F419915

General Info

Members Datasets Scaffolds Average Seq Length
354 259 313 309

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0257462|Ga0501068_0257462_32_1084
Length 350
Sequence VGEFDGLAKYGRLLGGDPRPAARADPRTARRSVSPTVHAVSTFRDDPACGVGLATVTTAGTVLDTWYPDPVLGPEAPAAPELEKLAGQDADRGVRVAVVATTIASLAAPPADAHDVYLRLHLLSHRLVRPNSISLDGIFGLLANVAWTSLGPVPVDGVESARLAARAEGLHLSVHGVDKFPRMTDYVAPAGVRIADADRVRLGAHLAAGTTVMHEGFCNFNAGTLGTSMVEGRISQGVVVGDGSDIGGGASIMGTLSGGGKAIVSIGERCLLGAEAGLGISLGDDCVVEAGLYVTAGTRVTLPDGTIVKARELSGADNLLFRRNSTTGTVEALPRTGSWGGLNSVLHSHN

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
5 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
6 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
7 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
8 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
9 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
10 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
11 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
12 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
13 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
14 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
15 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
16 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
17 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
18 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
19 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
20 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
21 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
22 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
23 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
24 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
25 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
26 2891562705 Microbispora tritici MT50 Isolate Unclassified
27 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
28 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
29 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
30 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
31 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
32 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
33 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
34 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
35 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
237 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
238 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
241 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
242 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
243 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
244 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
245 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
246 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
249 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
254 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
255 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
256 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
257 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
258 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
259 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.14
Metatranscriptomes 0.28
Isolates 11.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 5.65
Rhizosphere 72.6
Stem 0
Stem Tuber 0
Unclassified 15.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1005219 3300002073 Bacteria 1413
2 JGI25406J46586_10008921 3300003203 Bacteria 4511
3 Ga0055540_1000068 3300003792 Bacteria 120413
4 Ga0070658_10062652 3300005327 Bacteria 3031
5 Ga0070658_10095539 3300005327 Bacteria 2454
6 Ga0070658_10187868 3300005327 Bacteria 1741
7 Ga0070683_100061012 3300005329 Bacteria 3505
8 Ga0070683_100121148 3300005329 Bacteria 2471
9 Ga0068869_100229501 3300005334 Bacteria 1474
10 Ga0070682_100164270 3300005337 Bacteria 1536
11 Ga0068868_100058642 3300005338 Bacteria 3043
12 Ga0068868_100066819 3300005338 Bacteria 2860
13 Ga0068868_100165953 3300005338 Bacteria 1826
14 Ga0068868_100204204 3300005338 Bacteria 1649
15 Ga0070660_100084423 3300005339 Bacteria 2496
16 Ga0070660_100261033 3300005339 Bacteria 1414
17 Ga0070661_100123501 3300005344 Bacteria 1941
18 Ga0070668_100082595 3300005347 Bacteria 2520
19 Ga0070675_100284687 3300005354 Bacteria 1453
20 Ga0070671_100294960 3300005355 Bacteria 1380
21 Ga0070688_100113330 3300005365 Bacteria 1806
22 Ga0070659_100240375 3300005366 Bacteria 1498
23 Ga0070667_100001437 3300005367 Bacteria 21368
24 Ga0070709_10047874 3300005434 Bacteria 2665
25 Ga0070714_100173804 3300005435 Bacteria 1956
26 Ga0070713_100167526 3300005436 Bacteria 1966
27 Ga0070663_100029253 3300005455 Bacteria 3762
28 Ga0070678_100191488 3300005456 Bacteria 1682
29 Ga0070662_100277041 3300005457 Bacteria 1356
30 Ga0070681_10000109 3300005458 Bacteria 61563
31 Ga0070681_10009256 3300005458 Bacteria 9682
32 Ga0070681_10072569 3300005458 Bacteria 3405
33 Ga0068867_100228020 3300005459 Bacteria 1504
34 Ga0070685_10019047 3300005466 Bacteria 3700
35 Ga0070679_100000237 3300005530 Bacteria 45794
36 Ga0070679_100020412 3300005530 Bacteria 6460
37 Ga0070679_100043708 3300005530 Bacteria 4462
38 Ga0070679_100281474 3300005530 Bacteria 1616
39 Ga0070684_100123656 3300005535 Bacteria 2328
40 Ga0070684_100380213 3300005535 Bacteria 1300
41 Ga0068853_100012964 3300005539 Bacteria 6795
42 Ga0070665_100051316 3300005548 Bacteria 4137
43 Ga0070665_100074648 3300005548 Bacteria 3397
44 Ga0070665_100201929 3300005548 Bacteria 1988
45 Ga0070665_100412249 3300005548 Bacteria 1359
46 Ga0068857_100175569 3300005577 Bacteria 1949
47 Ga0068864_100307538 3300005618 Bacteria 1485
