 Ga0495650_0009567 3300046471 Bacteria 5500
244 Ga0495580_0533989 3300046472 Bacteria 780
245 Ga0495583_0218412 3300046506 Unclassified 771
246 Ga0495610_0007755 3300046512 Bacteria 7084
247 Ga0495631_0014535 3300046518 Bacteria 3797
248 Ga0495637_0082473 3300046520 Bacteria 1280
249 Ga0495652_0492147 3300046529 Bacteria 852
250 Ga0495597_0039404 3300046542 Bacteria 2116
251 Ga0495668_0005138 3300046616 Bacteria 8996
252 Ga0495588_0167498 3300046674 Bacteria 1162
253 Ga0495623_0255428 3300046679 Unclassified 984
254 Ga0495675_0054062 3300047444 Bacteria 2549
255 Ga0495686_0001132 3300047472 Bacteria 31511
256 Ga0495686_0020318 3300047472 Bacteria 4429
257 Ga0496102_0094668 3300048905 Bacteria 2768
258 Ga0496107_0229997 3300048910 Bacteria 1380
259 Ga0496112_0559645 3300048915 Bacteria 1077
260 Ga0496115_0127896 3300048918 Bacteria 2093
261 Ga0495678_010621 3300049459 Bacteria 4461
262 Ga0501031_0000761 3300049568 Bacteria 19398
263 Ga0501033_0036977 3300049570 Bacteria 3657
264 Ga0501036_0000024 3300049572 Bacteria 110026
265 Ga0501036_0721609 3300049572 Unclassified 823
266 Ga0501037_0025201 3300049573 Bacteria 4395
267 Ga0501038_0003033 3300049574 Bacteria 15665
268 Ga0501038_0270214 3300049574 Bacteria 1341
269 Ga0501039_0001763 3300049575 Bacteria 15968
270 Ga0501039_0079373 3300049575 Bacteria 2553
271 Ga0501039_0255045 3300049575 Bacteria 1379
272 Ga0501040_0008548 3300049576 Bacteria 6644
273 Ga0501040_0318875 3300049576 Bacteria 1112
274 Ga0501041_0004336 3300049577 Bacteria 8203
275 Ga0501041_0243797 3300049577 Bacteria 1129
276 Ga0501042_0000661 3300049578 Bacteria 18527
277 Ga0501042_0132066 3300049578 Bacteria 1799
278 Ga0501042_0251650 3300049578 Bacteria 1275
279 Ga0501042_0274982 3300049578 Bacteria 1216
280 Ga0501043_0024895 3300049579 Bacteria 4696
281 Ga0501046_0000495 3300049580 Bacteria 39248
282 Ga0501048_0000192 3300049582 Bacteria 39421
283 Ga0501048_0110298 3300049582 Bacteria 1943
284 Ga0501067_0006892 3300049583 Bacteria 6305
285 Ga0501068_0012296 3300049584 Bacteria 4845
286 Ga0501070_0423275 3300049586 Bacteria 1075
287 Ga0501071_0000269 3300049587 Bacteria 24497
288 Ga0501071_0023696 3300049587 Bacteria 4288
289 Ga0501071_0081252 3300049587 Bacteria 2372
290 Ga0501071_1000788 3300049587 Bacteria 646
291 Ga0501072_0001510 3300049588 Bacteria 17434
292 Ga0501072_0013750 3300049588 Bacteria 6197
293 Ga0501073_0001056 3300049589 Bacteria 19872
294 Ga0501074_0001129 3300049590 Bacteria 17480
295 Ga0501075_0000132 3300049591 Bacteria 37143
296 Ga0501075_0007249 3300049591 Bacteria 7688
297 Ga0501075_0153916 3300049591 Bacteria 1753
298 Ga0501076_0008195 3300049592 Bacteria 7653
299 Ga0501076_0077364 3300049592 Bacteria 2669
300 Ga0501077_0001549 3300049593 Bacteria 13860
301 Ga0501077_0016257 3300049593 Bacteria 4687
302 Ga0501077_0649548 3300049593 Bacteria 678
303 Ga0501080_0039480 3300049742 Bacteria 4405
304 Ga0501081_0006838 3300049743 Bacteria 7418
305 Ga0501081_0076879 3300049743 Bacteria 2332
306 Ga0501035_0002557 3300049822 Bacteria 17793
307 Ga0501035_0630793 3300049822 Bacteria 871
308 Ga0501044_0226752 3300049823 Bacteria 1818
309 Ga0501045_0000216 3300049824 Bacteria 33098
310 nmdc:mga0k408_278341_c1 3300050493 Bacteria 999
311 nmdc:mga05p37_10372_c1 3300050507 Bacteria 11061
312 nmdc:mga05p37_10682_c1 3300050507 Bacteria 10898
313 nmdc:mga05p37_11280_c1 3300050507 Bacteria 10628
314 nmdc:mga05p37_1137176_c1 3300050507 Bacteria 814
315 nmdc:mga05p37_286671_c1 3300050507 Bacteria 1961
316 nmdc:mga05p37_52837_c1 3300050507 Bacteria 4996
317 nmdc:mga05p37_571600_c1 3300050507 Bacteria 1282
