F419715

General Info

Members Datasets Scaffolds Average Seq Length
354 238 353 91

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100999263|Ga0075430_1009992632
Length 107
Sequence MIRRVAAPHHAATQEVLMPRYMVERTFKGGLDIPLSDAGAAACLSVVGKNAEEGVTWIHSYVSEDHMKTFCVYDGPSPEAIRRAAEKNSLPLDRITKVSVLDPYFYR

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
162 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
234 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 0
Rhizoplane 1.98
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10144494 3300003322 Bacteria 1737
2 rootH1_10123136 3300003323 Bacteria 6921
3 Ga0065707_10740710 3300005295 Unclassified 622
4 Ga0070658_10130454 3300005327 Bacteria 2094
5 Ga0070676_11090934 3300005328 Bacteria 603
6 Ga0070683_100080817 3300005329 Bacteria 3042
7 Ga0070683_101819928 3300005329 Bacteria 585
8 Ga0070670_100014129 3300005331 Bacteria 6849
9 Ga0070670_100416428 3300005331 Bacteria 1187
10 Ga0070677_10001935 3300005333 Bacteria 6562
11 Ga0068869_100098926 3300005334 Bacteria 2204
12 Ga0068869_100623243 3300005334 Bacteria 913
13 Ga0070666_11168036 3300005335 Bacteria 573
14 Ga0068868_100619219 3300005338 Unclassified 961
15 Ga0070660_100001170 3300005339 Bacteria 17747
16 Ga0070660_100275156 3300005339 Bacteria 1377
17 Ga0070661_100002225 3300005344 Bacteria 13304
18 Ga0070661_100074024 3300005344 Bacteria 2508
19 Ga0070692_10238707 3300005345 Bacteria 1082
20 Ga0070692_11283003 3300005345 Bacteria 524
21 Ga0070668_100440326 3300005347 Bacteria 1119
22 Ga0070668_101994409 3300005347 Unclassified 535
23 Ga0070669_100242993 3300005353 Bacteria 1431
24 Ga0070669_100422663 3300005353 Bacteria 1094
25 Ga0070669_100910828 3300005353 Bacteria 751
26 Ga0070675_100020031 3300005354 Bacteria 5338
27 Ga0070674_100138957 3300005356 Bacteria 1821
28 Ga0070673_100239355 3300005364 Unclassified 1577
29 Ga0070673_101985158 3300005364 Bacteria 552
30 Ga0070688_100535766 3300005365 Bacteria 888
31 Ga0070659_100019067 3300005366 Bacteria 5188
32 Ga0070667_100322029 3300005367 Unclassified 1395
33 Ga0070667_101103704 3300005367 Bacteria 741
34 Ga0070714_100095726 3300005435 Bacteria 2608
35 Ga0070713_102277295 3300005436 Unclassified 524
36 Ga0070710_10372934 3300005437 Bacteria 950
37 Ga0070708_100128254 3300005445 Bacteria 2346
38 Ga0070663_101317578 3300005455 Unclassified 637
39 Ga0070678_100259538 3300005456 Bacteria 1461
40 Ga0070662_101036072 3300005457 Bacteria 703
41 Ga0070662_101887502 3300005457 Bacteria 516
42 Ga0070681_10007876 3300005458 Bacteria 10427
43 Ga0068867_100174839 3300005459 Bacteria 1703
44 Ga0068867_100248835 3300005459 Bacteria 1444
45 Ga0070706_100342734 3300005467 Bacteria 1393
46 Ga0070706_100568610 3300005467 Bacteria 1054
47 Ga0070707_100285179 3300005468 Bacteria 1605
48 Ga0070707_100287265 3300005468 Bacteria 1598
49 Ga0070698_100156988 3300005471 Bacteria 2221
50 Ga0070698_100305790 3300005471 Bacteria 1521
51 Ga0070699_100040596 3300005518 Bacteria 4029
52 Ga0070679_100069194 3300005530 Bacteria 3521
53 Ga0070684_100017786 3300005535 Bacteria 5841
54 Ga0070684_101107423 3300005535 Bacteria 744
55 Ga0070697_101543649 3300005536 Bacteria 594
56 Ga0068853_100100522 3300005539 Bacteria 2557
57 Ga0068853_101236640 3300005539 Bacteria 721
58 Ga0068853_101251734 3300005539 Bacteria 717