48 Ga0068864_100374227 3300005618 Bacteria 1348
49 Ga0068851_10148271 3300005834 Bacteria 1280
50 Ga0068863_100029173 3300005841 Bacteria 5267
51 Ga0068858_100211239 3300005842 Bacteria 1836
52 Ga0081539_10003237 3300005985 Bacteria 20494
53 Ga0075365_10000511 3300006038 Bacteria 14787
54 Ga0075430_100022392 3300006846 Bacteria 5376
55 Ga0075434_100419789 3300006871 Bacteria 1359
56 Ga0075429_100121302 3300006880 Bacteria 2285
57 Ga0105243_10008754 3300009148 Bacteria 7756
58 Ga0105243_10087385 3300009148 Bacteria 2559
59 Ga0105243_10150467 3300009148 Bacteria 1996
60 Ga0105242_10272283 3300009176 Bacteria 1534
61 Ga0105237_10092627 3300009545 Bacteria 3012
62 Ga0105032_100645 3300009979 Bacteria 3405
63 Ga0105239_10011359 3300010375 Bacteria 9935
64 Ga0105239_10119669 3300010375 Bacteria 2923
65 Ga0105246_10146073 3300011119 Bacteria 1784
66 Ga0157374_10157613 3300013296 Bacteria 2210
67 Ga0157374_10215347 3300013296 Bacteria 1884
68 Ga0163162_10271362 3300013306 Bacteria 1828
69 Ga0157375_10064099 3300013308 Bacteria 3658
70 Ga0157375_10141301 3300013308 Bacteria 2535
71 Ga0163163_10021324 3300014325 Bacteria 6112
72 Ga0163163_10167903 3300014325 Bacteria 2241
73 Ga0157377_10017008 3300014745 Bacteria 3755
74 Ga0163161_10034034 3300017792 Bacteria 3643
75 Ga0163161_10232834 3300017792 Bacteria 1430
76 Ga0197907_10301407 3300020069 Bacteria 1365
77 Ga0213875_10036908 3300021388 Bacteria 2304
78 Ga0207426_1016792 3300025302 Bacteria 2616
79 Ga0209051_1000057 3300025303 Bacteria 263902
80 Ga0207647_10108771 3300025904 Bacteria 1640
81 Ga0207699_10098017 3300025906 Bacteria 1854
82 Ga0207643_10012693 3300025908 Bacteria 4552
83 Ga0207707_10000290 3300025912 Bacteria 53506
84 Ga0207707_10338110 3300025912 Bacteria 1298
85 Ga0207660_10007410 3300025917 Bacteria 7100
86 Ga0207657_10043163 3300025919 Bacteria 3974
87 Ga0207657_10118329 3300025919 Bacteria 2181
88 Ga0207652_10005351 3300025921 Bacteria 10411
89 Ga0207652_10058709 3300025921 Bacteria 3315
90 Ga0207652_10182431 3300025921 Bacteria 1886
91 Ga0207687_10048258 3300025927 Bacteria 2955
92 Ga0207644_10262988 3300025931 Bacteria 1380
93 Ga0207690_10132612 3300025932 Bacteria 1825
94 Ga0207709_10013741 3300025935 Bacteria 4467
95 Ga0207670_10283226 3300025936 Bacteria 1292
96 Ga0207711_10045532 3300025941 Bacteria 3749
97 Ga0207689_10061752 3300025942 Bacteria 3082
98 Ga0207661_10191286 3300025944 Bacteria 1794
99 Ga0207658_10002536 3300025986 Bacteria 13288
100 Ga0207677_10217948 3300026023 Bacteria 1529
101 Ga0207678_10093463 3300026067 Bacteria 2570
102 Ga0207708_10028538 3300026075 Bacteria 4226
103 Ga0207641_10012161 3300026088 Bacteria 7064
104 Ga0207641_10056754 3300026088 Bacteria 3328
105 Ga0207648_10234151 3300026089 Bacteria 1634
106 Ga0207676_10039135 3300026095 Bacteria 3625
107 Ga0207674_10108477 3300026116 Bacteria 2753
108 Ga0207683_10038830 3300026121 Bacteria 4152
109 Ga0207683_10144565 3300026121 Bacteria 2144
110 Ga0207698_10055618 3300026142 Bacteria 3051
111 Ga0268266_10036256 3300028379 Bacteria 4197
112 Ga0268265_10271411 3300028380 Bacteria 1513
113 Ga0307517_10127443 3300028786 Bacteria 1850
114 Ga0307515_10026553 3300028794 Bacteria 9961
115 Ga0307512_10001844 3300030522 Bacteria 28504
116 Ga0265327_10000336 3300031251 Bacteria 89407
117 Ga0307513_10014971 3300031456 Bacteria 9421
118 Ga0307513_10167142 3300031456 Bacteria 2082
119 Ga0307508_10010501 3300031616 Bacteria 8475
120 Ga0307514_10090909 3300031649 Bacteria 2225
121 Ga0316576_10226370 3300031727 Bacteria 1406
122 Ga0307516_10028574 3300031730 Bacteria 5642
123 Ga0307516_10077979 3300031730 Bacteria 3160
124 Ga0307516_10094843 3300031730 Bacteria 2807
125 Ga0307516_10095207 3300031730 Bacteria 2801
126 Ga0307413_10006739 3300031824 Bacteria 5276
127 Ga0307518_10003812 3300031838 Bacteria 10848
128 Ga0307415_100002684 3300032126 Bacteria 8885
129 Ga0307507_10090026 3300033179 Bacteria 2636
130 Ga0373942_0000033 3300035207 Bacteria 26057
131 Ga0316574_0019061 3300035398 Bacteria 4044
132 Ga0373931_0179611 3300035691 Bacteria 1253
133 Ga0395900_0128663 3300037418 Bacteria 2596
134 Ga0395900_0380411 3300037418 Bacteria 1380
135 Ga0395898_0401274 3300037466 Bacteria 1307
136 Ga0436364_0500773 3300037853 Bacteria 11610
137 Ga0395901_0028766 3300038443 Bacteria 5717
138 Ga0395901_0174066 3300038443 Bacteria 2258
139 Ga0436365_0152808 3300039437 Bacteria 1337
140 Ga0436363_0948672 3300039450 Bacteria 1358
141 Ga0451853_0073508 3300041512 Bacteria 11953
142 Ga0451853_2503619 3300041512 Bacteria 1178
143 Ga0451577_0000458 3300042876 Bacteria 70995
144 Ga0466969_0019127 3300044656 Bacteria 3563
145 Ga0466972_0136086 3300044658 Bacteria 1156
146 Ga0466965_0007037 3300044683 Bacteria 5149
147 Ga0466965_0138579 3300044683 Bacteria 1265
148 Ga0466966_0030815 3300044684 Bacteria 3479
149 Ga0466966_0191958 3300044684 Bacteria 1237
150 Ga0466961_0033320 3300044693 Bacteria 3310
151 Ga0466961_0044600 3300044693 Bacteria 2838
152 Ga0466961_0052880 3300044693 Bacteria 2592
153 Ga0466963_0011568 3300044694 Bacteria 5373
154 Ga0466963_0190403 3300044694 Bacteria 1433
155 Ga0453684_0007844 3300044712 Bacteria 19437
156 Ga0466968_0000622 3300044735 Bacteria 12098
157 Ga0466968_0044605 3300044735 Bacteria 1879
158 Ga0466970_0142461 3300044765 Bacteria 1321
159 Ga0466970_0214705 3300044765 Bacteria 1072
160 Ga0466970_0230012 3300044765 Bacteria 1036
161 Ga0466957_0030733 3300044842 Bacteria 3207
162 Ga0466960_0000592 3300044901 Bacteria 12538
163 Ga0466960_0000916 3300044901 Bacteria 10450
164 Ga0466960_0027434 3300044901 Bacteria 2597
165 Ga0466960_0039026 3300044901 Bacteria 2237
166 Ga0466959_0285724 3300045049 Bacteria 1132