318 nmdc:mga05p37_612593_c1 3300050507 Unclassified 1227
319 nmdc:mga09592_4085_c1 3300050508 Bacteria 11785
320 nmdc:mga09592_75465_c1 3300050508 Unclassified 2866
321 nmdc:mga0qj67_316319_c1 3300050509 Bacteria 1264
322 nmdc:mga0qj67_364194_c1 3300050509 Bacteria 1168
323 nmdc:mga06r32_346043_c1 3300050510 Bacteria 1471
324 nmdc:mga06r32_40284_c1 3300050510 Bacteria 4434
325 nmdc:mga06r32_549261_c1 3300050510 Bacteria 1129
326 nmdc:mga08y16_1454_c1 3300050511 Bacteria 23727
327 nmdc:mga08y16_62637_c1 3300050511 Bacteria 3885
328 nmdc:mga08y16_752277_c1 3300050511 Bacteria 971
329 nmdc:mga08y16_9117_c1 3300050511 Bacteria 10414
330 nmdc:mga0n895_162378_c1 3300050512 Unclassified 2266
331 nmdc:mga0n895_26283_c1 3300050512 Bacteria 5511
332 nmdc:mga0n895_725948_c1 3300050512 Bacteria 988
333 nmdc:mga0rr50_130717_c1 3300050513 Bacteria 2010
334 nmdc:mga0rr50_23108_c1 3300050513 Bacteria 4281
335 nmdc:mga0rr50_411270_c1 3300050513 Bacteria 1144
336 nmdc:mga0rr50_546745_c1 3300050513 Bacteria 986
337 nmdc:mga0a205_45076_c1 3300050515 Bacteria 4252
338 nmdc:mga0a205_559116_c1 3300050515 Bacteria 999
339 nmdc:mga0a205_6351_c1 3300050515 Bacteria 10674
340 Ga0495601_0503920 3300053077 Unclassified 781
341 Ga0495655_0008563 3300053083 Bacteria 1949
342 Ga0500578_0000895 3300053086 Bacteria 33760
343 Ga0500644_0003310 3300053088 Bacteria 3984
344 Ga0500646_0209818 3300053090 Bacteria 672
345 Ga0500641_0031334 3300053096 Bacteria 2096
346 Ga0500562_002922 3300053108 Bacteria 4268
347 Ga0500594_0000062 3300053118 Bacteria 33367
348 Ga0500559_0303061 3300053136 Bacteria 750
349 Ga0500622_0009854 3300053156 Bacteria 5272
350 Ga0501084_0003198 3300054114 Bacteria 13258
351 Ga0501084_0029363 3300054114 Bacteria 4600
352 Ga0501082_0002116 3300060353 Bacteria 17493
353 Ga0530510_0000013 3300061734 Bacteria 110065
354 Ga0530510_0106893 3300061734 Bacteria 2048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10190300 Ga0307405_101903002 165
2 iso_pu_bacteria 2582581279 2585150262 167
3 3300005434 Ga0070709_10647457 Ga0070709_106474572 169
4 3300006173 Ga0070716_100084645 Ga0070716_1000846452 169
5 3300028577 Ga0265318_10177878 Ga0265318_101778782 170
6 3300031903 Ga0307407_10592180 Ga0307407_105921802 170
7 3300035111 Ga0373923_0445956 Ga0373923_0445956_11_532 170
8 3300046679 Ga0495623_0255428 Ga0495623_0255428_14_538 170
9 3300049593 Ga0501077_0016257 Ga0501077_0016257_1157_1702 170
10 3300046457 Ga0495590_0000594 Ga0495590_0000594_13423_13962 171
11 3300046460 Ga0495638_0001299 Ga0495638_0001299_4478_5017 171
12 3300046471 Ga0495650_0009567 Ga0495650_0009567_1400_1939 171
13 3300046506 Ga0495583_0218412 Ga0495583_0218412_47_586 171
14 3300046512 Ga0495610_0007755 Ga0495610_0007755_3139_3678 171
15 3300046518 Ga0495631_0014535 Ga0495631_0014535_383_922 171
16 3300046520 Ga0495637_0082473 Ga0495637_0082473_705_1244 171
17 3300046542 Ga0495597_0039404 Ga0495597_0039404_1154_1693 171
18 3300046616 Ga0495668_0005138 Ga0495668_0005138_4997_5536 171
19 3300047472 Ga0495686_0001132 Ga0495686_0001132_15737_16276 171
20 3300047472 Ga0495686_0020318 Ga0495686_0020318_2891_3430 171
21 3300049459 Ga0495678_010621 Ga0495678_010621_3133_3672 171
22 3300053086 Ga0500578_0000895 Ga0500578_0000895_13146_13685 171
23 3300053088 Ga0500644_0003310 Ga0500644_0003310_2564_3103 171
24 3300053090 Ga0500646_0209818 Ga0500646_0209818_20_559 171
25 3300053096 Ga0500641_0031334 Ga0500641_0031334_213_752 171
26 3300053108 Ga0500562_002922 Ga0500562_002922_560_1099 171
27 3300053118 Ga0500594_0000062 Ga0500594_0000062_19837_20376 171