167 Ga0466958_0021454 3300045836 Bacteria 3775
168 Ga0466958_0088921 3300045836 Bacteria 1909
169 Ga0466967_0005415 3300045976 Bacteria 8842
170 Ga0466967_0023424 3300045976 Bacteria 5059
171 Ga0466967_0817788 3300045976 Bacteria 925
172 Ga0495592_0043782 3300046454 Bacteria 3347
173 Ga0495603_0161282 3300046455 Bacteria 1301
174 Ga0495629_0064146 3300046459 Bacteria 2565
175 Ga0495629_0130772 3300046459 Bacteria 1748
176 Ga0495629_0172767 3300046459 Bacteria 1499
177 Ga0495629_0203352 3300046459 Bacteria 1369
178 Ga0495651_0180588 3300046462 Bacteria 1494
179 Ga0495585_0035320 3300046492 Bacteria 2826
180 Ga0495628_0250061 3300046516 Bacteria 1324
181 Ga0495632_0041872 3300046519 Bacteria 2299
182 Ga0495643_0002707 3300046522 Bacteria 13652
183 Ga0495652_0148114 3300046529 Bacteria 1837
184 Ga0495640_0008269 3300046533 Bacteria 8162
185 Ga0495634_0014946 3300046642 Bacteria 5581
186 Ga0495588_0189895 3300046674 Bacteria 1085
187 Ga0495657_0065084 3300046675 Bacteria 2398
188 Ga0495658_0070117 3300046683 Bacteria 2033
189 Ga0495613_0203924 3300046689 Bacteria 1393
190 Ga0495624_0154363 3300046690 Bacteria 1403
191 Ga0495589_0025631 3300046794 Bacteria 2992
192 Ga0495600_0005315 3300046809 Bacteria 7759
193 Ga0495660_0091503 3300046810 Bacteria 1580
194 Ga0495581_0227523 3300047315 Bacteria 1091
195 Ga0495604_0005568 3300047317 Bacteria 9984
196 Ga0495674_0316825 3300047319 Bacteria 1271
197 Ga0495687_040628 3300047443 Bacteria 2047
198 Ga0495675_0009983 3300047444 Bacteria 5922
199 Ga0495679_021343 3300047446 Bacteria 2238
200 Ga0495685_009799 3300047447 Bacteria 3206
201 Ga0495681_0000862 3300047470 Bacteria 23335
202 Ga0495686_0063078 3300047472 Bacteria 2297
203 Ga0496100_0000277 3300048903 Bacteria 25885
204 Ga0496101_0000042 3300048904 Bacteria 163148
205 Ga0496103_0008772 3300048906 Bacteria 5998
206 Ga0496105_0058485 3300048908 Bacteria 3182
207 Ga0496105_0242087 3300048908 Bacteria 1464
208 Ga0496106_0042421 3300048909 Bacteria 3412
209 Ga0496107_0001989 3300048910 Bacteria 13012
210 Ga0496108_0149662 3300048911 Bacteria 2014
211 Ga0496108_0327635 3300048911 Bacteria 1335
212 Ga0496109_0000135 3300048912 Bacteria 74407
213 Ga0496109_0082058 3300048912 Bacteria 2971
214 Ga0496110_0001845 3300048913 Bacteria 15632
215 Ga0496110_0312869 3300048913 Bacteria 1430
216 Ga0496111_0006560 3300048914 Bacteria 7566
217 Ga0496112_0005277 3300048915 Bacteria 11142
218 Ga0496112_0006347 3300048915 Bacteria 10375
219 Ga0496114_0000344 3300048917 Bacteria 33940
220 Ga0496114_0547542 3300048917 Bacteria 1022
221 Ga0496115_0290870 3300048918 Bacteria 1340
222 Ga0496118_0018057 3300048921 Bacteria 6385
223 Ga0496119_0004531 3300048922 Bacteria 13788
224 Ga0496121_0000139 3300048924 Bacteria 163176
225 Ga0496122_0000149 3300048925 Bacteria 163504
226 Ga0496123_0004844 3300048926 Bacteria 13862
227 Ga0496124_0000114 3300048927 Bacteria 165215
228 Ga0496125_0000130 3300048928 Bacteria 163176
229 Ga0496126_0000149 3300048929 Bacteria 163176
230 Ga0496126_0006196 3300048929 Bacteria 13383
231 Ga0496126_0023321 3300048929 Bacteria 5997
232 Ga0501031_0002312 3300049568 Bacteria 12077
233 Ga0501031_0187955 3300049568 Bacteria 1349
234 Ga0501032_0012593 3300049569 Bacteria 6038
235 Ga0501032_0246712 3300049569 Bacteria 1159
236 Ga0501033_0001766 3300049570 Bacteria 18915
237 Ga0501033_0048715 3300049570 Bacteria 3147
238 Ga0501034_0001971 3300049571 Bacteria 26025
239 Ga0501034_0008781 3300049571 Bacteria 10634
240 Ga0501034_0021258 3300049571 Bacteria 6617
241 Ga0501034_0191979 3300049571 Bacteria 2004
242 Ga0501036_0002578 3300049572 Bacteria 14257
243 Ga0501036_0005818 3300049572 Bacteria 9984
244 Ga0501036_0011592 3300049572 Bacteria 7304
245 Ga0501036_0457109 3300049572 Bacteria 1064
246 Ga0501037_0001359 3300049573 Bacteria 17961
247 Ga0501037_0013918 3300049573 Bacteria 5928
248 Ga0501038_0011677 3300049574 Bacteria 8010
249 Ga0501038_0023057 3300049574 Bacteria 5570
250 Ga0501039_0002439 3300049575 Bacteria 13848
251 Ga0501039_0051407 3300049575 Bacteria 3189
252 Ga0501043_0036052 3300049579 Bacteria 3890
253 Ga0501043_0083110 3300049579 Bacteria 2517
254 Ga0501043_0103706 3300049579 Bacteria 2234
255 Ga0501043_0153793 3300049579 Bacteria 1799
256 Ga0501046_0033484 3300049580 Bacteria 4151
257 Ga0501046_0270115 3300049580 Bacteria 1247
258 Ga0501047_0112442 3300049581 Bacteria 2605
259 Ga0501047_0224124 3300049581 Bacteria 1735
260 Ga0501047_0437262 3300049581 Bacteria 1139
261 Ga0501048_0015026 3300049582 Bacteria 5723
262 Ga0501048_0016695 3300049582 Bacteria 5412
263 Ga0501067_0007432 3300049583 Bacteria 6087
264 Ga0501068_0003017 3300049584 Bacteria 8982
265 Ga0501068_0257462 3300049584 Bacteria 1113
266 Ga0501069_0000015 3300049585 Bacteria 144828
267 Ga0501070_0000005 3300049586 Bacteria 250033
268 Ga0501070_0033277 3300049586 Bacteria 4313
269 Ga0501070_0086411 3300049586 Bacteria 2597
270 Ga0501071_0003967 3300049587 Bacteria 9340
271 Ga0501071_0275066 3300049587 Bacteria 1274
272 Ga0501073_0000661 3300049589 Bacteria 24171
273 Ga0501074_0023783 3300049590 Bacteria 4454
274 Ga0501080_0028647 3300049742 Bacteria 5184
275 Ga0501080_0072985 3300049742 Bacteria 3192
276 Ga0501080_0103368 3300049742 Bacteria 2642
277 Ga0501083_0022915 3300049744 Bacteria 4333
278 Ga0501035_0010795 3300049822 Bacteria 8459
279 Ga0501035_0017487 3300049822 Bacteria 6613
280 Ga0501035_0286276 3300049822 Bacteria 1391
281 Ga0501044_0002157 3300049823 Bacteria 22566
282 Ga0501044_0016488 3300049823 Bacteria 7929
283 Ga0501044_0018047 3300049823 Bacteria 7567
284 Ga0501044_0067635 3300049823 Bacteria 3639
285 Ga0501044_0215142 3300049823 Bacteria 1874
286 Ga0501044_0399300 3300049823 Bacteria 1287
287 Ga0501045_0021165 3300049824 Bacteria 4650
288 Ga0501045_0161623 3300049824 Bacteria 1667
289 nmdc:mga00v17_84361_c1 3300050491 Bacteria 1988
290 nmdc:mga0yw44_33557_c1 3300050492 Bacteria 3000
291 nmdc:mga09592_257734_c1 3300050508 Bacteria 1512
292 nmdc:mga0qj67_9125_c1 3300050509 Bacteria 7360
293 nmdc:mga0n895_396246_c1 3300050512 Bacteria 1396
294 nmdc:mga0sz30_7125_c1 3300050516 Bacteria 4182
295 Ga0495619_0059837 3300053085 Bacteria 2531
296 Ga0500578_0051344 3300053086 Bacteria 2641
297 Ga0500654_099672 3300053099 Bacteria 1246
298 Ga0500660_124388 3300053100 Bacteria 1065
299 Ga0500553_007612 3300053101 Bacteria 5381
300 Ga0500556_0000182 3300053104 Bacteria 51372
301 Ga0500593_001684 3300053117 Bacteria 7976
302 Ga0500614_005986 3300053123 Bacteria 2555
303 Ga0500628_043107 3300053129 Bacteria 1039
304 Ga0500561_0058697 3300053137 Bacteria 1071
305 Ga0500573_0134851 3300053140 Bacteria 1364
306 Ga0500579_153139 3300053143 Bacteria 998
307 Ga0500600_0015646 3300053149 Bacteria 4600
308 Ga0500616_0012338 3300053153 Bacteria 5003
309 Ga0500634_0142752 3300053161 Bacteria 1131
310 Ga0500587_001463 3300053739 Bacteria 3343
311 Ga0501084_0374122 3300054114 Bacteria 1204
312 Ga0590075_021488 3300059424 Bacteria 1611
313 Ga0466962_0075246 3300061719 Bacteria 1613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10095539 Ga0070658_100955392 241
2 3300005435 Ga0070714_100173804 Ga0070714_1001738041 242
3 3300045976 Ga0466967_0817788 Ga0466967_0817788_51_896 247
4 3300005434 Ga0070709_10047874 Ga0070709_100478744 252
5 3300048929 Ga0496126_0023321 Ga0496126_0023321_5127_5966 252
6 3300053104 Ga0500556_0000182 Ga0500556_0000182_15294_16250 263
7 3300046454 Ga0495592_0043782 Ga0495592_0043782_893_1873 265
8 3300046459 Ga0495629_0130772 Ga0495629_0130772_277_1257 265
9 3300046462 Ga0495651_0180588 Ga0495651_0180588_498_1478 265
10 3300046529 Ga0495652_0148114 Ga0495652_0148114_351_1331 265
11 3300046533 Ga0495640_0008269 Ga0495640_0008269_5135_6115 265
12 3300046642 Ga0495634_0014946 Ga0495634_0014946_433_1413 265
13 3300046675 Ga0495657_0065084 Ga0495657_0065084_940_1920 265
14 3300046690 Ga0495624_0154363 Ga0495624_0154363_343_1323 265
15 3300046809 Ga0495600_0005315 Ga0495600_0005315_57_1037 265
16 3300047315 Ga0495581_0227523 Ga0495581_0227523_46_1026 265
17 3300049569 Ga0501032_0012593 Ga0501032_0012593_4319_5299 265
18 3300049570 Ga0501033_0048715 Ga0501033_0048715_668_1648 265
19 3300049571 Ga0501034_0021258 Ga0501034_0021258_2059_3039 265
20 3300049572 Ga0501036_0005818 Ga0501036_0005818_2820_3800 265
21 3300049574 Ga0501038_0023057 Ga0501038_0023057_4416_5396 265
22 3300049581 Ga0501047_0112442 Ga0501047_0112442_788_1768 265
23 3300049822 Ga0501035_0010795 Ga0501035_0010795_3724_4704 265
24 3300049823 Ga0501044_0016488 Ga0501044_0016488_1394_2374 265
25 3300046516 Ga0495628_0250061 Ga0495628_0250061_266_1246 269
26 3300031727 Ga0316576_10226370 Ga0316576_102263701 271
27 3300035398 Ga0316574_0019061 Ga0316574_0019061_1174_2175 271
28 3300042876 Ga0451577_0000458 Ga0451577_0000458_68788_69714 271
29 3300044712 Ga0453684_0007844 Ga0453684_0007844_1934_2860 271
30 3300031730 Ga0307516_10095207 Ga0307516_100952072 272
31 3300044901 Ga0466960_0000592 Ga0466960_0000592_8928_9884 272
32 3300013308 Ga0157375_10141301 Ga0157375_101413012 273
33 3300041512 Ga0451853_2503619 Ga0451853_2503619_320_1165 275
34 3300049571 Ga0501034_0008781 Ga0501034_0008781_9274_10323 277
35 3300005338 Ga0068868_100066819 Ga0068868_1000668193 278
36 3300005458 Ga0070681_10009256 Ga0070681_100092566 278
37 3300005530 Ga0070679_100020412 Ga0070679_1000204123 278
38 3300014325 Ga0163163_10167903 Ga0163163_101679032 278
39 3300025921 Ga0207652_10058709 Ga0207652_100587092 278
40 3300028794 Ga0307515_10026553 Ga0307515_100265539 278
41 3300030522 Ga0307512_10001844 Ga0307512_100018444 278
42 3300031456 Ga0307513_10014971 Ga0307513_1001497111 278
43 3300044901 Ga0466960_0039026 Ga0466960_0039026_177_1139 278
44 3300053143 Ga0500579_153139 Ga0500579_153139_12_959 278
45 3300003203 JGI25406J46586_10008921 JGI25406J46586_100089214 279
46 3300005985 Ga0081539_10003237 Ga0081539_1000323713 279
47 3300044684 Ga0466966_0191958 Ga0466966_0191958_65_1024 279
48 3300044694 Ga0466963_0190403 Ga0466963_0190403_237_1217 279
49 3300045836 Ga0466958_0088921 Ga0466958_0088921_281_1240 279
50 3300031730 Ga0307516_10094843 Ga0307516_100948433 280
51 3300028786 Ga0307517_10127443 Ga0307517_101274432 281
52 3300031730 Ga0307516_10077979 Ga0307516_100779794 281
53 3300037418 Ga0395900_0380411 Ga0395900_0380411_269_1258 281
54 3300037466 Ga0395898_0401274 Ga0395898_0401274_210_1199 281
55 3300038443 Ga0395901_0028766 Ga0395901_0028766_1499_2488 281
56 3300044693 Ga0466961_0044600 Ga0466961_0044600_1853_2815 281
57 3300044765 Ga0466970_0142461 Ga0466970_0142461_329_1288 281
58 3300053117 Ga0500593_001684 Ga0500593_001684_5378_6334 281
59 3300061719 Ga0466962_0075246 Ga0466962_0075246_35_997 281
60 3300005327 Ga0070658_10062652 Ga0070658_100626523 282
61 3300005329 Ga0070683_100121148 Ga0070683_1001211481 282
62 3300005436 Ga0070713_100167526 Ga0070713_1001675262 282
63 3300005530 Ga0070679_100281474 Ga0070679_1002814742 282
64 3300005577 Ga0068857_100175569 Ga0068857_1001755692 282
65 3300020069 Ga0197907_10301407 Ga0197907_103014072 282
66 3300025906 Ga0207699_10098017 Ga0207699_100980172 282
67 3300025912 Ga0207707_10338110 Ga0207707_103381101 282
68 3300025921 Ga0207652_10182431 Ga0207652_101824312 282
69 3300049823 Ga0501044_0002157 Ga0501044_0002157_18500_19489 283
70 3300049587 Ga0501071_0275066 Ga0501071_0275066_253_1200 284
71 3300035207 Ga0373942_0000033 Ga0373942_0000033_2234_3190 285