28 3300053156 Ga0500622_0009854 Ga0500622_0009854_3158_3697 171
29 3300028794 Ga0307515_10031589 Ga0307515_100315895 172
30 3300044673 Ga0453683_0056340 Ga0453683_0056340_1079_1645 172
31 3300005844 Ga0068862_101591409 Ga0068862_1015914091 173
32 3300028380 Ga0268265_11348863 Ga0268265_113488632 173
33 3300009093 Ga0105240_10059398 Ga0105240_100593982 174
34 3300005435 Ga0070714_100061676 Ga0070714_1000616763 175
35 3300005445 Ga0070708_100704559 Ga0070708_1007045591 175
36 3300005937 Ga0081455_10007276 Ga0081455_100072766 175
37 3300025929 Ga0207664_10063211 Ga0207664_100632112 175
38 3300028558 Ga0265326_10000135 Ga0265326_1000013519 175
39 3300028563 Ga0265319_1062807 Ga0265319_10628072 175
40 3300028573 Ga0265334_10001044 Ga0265334_1000104416 175
41 3300028666 Ga0265336_10000249 Ga0265336_1000024919 175
42 3300028800 Ga0265338_10000406 Ga0265338_1000040625 175
43 3300029957 Ga0265324_10000272 Ga0265324_1000027224 175
44 3300031235 Ga0265330_10002824 Ga0265330_100028242 175
45 3300031241 Ga0265325_10011178 Ga0265325_100111783 175
46 3300031247 Ga0265340_10000040 Ga0265340_1000004042 175
47 3300031249 Ga0265339_10003266 Ga0265339_100032663 175
48 3300031249 Ga0265339_10005415 Ga0265339_100054155 175
49 3300031250 Ga0265331_10000071 Ga0265331_10000071105 175
50 3300031344 Ga0265316_10002063 Ga0265316_100020633 175
51 3300031595 Ga0265313_10001858 Ga0265313_1000185810 175
52 3300031711 Ga0265314_10009502 Ga0265314_100095028 175
53 3300031712 Ga0265342_10002794 Ga0265342_1000279410 175
54 3300031712 Ga0265342_10042948 Ga0265342_100429483 175
55 3300035119 Ga0373956_0206032 Ga0373956_0206032_357_908 175
56 3300036401 Ga0373937_0050861 Ga0373937_0050861_85_636 175
57 3300044656 Ga0466969_0092899 Ga0466969_0092899_91_618 175
58 3300044694 Ga0466963_0708939 Ga0466963_0708939_162_689 175
59 3300003373 JGI25407J50210_10004743 JGI25407J50210_100047433 176
60 3300005355 Ga0070671_100715476 Ga0070671_1007154762 176
61 3300005434 Ga0070709_10084445 Ga0070709_100844452 176
62 3300005436 Ga0070713_100036833 Ga0070713_1000368333 176
63 3300005440 Ga0070705_100096945 Ga0070705_1000969452 176
64 3300005455 Ga0070663_100483642 Ga0070663_1004836422 176
65 3300005468 Ga0070707_100234774 Ga0070707_1002347742 176
66 3300005471 Ga0070698_100053517 Ga0070698_1000535174 176
67 3300005518 Ga0070699_100025692 Ga0070699_1000256922 176
68 3300005518 Ga0070699_100613233 Ga0070699_1006132332 176
69 3300005536 Ga0070697_100038588 Ga0070697_1000385883 176
70 3300005536 Ga0070697_100131130 Ga0070697_1001311302 176
71 3300005536 Ga0070697_100225118 Ga0070697_1002251182 176
72 3300005546 Ga0070696_100041904 Ga0070696_1000419043 176
73 3300005937 Ga0081455_10006967 Ga0081455_100069676 176
74 3300005937 Ga0081455_10014788 Ga0081455_100147883 176
75 3300005981 Ga0081538_10001180 Ga0081538_1000118015 176
76 3300005985 Ga0081539_10058578 Ga0081539_100585782 176
77 3300006163 Ga0070715_10090659 Ga0070715_100906592 176
78 3300006846 Ga0075430_100487359 Ga0075430_1004873592 176
79 3300006847 Ga0075431_100030386 Ga0075431_1000303863 176
80 3300006847 Ga0075431_101304321 Ga0075431_1013043212 176
81 3300006852 Ga0075433_10007886 Ga0075433_100078862 176
82 3300006852 Ga0075433_10810956 Ga0075433_108109561 176
83 3300006871 Ga0075434_100036850 Ga0075434_1000368503 176
84 3300006871 Ga0075434_100084558 Ga0075434_1000845588 176
85 3300006871 Ga0075434_101180538 Ga0075434_1011805382 176
86 3300006914 Ga0075436_100005554 Ga0075436_1000055548 176
87 3300007076 Ga0075435_100247518 Ga0075435_1002475182 176
88 3300009094 Ga0111539_10010935 Ga0111539_100109354 176