72 3300048908 Ga0496105_0242087 Ga0496105_0242087_434_1372 285
73 3300013308 Ga0157375_10064099 Ga0157375_100640993 286
74 3300046459 Ga0495629_0172767 Ga0495629_0172767_380_1360 286
75 3300006880 Ga0075429_100121302 Ga0075429_1001213023 288
76 3300045976 Ga0466967_0005415 Ga0466967_0005415_1155_2138 288
77 3300049568 Ga0501031_0002312 Ga0501031_0002312_3192_4169 288
78 3300049570 Ga0501033_0001766 Ga0501033_0001766_16546_17523 288
79 3300049571 Ga0501034_0001971 Ga0501034_0001971_18463_19440 288
80 3300049572 Ga0501036_0002578 Ga0501036_0002578_9736_10713 288
81 3300049573 Ga0501037_0013918 Ga0501037_0013918_3431_4408 288
82 3300049575 Ga0501039_0002439 Ga0501039_0002439_3539_4516 288
83 3300049579 Ga0501043_0036052 Ga0501043_0036052_1393_2370 288
84 3300049580 Ga0501046_0033484 Ga0501046_0033484_2992_3969 288
85 3300049581 Ga0501047_0224124 Ga0501047_0224124_35_1012 288
86 3300049582 Ga0501048_0016695 Ga0501048_0016695_3613_4590 288
87 3300049586 Ga0501070_0086411 Ga0501070_0086411_409_1386 288
88 3300049824 Ga0501045_0021165 Ga0501045_0021165_151_1128 288
89 3300005548 Ga0070665_100074648 Ga0070665_1000746484 289
90 3300054114 Ga0501084_0374122 Ga0501084_0374122_272_1171 289
91 3300049584 Ga0501068_0003017 Ga0501068_0003017_242_1222 290
92 3300049586 Ga0501070_0033277 Ga0501070_0033277_2563_3543 290
93 3300049589 Ga0501073_0000661 Ga0501073_0000661_14763_15743 290
94 3300049742 Ga0501080_0072985 Ga0501080_0072985_1244_2224 290
95 3300049742 Ga0501080_0103368 Ga0501080_0103368_1527_2510 290
96 3300049744 Ga0501083_0022915 Ga0501083_0022915_1108_2091 290
97 3300050508 nmdc:mga09592_257734_c1 nmdc:mga09592_257734_c1_229_1251 290
98 iso_pu_bacteria 2738543005 2739203926 290
99 iso_pu_bacteria 2738543011 2739238582 290
100 3300005548 Ga0070665_100051316 Ga0070665_1000513162 292
101 3300005618 Ga0068864_100374227 Ga0068864_1003742272 292
102 3300005841 Ga0068863_100029173 Ga0068863_1000291733 292
103 3300006846 Ga0075430_100022392 Ga0075430_1000223925 292
104 3300014325 Ga0163163_10021324 Ga0163163_100213242 292
105 3300026088 Ga0207641_10012161 Ga0207641_100121614 292
106 3300026095 Ga0207676_10039135 Ga0207676_100391353 292
107 3300028379 Ga0268266_10036256 Ga0268266_100362562 292
108 3300031824 Ga0307413_10006739 Ga0307413_100067392 292
109 3300048915 Ga0496112_0005277 Ga0496112_0005277_7280_8212 292
110 3300048915 Ga0496112_0006347 Ga0496112_0006347_1746_2678 292
111 3300050509 nmdc:mga0qj67_9125_c1 nmdc:mga0qj67_9125_c1_2220_3134 292
112 3300005339 Ga0070660_100084423 Ga0070660_1000844231 293
113 3300005458 Ga0070681_10072569 Ga0070681_100725694 293
114 3300005530 Ga0070679_100043708 Ga0070679_1000437084 293
115 3300025919 Ga0207657_10118329 Ga0207657_101183292 293
116 3300009148 Ga0105243_10008754 Ga0105243_100087544 294
117 3300025935 Ga0207709_10013741 Ga0207709_100137415 294
118 3300044765 Ga0466970_0230012 Ga0466970_0230012_94_1011 294
119 3300006038 Ga0075365_10000511 Ga0075365_1000051113 295
120 3300050491 nmdc:mga00v17_84361_c1 nmdc:mga00v17_84361_c1_464_1405 295
121 3300050492 nmdc:mga0yw44_33557_c1 nmdc:mga0yw44_33557_c1_1496_2437 295
122 3300005327 Ga0070658_10187868 Ga0070658_101878682 296
123 3300041512 Ga0451853_0073508 Ga0451853_0073508_4120_5067 298
124 3300053140 Ga0500573_0134851 Ga0500573_0134851_93_1082 299
125 3300044901 Ga0466960_0000916 Ga0466960_0000916_539_1483 300
126 iso_pu_bacteria 2773857762 2774393939 300
127 iso_pu_bacteria 2811994878 2812350065 300
128 iso_pu_bacteria 2891968417 2891972312 300
129 3300031616 Ga0307508_10010501 Ga0307508_100105014 301
130 3300031649 Ga0307514_10090909 Ga0307514_100909092 301
131 3300031730 Ga0307516_10028574 Ga0307516_100285743 301
132 3300039437 Ga0436365_0152808 Ga0436365_0152808_366_1301 301
133 3300044735 Ga0466968_0044605 Ga0466968_0044605_306_1253 301
134 3300044765 Ga0466970_0214705 Ga0466970_0214705_14_937 301
135 3300046459 Ga0495629_0064146 Ga0495629_0064146_432_1364 301
136 3300046519 Ga0495632_0041872 Ga0495632_0041872_1176_2165 301
137 3300046522 Ga0495643_0002707 Ga0495643_0002707_3047_4036 301
138 3300046674 Ga0495588_0189895 Ga0495588_0189895_114_1067 301
139 3300046794 Ga0495589_0025631 Ga0495589_0025631_1801_2790 301
140 3300046810 Ga0495660_0091503 Ga0495660_0091503_488_1477 301
141 3300047443 Ga0495687_040628 Ga0495687_040628_865_1854 301
142 3300047446 Ga0495679_021343 Ga0495679_021343_1228_2217 301
143 3300047447 Ga0495685_009799 Ga0495685_009799_367_1356 301
144 3300047470 Ga0495681_0000862 Ga0495681_0000862_13303_14292 301
145 3300047472 Ga0495686_0063078 Ga0495686_0063078_1275_2264 301
146 3300049583 Ga0501067_0007432 Ga0501067_0007432_1901_2878 301
147 3300053086 Ga0500578_0051344 Ga0500578_0051344_19_1008 301
148 3300053099 Ga0500654_099672 Ga0500654_099672_175_1164 301
149 3300053100 Ga0500660_124388 Ga0500660_124388_30_1019 301
150 3300053129 Ga0500628_043107 Ga0500628_043107_37_1026 301
151 3300053137 Ga0500561_0058697 Ga0500561_0058697_24_1013 301
152 3300053149 Ga0500600_0015646 Ga0500600_0015646_2275_3264 301
153 3300053153 Ga0500616_0012338 Ga0500616_0012338_3177_4166 301
154 3300053161 Ga0500634_0142752 Ga0500634_0142752_26_1015 301
155 3300053739 Ga0500587_001463 Ga0500587_001463_1571_2560 301
156 iso_pu_bacteria 2643221567 2643851089 301
157 iso_pu_bacteria 2643221624 2644134842 301
158 iso_pu_bacteria 2939582691 2939584328 301
159 3300005458 Ga0070681_10000109 Ga0070681_1000010937 302
160 3300005530 Ga0070679_100000237 Ga0070679_10000023744 302
161 3300005539 Ga0068853_100012964 Ga0068853_1000129645 302
162 3300025912 Ga0207707_10000290 Ga0207707_1000029021 302
163 3300025917 Ga0207660_10007410 Ga0207660_100074101 302
164 3300025921 Ga0207652_10005351 Ga0207652_1000535111 302