89 3300009094 Ga0111539_11184092 Ga0111539_111840921 176
90 3300009147 Ga0114129_10019473 Ga0114129_1001947313 176
91 3300009147 Ga0114129_10320353 Ga0114129_103203532 176
92 3300009174 Ga0105241_10869402 Ga0105241_108694022 176
93 3300009176 Ga0105242_10082681 Ga0105242_100826813 176
94 3300009177 Ga0105248_11096497 Ga0105248_110964972 176
95 3300009545 Ga0105237_10249847 Ga0105237_102498471 176
96 3300009551 Ga0105238_11349945 Ga0105238_113499451 176
97 3300009553 Ga0105249_10595022 Ga0105249_105950221 176
98 3300013296 Ga0157374_10343604 Ga0157374_103436042 176
99 3300013308 Ga0157375_10302600 Ga0157375_103026002 176
100 3300013308 Ga0157375_10701852 Ga0157375_107018522 176
101 3300014969 Ga0157376_10028152 Ga0157376_100281524 176
102 3300021361 Ga0213872_10009438 Ga0213872_100094383 176
103 3300021384 Ga0213876_10257606 Ga0213876_102576061 176
104 3300025906 Ga0207699_10055315 Ga0207699_100553153 176
105 3300025906 Ga0207699_10062036 Ga0207699_100620363 176
106 3300025910 Ga0207684_11075796 Ga0207684_110757961 176
107 3300025922 Ga0207646_10042761 Ga0207646_100427612 176
108 3300025922 Ga0207646_10384028 Ga0207646_103840282 176
109 3300025931 Ga0207644_10653712 Ga0207644_106537122 176
110 3300025939 Ga0207665_10006478 Ga0207665_100064786 176
111 3300025961 Ga0207712_10640492 Ga0207712_106404922 176
112 3300026118 Ga0207675_100043532 Ga0207675_1000435326 176
113 3300027907 Ga0207428_10038696 Ga0207428_100386964 176
114 3300027907 Ga0207428_10425233 Ga0207428_104252333 176
115 3300028380 Ga0268265_10437188 Ga0268265_104371882 176
116 3300028563 Ga0265319_1021456 Ga0265319_10214562 176
117 3300031240 Ga0265320_10006623 Ga0265320_100066237 176
118 3300031241 Ga0265325_10045715 Ga0265325_100457153 176
119 3300031344 Ga0265316_10419771 Ga0265316_104197712 176
120 3300031548 Ga0307408_100110079 Ga0307408_1001100792 176
121 3300031548 Ga0307408_100489060 Ga0307408_1004890602 176
122 3300031731 Ga0307405_10011066 Ga0307405_100110666 176
123 3300031852 Ga0307410_10070226 Ga0307410_100702263 176
124 3300031901 Ga0307406_10004934 Ga0307406_100049347 176
125 3300031903 Ga0307407_10058035 Ga0307407_100580352 176
126 3300031911 Ga0307412_10672887 Ga0307412_106728872 176
127 3300031995 Ga0307409_100000840 Ga0307409_1000008407 176
128 3300031995 Ga0307409_100167672 Ga0307409_1001676722 176
129 3300032002 Ga0307416_100167307 Ga0307416_1001673072 176
130 3300032004 Ga0307414_10067788 Ga0307414_100677882 176
131 3300032004 Ga0307414_10401062 Ga0307414_104010622 176
132 3300032126 Ga0307415_100007195 Ga0307415_1000071955 176
133 3300032126 Ga0307415_100067191 Ga0307415_1000671913 176
134 3300037471 Ga0395905_0407548 Ga0395905_0407548_65_595 176
135 3300038443 Ga0395901_0995164 Ga0395901_0995164_124_654 176
136 3300039437 Ga0436365_0522242 Ga0436365_0522242_452_982 176
137 3300039447 Ga0436361_0048153 Ga0436361_0048153_18247_18777 176
138 3300042005 Ga0439448_0041167 Ga0439448_0041167_736_1266 176
139 3300042005 Ga0439448_0042255 Ga0439448_0042255_315_845 176
140 3300042005 Ga0439448_0267776 Ga0439448_0267776_19_549 176
141 3300042008 Ga0439450_120352 Ga0439450_120352_62_592 176
142 3300042012 Ga0439455_0034666 Ga0439455_0034666_428_958 176
143 3300042157 Ga0439458_0044397 Ga0439458_0044397_468_998 176
144 3300042530 Ga0450916_004390 Ga0450916_004390_779_1309 176
145 3300042993 Ga0439440_0043548 Ga0439440_0043548_301_831 176
146 3300044673 Ga0453683_0068094 Ga0453683_0068094_844_1374 176
147 3300044673 Ga0453683_0630609 Ga0453683_0630609_33_563 176
148 3300044712 Ga0453684_0000003 Ga0453684_0000003_430821_431351 176
149 3300046529 Ga0495652_0492147 Ga0495652_0492147_184_714 176