165 3300025944 Ga0207661_10191286 Ga0207661_101912862 302
166 3300044656 Ga0466969_0019127 Ga0466969_0019127_1257_2174 302
167 3300044684 Ga0466966_0030815 Ga0466966_0030815_2209_3126 302
168 3300044693 Ga0466961_0033320 Ga0466961_0033320_2069_2986 302
169 3300045049 Ga0466959_0285724 Ga0466959_0285724_172_1089 302
170 3300046492 Ga0495585_0035320 Ga0495585_0035320_637_1617 302
171 3300047317 Ga0495604_0005568 Ga0495604_0005568_8855_9835 302
172 iso_pu_bacteria 2547132424 2548698704 302
173 iso_pu_bacteria 2675903059 2676481321 302
174 3300039450 Ga0436363_0948672 Ga0436363_0948672_326_1255 303
175 3300045976 Ga0466967_0023424 Ga0466967_0023424_1194_2183 303
176 3300049584 Ga0501068_0257462 Ga0501068_0257462_32_1084 303
177 iso_pu_bacteria 2889300758 2889303016 303
178 iso_pu_bacteria 2939743619 2939746106 303
179 3300005456 Ga0070678_100191488 Ga0070678_1001914882 304
180 3300009148 Ga0105243_10150467 Ga0105243_101504672 304
181 3300009176 Ga0105242_10272283 Ga0105242_102722832 304
182 3300010375 Ga0105239_10119669 Ga0105239_101196692 304
183 3300013296 Ga0157374_10157613 Ga0157374_101576133 304
184 3300017792 Ga0163161_10232834 Ga0163161_102328341 304
185 3300037418 Ga0395900_0128663 Ga0395900_0128663_684_1628 304
186 3300038443 Ga0395901_0174066 Ga0395901_0174066_165_1109 304
187 3300044694 Ga0466963_0011568 Ga0466963_0011568_3097_4047 304
188 3300044842 Ga0466957_0030733 Ga0466957_0030733_2022_2972 304
189 3300045836 Ga0466958_0021454 Ga0466958_0021454_797_1747 304
190 3300048917 Ga0496114_0547542 Ga0496114_0547542_60_1004 304
191 3300005367 Ga0070667_100001437 Ga0070667_10000143715 305
192 3300025986 Ga0207658_10002536 Ga0207658_100025366 305
193 3300044658 Ga0466972_0136086 Ga0466972_0136086_146_1090 305
194 3300044683 Ga0466965_0007037 Ga0466965_0007037_2440_3384 305
195 3300044735 Ga0466968_0000622 Ga0466968_0000622_3948_4892 305
196 3300044901 Ga0466960_0027434 Ga0466960_0027434_484_1428 305
197 3300048929 Ga0496126_0006196 Ga0496126_0006196_97_1041 305
198 iso_pu_bacteria 2558860112 2558909323 305
199 iso_pu_bacteria 2848551377 2848551955 305
200 3300009545 Ga0105237_10092627 Ga0105237_100926273 306
201 3300025941 Ga0207711_10045532 Ga0207711_100455325 306
202 3300031456 Ga0307513_10167142 Ga0307513_101671422 306
203 3300048903 Ga0496100_0000277 Ga0496100_0000277_14000_14932 306
204 3300048904 Ga0496101_0000042 Ga0496101_0000042_64763_65695 306
205 3300048906 Ga0496103_0008772 Ga0496103_0008772_207_1139 306
206 3300048909 Ga0496106_0042421 Ga0496106_0042421_1666_2598 306
207 3300048910 Ga0496107_0001989 Ga0496107_0001989_2893_3825 306
208 3300048911 Ga0496108_0327635 Ga0496108_0327635_250_1182 306
209 3300048912 Ga0496109_0000135 Ga0496109_0000135_7589_8521 306
210 3300048913 Ga0496110_0001845 Ga0496110_0001845_4518_5450 306
211 3300048914 Ga0496111_0006560 Ga0496111_0006560_1369_2301 306
212 3300048917 Ga0496114_0000344 Ga0496114_0000344_13115_14047 306
213 3300048918 Ga0496115_0290870 Ga0496115_0290870_86_1018 306
214 3300048921 Ga0496118_0018057 Ga0496118_0018057_3099_4031 306
215 3300048922 Ga0496119_0004531 Ga0496119_0004531_2657_3589 306
216 3300048924 Ga0496121_0000139 Ga0496121_0000139_64763_65695 306
217 3300048925 Ga0496122_0000149 Ga0496122_0000149_64991_65923 306
218 3300048926 Ga0496123_0004844 Ga0496123_0004844_10898_11830 306
219 3300048927 Ga0496124_0000114 Ga0496124_0000114_66802_67734 306
220 3300048928 Ga0496125_0000130 Ga0496125_0000130_64763_65695 306
221 3300048929 Ga0496126_0000149 Ga0496126_0000149_97482_98414 306
222 3300049572 Ga0501036_0011592 Ga0501036_0011592_185_1138 306
223 3300049573 Ga0501037_0001359 Ga0501037_0001359_137_1090 306
224 3300049579 Ga0501043_0103706 Ga0501043_0103706_162_1115 306
225 3300049580 Ga0501046_0270115 Ga0501046_0270115_88_1056 306
226 3300049582 Ga0501048_0015026 Ga0501048_0015026_4623_5591 306
227 3300049590 Ga0501074_0023783 Ga0501074_0023783_2163_3116 306
228 3300049822 Ga0501035_0286276 Ga0501035_0286276_185_1138 306
229 3300049823 Ga0501044_0215142 Ga0501044_0215142_737_1690 306
230 3300049823 Ga0501044_0399300 Ga0501044_0399300_150_1103 306
231 3300032126 Ga0307415_100002684 Ga0307415_1000026842 307
232 3300046459 Ga0495629_0203352 Ga0495629_0203352_38_991 307
233 3300053085 Ga0495619_0059837 Ga0495619_0059837_1080_2033 307
234 iso_pu_bacteria 2675903060 2676487819 307
235 iso_pu_bacteria 2816332139 2816511578 307
236 iso_pu_bacteria 2856741275 2856741520 307
237 iso_pu_bacteria 2891562705 2891565269 307
238 iso_pu_bacteria 2946003308 2946005433 307
239 3300003792 Ga0055540_1000068 Ga0055540_100006885 308
240 3300005338 Ga0068868_100165953 Ga0068868_1001659532 308
241 3300005548 Ga0070665_100201929 Ga0070665_1002019292 308
242 3300014745 Ga0157377_10017008 Ga0157377_100170082 308
243 3300025303 Ga0209051_1000057 Ga0209051_100005786 308
244 3300025927 Ga0207687_10048258 Ga0207687_100482581 308
245 3300026121 Ga0207683_10038830 Ga0207683_100388303 308
246 3300031251 Ga0265327_10000336 Ga0265327_1000033672 308
247 3300046455 Ga0495603_0161282 Ga0495603_0161282_42_998 308
248 3300048908 Ga0496105_0058485 Ga0496105_0058485_1296_2252 308
249 3300048911 Ga0496108_0149662 Ga0496108_0149662_98_1054 308
250 3300048912 Ga0496109_0082058 Ga0496109_0082058_1887_2843 308
251 iso_pu_bacteria 2585427649 2586064184 308
252 iso_pu_bacteria 2767802112 2768646726 308
253 iso_pu_bacteria 2808606365 2808873101 308
254 iso_pu_bacteria 2891326441 2891328195 308
255 iso_pu_bacteria 2891395885 2891396709 308
256 iso_pu_bacteria 2891554331 2891559263 308
257 iso_pu_bacteria 2899359706 2899360199 308
258 iso_pu_bacteria 8048127548 8048131054 308
259 3300010375 Ga0105239_10011359 Ga0105239_100113591 309