150 3300048905 Ga0496102_0094668 Ga0496102_0094668_459_989 176
151 3300048910 Ga0496107_0229997 Ga0496107_0229997_342_872 176
152 3300048918 Ga0496115_0127896 Ga0496115_0127896_101_631 176
153 3300049568 Ga0501031_0000761 Ga0501031_0000761_7915_8445 176
154 3300049570 Ga0501033_0036977 Ga0501033_0036977_2636_3166 176
155 3300049572 Ga0501036_0000024 Ga0501036_0000024_105683_106213 176
156 3300049573 Ga0501037_0025201 Ga0501037_0025201_3222_3752 176
157 3300049574 Ga0501038_0003033 Ga0501038_0003033_11298_11828 176
158 3300049575 Ga0501039_0001763 Ga0501039_0001763_15285_15815 176
159 3300049576 Ga0501040_0008548 Ga0501040_0008548_2302_2832 176
160 3300049577 Ga0501041_0004336 Ga0501041_0004336_3513_4043 176
161 3300049578 Ga0501042_0000661 Ga0501042_0000661_3867_4397 176
162 3300049579 Ga0501043_0024895 Ga0501043_0024895_2216_2746 176
163 3300049580 Ga0501046_0000495 Ga0501046_0000495_34912_35442 176
164 3300049582 Ga0501048_0000192 Ga0501048_0000192_3801_4331 176
165 3300049584 Ga0501068_0012296 Ga0501068_0012296_703_1233 176
166 3300049586 Ga0501070_0423275 Ga0501070_0423275_374_904 176
167 3300049587 Ga0501071_0000269 Ga0501071_0000269_15188_15718 176
168 3300049588 Ga0501072_0001510 Ga0501072_0001510_3818_4348 176
169 3300049590 Ga0501074_0001129 Ga0501074_0001129_13112_13642 176
170 3300049591 Ga0501075_0000132 Ga0501075_0000132_32859_33389 176
171 3300049592 Ga0501076_0008195 Ga0501076_0008195_3821_4351 176
172 3300049593 Ga0501077_0001549 Ga0501077_0001549_11222_11752 176
173 3300049742 Ga0501080_0039480 Ga0501080_0039480_500_1030 176
174 3300049743 Ga0501081_0006838 Ga0501081_0006838_3030_3560 176
175 3300049822 Ga0501035_0002557 Ga0501035_0002557_13496_14026 176
176 3300049823 Ga0501044_0226752 Ga0501044_0226752_492_1022 176
177 3300049824 Ga0501045_0000216 Ga0501045_0000216_32415_32945 176
178 3300050507 nmdc:mga05p37_11280_c1 nmdc:mga05p37_11280_c1_7257_7787 176
179 3300050507 nmdc:mga05p37_286671_c1 nmdc:mga05p37_286671_c1_145_675 176
180 3300050510 nmdc:mga06r32_40284_c1 nmdc:mga06r32_40284_c1_2499_3029 176
181 3300050511 nmdc:mga08y16_62637_c1 nmdc:mga08y16_62637_c1_3339_3869 176
182 3300050511 nmdc:mga08y16_752277_c1 nmdc:mga08y16_752277_c1_296_826 176
183 3300050512 nmdc:mga0n895_162378_c1 nmdc:mga0n895_162378_c1_1607_2137 176
184 3300050512 nmdc:mga0n895_26283_c1 nmdc:mga0n895_26283_c1_4410_4940 176
185 3300050512 nmdc:mga0n895_725948_c1 nmdc:mga0n895_725948_c1_335_865 176
186 3300050513 nmdc:mga0rr50_546745_c1 nmdc:mga0rr50_546745_c1_231_761 176
187 3300050515 nmdc:mga0a205_45076_c1 nmdc:mga0a205_45076_c1_2448_2978 176
188 3300050515 nmdc:mga0a205_6351_c1 nmdc:mga0a205_6351_c1_7217_7747 176
189 3300053077 Ga0495601_0503920 Ga0495601_0503920_98_628 176
190 3300053083 Ga0495655_0008563 Ga0495655_0008563_661_1191 176
191 3300053136 Ga0500559_0303061 Ga0500559_0303061_175_705 176
192 3300054114 Ga0501084_0003198 Ga0501084_0003198_8874_9404 176
193 3300060353 Ga0501082_0002116 Ga0501082_0002116_12832_13362 176
194 3300061734 Ga0530510_0000013 Ga0530510_0000013_3869_4399 176
195 3300002459 JGI24751J29686_10019127 JGI24751J29686_100191273 177
196 3300005331 Ga0070670_100008590 Ga0070670_1000085906 177
197 3300005340 Ga0070689_100489165 Ga0070689_1004891651 177
198 3300005343 Ga0070687_100081226 Ga0070687_1000812262 177
199 3300005439 Ga0070711_100094735 Ga0070711_1000947352 177
200 3300005440 Ga0070705_100641188 Ga0070705_1006411881 177
201 3300005444 Ga0070694_100003717 Ga0070694_1000037174 177
202 3300005445 Ga0070708_100064449 Ga0070708_1000644492 177
203 3300005467 Ga0070706_100004114 Ga0070706_10000411411 177
204 3300005467 Ga0070706_100880984 Ga0070706_1008809842 177
205 3300005468 Ga0070707_100003707 Ga0070707_1000037075 177
206 3300005468 Ga0070707_100098810 Ga0070707_1000988102 177
207 3300005471 Ga0070698_100000421 Ga0070698_1000004215 177
208 3300005471 Ga0070698_100012476 Ga0070698_1000124765 177
209 3300005518 Ga0070699_100007663 Ga0070699_1000076632 177
210 3300005518 Ga0070699_100011287 Ga0070699_1000112875 177
211 3300005518 Ga0070699_100025905 Ga0070699_1000259052 177
212 3300005518 Ga0070699_100049956 Ga0070699_1000499562 177
213 3300005536 Ga0070697_100009482 Ga0070697_1000094829 177
214 3300005546 Ga0070696_100000070 Ga0070696_1000000707 177
215 3300005547 Ga0070693_100000653 Ga0070693_1000006538 177
216 3300005549 Ga0070704_100003430 Ga0070704_1000034308 177
217 3300005549 Ga0070704_100166071 Ga0070704_1001660712 177
218 3300005549 Ga0070704_100255965 Ga0070704_1002559652 177
219 3300005577 Ga0068857_100173038 Ga0068857_1001730382 177
220 3300005719 Ga0068861_100018447 Ga0068861_1000184473 177
221 3300005840 Ga0068870_10037227 Ga0068870_100372273 177
222 3300005843 Ga0068860_100298752 Ga0068860_1002987522 177
223 3300005937 Ga0081455_10002275 Ga0081455_1000227525 177
224 3300005981 Ga0081538_10008658 Ga0081538_100086587 177
225 3300005981 Ga0081538_10024992 Ga0081538_100249924 177
226 3300006058 Ga0075432_10122453 Ga0075432_101224532 177
227 3300006163 Ga0070715_10218522 Ga0070715_102185221 177
228 3300006173 Ga0070716_100093545 Ga0070716_1000935452 177
229 3300006195 Ga0075366_10073644 Ga0075366_100736442 177
230 3300006844 Ga0075428_100046298 Ga0075428_1000462984 177
231 3300006844 Ga0075428_100229562 Ga0075428_1002295622 177
232 3300006846 Ga0075430_100378732 Ga0075430_1003787321 177
233 3300006846 Ga0075430_100439003 Ga0075430_1004390032 177
234 3300006847 Ga0075431_100113559 Ga0075431_1001135593 177
235 3300006847 Ga0075431_100165163 Ga0075431_1001651632 177
236 3300006852 Ga0075433_10093422 Ga0075433_100934222 177
237 3300006852 Ga0075433_10192590 Ga0075433_101925902 177
238 3300006871 Ga0075434_100063066 Ga0075434_1000630665 177
239 3300006871 Ga0075434_100257948 Ga0075434_1002579482 177
240 3300006880 Ga0075429_100008472 Ga0075429_1000084725 177
241 3300006880 Ga0075429_100141737 Ga0075429_1001417372 177
242 3300006914 Ga0075436_100449256 Ga0075436_1004492561 177
243 3300007076 Ga0075435_100144526 Ga0075435_1001445261 177
244 3300007076 Ga0075435_100545207 Ga0075435_1005452071 177
245 3300009094 Ga0111539_10002204 Ga0111539_100022049 177
246 3300009094 Ga0111539_10013138 Ga0111539_100131385 177
247 3300009094 Ga0111539_10360570 Ga0111539_103605702 177
248 3300009094 Ga0111539_12538748 Ga0111539_125387481 177
249 3300009147 Ga0114129_10013718 Ga0114129_100137185 177
250 3300009147 Ga0114129_10014963 Ga0114129_100149636 177
251 3300009147 Ga0114129_10053539 Ga0114129_100535395 177
252 3300009147 Ga0114129_10075872 Ga0114129_100758723 177
253 3300009147 Ga0114129_10104064 Ga0114129_101040644 177
254 3300009147 Ga0114129_10142048 Ga0114129_101420482 177
255 3300009147 Ga0114129_10589334 Ga0114129_105893343 177
256 3300009147 Ga0114129_11010126 Ga0114129_110101261 177
257 3300009148 Ga0105243_10069015 Ga0105243_100690152 177
258 3300009177 Ga0105248_10502261 Ga0105248_105022612 177
259 3300011119 Ga0105246_10353168 Ga0105246_103531682 177
260 3300025908 Ga0207643_10006388 Ga0207643_100063887 177
261 3300025910 Ga0207684_10026968 Ga0207684_100269682 177
262 3300025910 Ga0207684_10036018 Ga0207684_100360183 177
263 3300025916 Ga0207663_10077944 Ga0207663_100779443 177