260 3300044683 Ga0466965_0138579 Ga0466965_0138579_100_1041 309
261 3300049585 Ga0501069_0000015 Ga0501069_0000015_19176_20165 309
262 3300049586 Ga0501070_0000005 Ga0501070_0000005_174591_175580 309
263 3300049587 Ga0501071_0003967 Ga0501071_0003967_12_1001 309
264 3300049742 Ga0501080_0028647 Ga0501080_0028647_1610_2599 309
265 iso_pu_bacteria 2738543034 2739366156 309
266 iso_pu_bacteria 2791355406 2793978048 309
267 iso_pu_bacteria 2795385470 2795779803 309
268 iso_pu_bacteria 2862705112 2862707252 309
269 iso_pu_bacteria 2867346516 2867351984 309
270 iso_pu_bacteria 2912715099 2912721884 309
271 iso_pu_bacteria 2990044586 2990044710 309
272 iso_pu_bacteria 8008485437 8008489716 309
273 iso_pu_bacteria 8025524527 8025528708 309
274 iso_pu_bacteria 8047893842 8047899807 309
275 iso_pu_bacteria 8048356638 8048359123 309
276 iso_pu_bacteria 8048369669 8048376755 309
277 iso_pu_bacteria 8048379754 8048385808 309
278 3300005338 Ga0068868_100204204 Ga0068868_1002042042 310
279 3300031838 Ga0307518_10003812 Ga0307518_100038121 310
280 3300047444 Ga0495675_0009983 Ga0495675_0009983_27_1040 310
281 3300002073 JGI24745J21846_1005219 JGI24745J21846_10052192 311
282 3300005329 Ga0070683_100061012 Ga0070683_1000610123 311
283 3300005334 Ga0068869_100229501 Ga0068869_1002295012 311
284 3300005337 Ga0070682_100164270 Ga0070682_1001642701 311
285 3300005338 Ga0068868_100058642 Ga0068868_1000586422 311
286 3300005339 Ga0070660_100261033 Ga0070660_1002610332 311
287 3300005344 Ga0070661_100123501 Ga0070661_1001235012 311
288 3300005347 Ga0070668_100082595 Ga0070668_1000825953 311
289 3300005354 Ga0070675_100284687 Ga0070675_1002846871 311
290 3300005355 Ga0070671_100294960 Ga0070671_1002949601 311
291 3300005365 Ga0070688_100113330 Ga0070688_1001133301 311
292 3300005366 Ga0070659_100240375 Ga0070659_1002403752 311
293 3300005455 Ga0070663_100029253 Ga0070663_1000292532 311
294 3300005457 Ga0070662_100277041 Ga0070662_1002770411 311
295 3300005459 Ga0068867_100228020 Ga0068867_1002280202 311
296 3300005466 Ga0070685_10019047 Ga0070685_100190472 311
297 3300005535 Ga0070684_100123656 Ga0070684_1001236561 311
298 3300005535 Ga0070684_100380213 Ga0070684_1003802131 311
299 3300005548 Ga0070665_100412249 Ga0070665_1004122491 311
300 3300005618 Ga0068864_100307538 Ga0068864_1003075381 311
301 3300005834 Ga0068851_10148271 Ga0068851_101482711 311
302 3300005842 Ga0068858_100211239 Ga0068858_1002112391 311
303 3300006871 Ga0075434_100419789 Ga0075434_1004197891 311
304 3300009148 Ga0105243_10087385 Ga0105243_100873851 311
305 3300009979 Ga0105032_100645 Ga0105032_1006453 311
306 3300011119 Ga0105246_10146073 Ga0105246_101460732 311
307 3300013296 Ga0157374_10215347 Ga0157374_102153471 311
308 3300013306 Ga0163162_10271362 Ga0163162_102713621 311
309 3300017792 Ga0163161_10034034 Ga0163161_100340342 311
310 3300021388 Ga0213875_10036908 Ga0213875_100369082 311
311 3300025302 Ga0207426_1016792 Ga0207426_10167924 311
312 3300025904 Ga0207647_10108771 Ga0207647_101087712 311
313 3300025908 Ga0207643_10012693 Ga0207643_100126931 311
314 3300025919 Ga0207657_10043163 Ga0207657_100431632 311
315 3300025931 Ga0207644_10262988 Ga0207644_102629881 311
316 3300025932 Ga0207690_10132612 Ga0207690_101326122 311
317 3300025936 Ga0207670_10283226 Ga0207670_102832261 311
318 3300025942 Ga0207689_10061752 Ga0207689_100617521 311
319 3300026023 Ga0207677_10217948 Ga0207677_102179482 311
320 3300026067 Ga0207678_10093463 Ga0207678_100934633 311
321 3300026075 Ga0207708_10028538 Ga0207708_100285384 311
322 3300026088 Ga0207641_10056754 Ga0207641_100567542 311
323 3300026089 Ga0207648_10234151 Ga0207648_102341512 311
324 3300026116 Ga0207674_10108477 Ga0207674_101084773 311
325 3300026121 Ga0207683_10144565 Ga0207683_101445651 311
326 3300026142 Ga0207698_10055618 Ga0207698_100556182 311
327 3300028380 Ga0268265_10271411 Ga0268265_102714112 311
328 3300033179 Ga0307507_10090026 Ga0307507_100900263 311
329 3300035691 Ga0373931_0179611 Ga0373931_0179611_108_1043 311
330 3300037853 Ga0436364_0500773 Ga0436364_0500773_8167_9174 311
331 3300044693 Ga0466961_0052880 Ga0466961_0052880_949_1953 311
332 3300046683 Ga0495658_0070117 Ga0495658_0070117_262_1251 311
333 3300046689 Ga0495613_0203924 Ga0495613_0203924_11_1000 311
334 3300047319 Ga0495674_0316825 Ga0495674_0316825_66_1073 311
335 3300048913 Ga0496110_0312869 Ga0496110_0312869_106_1041 311
336 3300049568 Ga0501031_0187955 Ga0501031_0187955_289_1287 311
337 3300049569 Ga0501032_0246712 Ga0501032_0246712_53_1051 311
338 3300049571 Ga0501034_0191979 Ga0501034_0191979_140_1228 311
339 3300049572 Ga0501036_0457109 Ga0501036_0457109_52_1050 311
340 3300049574 Ga0501038_0011677 Ga0501038_0011677_6261_7259 311
341 3300049575 Ga0501039_0051407 Ga0501039_0051407_66_1064 311
342 3300049579 Ga0501043_0083110 Ga0501043_0083110_1502_2500 311
343 3300049579 Ga0501043_0153793 Ga0501043_0153793_520_1518 311
344 3300049581 Ga0501047_0437262 Ga0501047_0437262_97_1095 311
345 3300049822 Ga0501035_0017487 Ga0501035_0017487_4499_5497 311
346 3300049823 Ga0501044_0018047 Ga0501044_0018047_3441_4439 311
347 3300049823 Ga0501044_0067635 Ga0501044_0067635_1658_2656 311
348 3300049824 Ga0501045_0161623 Ga0501045_0161623_621_1619 311
349 3300050512 nmdc:mga0n895_396246_c1 nmdc:mga0n895_396246_c1_285_1292 311
350 3300050516 nmdc:mga0sz30_7125_c1 nmdc:mga0sz30_7125_c1_1600_2592 311
351 3300053101 Ga0500553_007612 Ga0500553_007612_3007_3996 311
352 3300053123 Ga0500614_005986 Ga0500614_005986_113_1102 311
353 3300059424 Ga0590075_021488 Ga0590075_021488_410_1459 311
354 iso_pu_bacteria 3006425503 3006426379 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14789