264 3300025922 Ga0207646_10004780 Ga0207646_100047809 177
265 3300025922 Ga0207646_10009041 Ga0207646_100090415 177
266 3300025925 Ga0207650_10011743 Ga0207650_100117435 177
267 3300025935 Ga0207709_10038274 Ga0207709_100382743 177
268 3300025942 Ga0207689_10470070 Ga0207689_104700702 177
269 3300025949 Ga0207667_10001271 Ga0207667_1000127123 177
270 3300026116 Ga0207674_10215909 Ga0207674_102159092 177
271 3300027907 Ga0207428_10007306 Ga0207428_100073068 177
272 3300027907 Ga0207428_10015102 Ga0207428_100151022 177
273 3300027907 Ga0207428_10087840 Ga0207428_100878403 177
274 3300028380 Ga0268265_10251047 Ga0268265_102510472 177
275 3300028381 Ga0268264_10488918 Ga0268264_104889182 177
276 3300028573 Ga0265334_10047759 Ga0265334_100477592 177
277 3300028653 Ga0265323_10007219 Ga0265323_100072194 177
278 3300028666 Ga0265336_10015488 Ga0265336_100154882 177
279 3300028800 Ga0265338_10015145 Ga0265338_100151452 177
280 3300028800 Ga0265338_10274699 Ga0265338_102746992 177
281 3300028800 Ga0265338_10340300 Ga0265338_103403001 177
282 3300031247 Ga0265340_10107517 Ga0265340_101075172 177
283 3300031249 Ga0265339_10226327 Ga0265339_102263271 177
284 3300031344 Ga0265316_10024631 Ga0265316_100246313 177
285 3300031344 Ga0265316_10030045 Ga0265316_100300452 177
286 3300031711 Ga0265314_10035247 Ga0265314_100352473 177
287 3300031712 Ga0265342_10001393 Ga0265342_100013931 177
288 3300031712 Ga0265342_10348742 Ga0265342_103487422 177
289 3300031733 Ga0316577_10098841 Ga0316577_100988412 177
290 3300031901 Ga0307406_10388253 Ga0307406_103882532 177
291 3300031911 Ga0307412_10378952 Ga0307412_103789522 177
292 3300032002 Ga0307416_100041393 Ga0307416_1000413933 177
293 3300035083 Ga0373926_0015607 Ga0373926_0015607_494_1036 177
294 3300035116 Ga0373945_0219165 Ga0373945_0219165_17_559 177
295 3300035170 Ga0373943_0069322 Ga0373943_0069322_920_1462 177
296 3300035692 Ga0373935_0102878 Ga0373935_0102878_102_644 177
297 3300035724 Ga0373933_0000404 Ga0373933_0000404_17191_17733 177
298 3300036401 Ga0373937_0001737 Ga0373937_0001737_15043_15585 177
299 3300037471 Ga0395905_0432434 Ga0395905_0432434_614_1174 177
300 3300038443 Ga0395901_0334214 Ga0395901_0334214_613_1173 177
301 3300038725 Ga0400484_00615 Ga0400484_00615_934_1470 177
302 3300038725 Ga0400484_27425 Ga0400484_27425_676_1227 177
303 3300038741 Ga0400488_45007 Ga0400488_45007_3371_3907 177
304 3300042993 Ga0439440_0127217 Ga0439440_0127217_90_638 177
305 3300044673 Ga0453683_0147763 Ga0453683_0147763_771_1313 177
306 3300044712 Ga0453684_0186996 Ga0453684_0186996_252_791 177
307 3300044712 Ga0453684_0796260 Ga0453684_0796260_344_886 177
308 3300045051 Ga0451576_0000454 Ga0451576_0000454_9605_10147 177
309 3300046472 Ga0495580_0533989 Ga0495580_0533989_12_554 177
310 3300046674 Ga0495588_0167498 Ga0495588_0167498_141_677 177
311 3300047444 Ga0495675_0054062 Ga0495675_0054062_1967_2512 177
312 3300048915 Ga0496112_0559645 Ga0496112_0559645_314_865 177
313 3300049572 Ga0501036_0721609 Ga0501036_0721609_165_719 177
314 3300049574 Ga0501038_0270214 Ga0501038_0270214_321_857 177
315 3300049575 Ga0501039_0079373 Ga0501039_0079373_409_945 177
316 3300049575 Ga0501039_0255045 Ga0501039_0255045_229_783 177
317 3300049576 Ga0501040_0318875 Ga0501040_0318875_36_572 177
318 3300049577 Ga0501041_0243797 Ga0501041_0243797_152_688 177
319 3300049578 Ga0501042_0132066 Ga0501042_0132066_1246_1782 177
320 3300049578 Ga0501042_0251650 Ga0501042_0251650_569_1102 177
321 3300049578 Ga0501042_0274982 Ga0501042_0274982_451_1005 177
322 3300049582 Ga0501048_0110298 Ga0501048_0110298_1127_1663 177