THDPS_M

Tetrahydrodipicolinate N-succinyltransferase middle

142

182

0.99

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

263

296

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e3q-assembly1.cif.gz_A crystal structure of dapd in complex with succinyl-coa from corynebacterium glutamicum 0.9824 9 300
5e3q-assembly1.cif.gz_A crystal structure of dapd in complex with succinyl-coa from corynebacterium glutamicum 0.9755 9 300
5e3p-assembly1.cif.gz_A crystal structure of dapd from corynebacterium glutamicum 0.9736 9 298
5e3p-assembly1.cif.gz_A crystal structure of dapd from corynebacterium glutamicum 0.9669 9 298
3fsy-assembly1.cif.gz_C structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis 0.9603 9 297
ID Description Score Start End Superfamily
3fsxE03 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9988 145 297 2.160.10.10
af_P9WP21_111_150_3.30.60.70 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Trimeric LpxA-like enzymes 0.9967 105 144 3.30.60.70
3fsxE03 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9919 145 297 2.160.10.10
af_P9WP21_111_150_3.30.60.70 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Trimeric LpxA-like enzymes 0.9728 105 144 3.30.60.70
5e3rA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9326 9 104 3.30.70.2010
ID Description Score Start End GO Terms
AF-A0A0B8QFM5-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) 1.006 145 213 GO:0008666
AF-A0A1X0JGK2-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 1.004 80 153 GO:0005737
GO:0016740
AF-A0A6G3VKW6-F1-model_v4 deleted 1.003 229 295
AF-A0A354XMX3-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9938 133 217 GO:0016740
AF-X8C3F2-F1-model_v4 deleted 0.9924 62 265

Feature Viewer

pLDDT pTM Quality
91.4 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map