323 3300049583 Ga0501067_0006892 Ga0501067_0006892_1365_1898 177
324 3300049587 Ga0501071_0023696 Ga0501071_0023696_337_873 177
325 3300049587 Ga0501071_0081252 Ga0501071_0081252_1447_2001 177
326 3300049587 Ga0501071_1000788 Ga0501071_1000788_40_588 177
327 3300049588 Ga0501072_0013750 Ga0501072_0013750_1471_2007 177
328 3300049589 Ga0501073_0001056 Ga0501073_0001056_8064_8597 177
329 3300049591 Ga0501075_0007249 Ga0501075_0007249_5931_6485 177
330 3300049591 Ga0501075_0153916 Ga0501075_0153916_541_1077 177
331 3300049592 Ga0501076_0077364 Ga0501076_0077364_1048_1584 177
332 3300049593 Ga0501077_0649548 Ga0501077_0649548_88_642 177
333 3300049743 Ga0501081_0076879 Ga0501081_0076879_1441_1995 177
334 3300049822 Ga0501035_0630793 Ga0501035_0630793_218_772 177
335 3300050493 nmdc:mga0k408_278341_c1 nmdc:mga0k408_278341_c1_208_759 177
336 3300050507 nmdc:mga05p37_10372_c1 nmdc:mga05p37_10372_c1_6997_7542 177
337 3300050507 nmdc:mga05p37_10682_c1 nmdc:mga05p37_10682_c1_6833_7381 177
338 3300050507 nmdc:mga05p37_1137176_c1 nmdc:mga05p37_1137176_c1_129_674 177
339 3300050507 nmdc:mga05p37_52837_c1 nmdc:mga05p37_52837_c1_2732_3268 177
340 3300050507 nmdc:mga05p37_571600_c1 nmdc:mga05p37_571600_c1_649_1182 177
341 3300050507 nmdc:mga05p37_612593_c1 nmdc:mga05p37_612593_c1_388_921 177
342 3300050508 nmdc:mga09592_4085_c1 nmdc:mga09592_4085_c1_10773_11318 177
343 3300050508 nmdc:mga09592_75465_c1 nmdc:mga09592_75465_c1_1669_2202 177
344 3300050509 nmdc:mga0qj67_316319_c1 nmdc:mga0qj67_316319_c1_135_668 177
345 3300050509 nmdc:mga0qj67_364194_c1 nmdc:mga0qj67_364194_c1_33_578 177
346 3300050510 nmdc:mga06r32_346043_c1 nmdc:mga06r32_346043_c1_257_790 177
347 3300050510 nmdc:mga06r32_549261_c1 nmdc:mga06r32_549261_c1_463_996 177
348 3300050511 nmdc:mga08y16_1454_c1 nmdc:mga08y16_1454_c1_12821_13369 177
349 3300050511 nmdc:mga08y16_9117_c1 nmdc:mga08y16_9117_c1_6694_7239 177
350 3300050513 nmdc:mga0rr50_130717_c1 nmdc:mga0rr50_130717_c1_1423_1986 177
351 3300050513 nmdc:mga0rr50_23108_c1 nmdc:mga0rr50_23108_c1_761_1294 177
352 3300050513 nmdc:mga0rr50_411270_c1 nmdc:mga0rr50_411270_c1_181_726 177
353 3300050515 nmdc:mga0a205_559116_c1 nmdc:mga0a205_559116_c1_412_945 177
354 3300054114 Ga0501084_0029363 Ga0501084_0029363_1113_1670 177
355 3300061734 Ga0530510_0106893 Ga0530510_0106893_402_938 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

40

211

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9705 1 174
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9641 1 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9578 2 170
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9552 2 173
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9525 2 174
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9429 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9396 1 170 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9394 2 173 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9349 2 174 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9327 1 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536SWI1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9992 1 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9975 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1R3X2U9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9954 2 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A383T4G5-F1-model_v4 deleted 0.9931 45 175
AF-W4SGX0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.993 45 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
97.48 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map