59 Ga0070672_100050097 3300005543 Bacteria 3252
60 Ga0070672_100161026 3300005543 Bacteria 1862
61 Ga0070695_101383542 3300005545 Bacteria 583
62 Ga0070696_101551646 3300005546 Unclassified 568
63 Ga0070665_100264005 3300005548 Bacteria 1723
64 Ga0070665_101087696 3300005548 Unclassified 811
65 Ga0070704_100465757 3300005549 Bacteria 1091
66 Ga0070704_101066524 3300005549 Unclassified 733
67 Ga0070664_100004762 3300005564 Bacteria 10878
68 Ga0070664_100210430 3300005564 Bacteria 1738
69 Ga0070664_100497340 3300005564 Bacteria 1123
70 Ga0070664_100554527 3300005564 Bacteria 1063
71 Ga0068857_100008196 3300005577 Bacteria 9027
72 Ga0068854_100135459 3300005578 Bacteria 1885
73 Ga0068854_100236897 3300005578 Bacteria 1451
74 Ga0068854_101421571 3300005578 Unclassified 628
75 Ga0068856_100011186 3300005614 Bacteria 8712
76 Ga0068856_100022903 3300005614 Bacteria 6075
77 Ga0068856_100042496 3300005614 Bacteria 4471
78 Ga0068852_100105641 3300005616 Bacteria 2551
79 Ga0068859_101521199 3300005617 Bacteria 739
80 Ga0068861_100872739 3300005719 Bacteria 850
81 Ga0068851_10005593 3300005834 Bacteria 5702
82 Ga0068870_10427125 3300005840 Unclassified 868
83 Ga0068863_102080888 3300005841 Unclassified 578
84 Ga0068860_100429327 3300005843 Bacteria 1311
85 Ga0068860_102561444 3300005843 Bacteria 529
86 Ga0068860_102647107 3300005843 Bacteria 520
87 Ga0068862_100624560 3300005844 Bacteria 1037
88 Ga0081455_10018717 3300005937 Bacteria 6575
89 Ga0081455_10091413 3300005937 Bacteria 2465
90 Ga0081455_10456872 3300005937 Unclassified 871
91 Ga0081540_1000346 3300005983 Bacteria 46837
92 Ga0075365_11123685 3300006038 Bacteria 553
93 Ga0070715_10006494 3300006163 Bacteria 3979
94 Ga0075362_10343761 3300006177 Bacteria 746
95 Ga0075369_10179761 3300006186 Bacteria 973
96 Ga0075369_10245442 3300006186 Bacteria 831
97 Ga0075370_10413380 3300006353 Bacteria 810
98 Ga0075428_100095677 3300006844 Bacteria 3237
99 Ga0075428_100170475 3300006844 Unclassified 2360
100 Ga0075428_100413133 3300006844 Bacteria 1446
101 Ga0075430_100999263 3300006846 Bacteria 689
102 Ga0075431_100018753 3300006847 Bacteria 7049
103 Ga0075431_101468561 3300006847 Bacteria 641
104 Ga0075433_10013203 3300006852 Bacteria 6705
105 Ga0075433_10137898 3300006852 Bacteria 2168
106 Ga0075434_100047681 3300006871 Bacteria 4251
107 Ga0075434_100210045 3300006871 Bacteria 1967
108 Ga0075434_100354165 3300006871 Bacteria 1489
109 Ga0075429_100041999 3300006880 Bacteria 3980
110 Ga0075429_100553887 3300006880 Bacteria 1008
111 Ga0068865_100206415 3300006881 Bacteria 1528
112 Ga0068865_101255820 3300006881 Unclassified 657
113 Ga0075436_100025179 3300006914 Bacteria 4092
114 Ga0097620_101520787 3300006931 Bacteria 739
115 Ga0075435_100261094 3300007076 Bacteria 1476
116 Ga0075435_100276102 3300007076 Bacteria 1434
117 Ga0075435_101071140 3300007076 Bacteria 704
118 Ga0105240_10707135 3300009093 Bacteria 1099
119 Ga0111539_10070947 3300009094 Bacteria 4111
120 Ga0111539_10361071 3300009094 Bacteria 1691
121 Ga0105245_10248578 3300009098 Bacteria 1727
122 Ga0105247_10638189 3300009101 Bacteria 794
123 Ga0105247_10895795 3300009101 Bacteria 685
124 Ga0114129_10384666 3300009147 Bacteria 1852
125 Ga0114129_10481135 3300009147 Bacteria 1624
126 Ga0114129_12886791 3300009147 Unclassified 569
127 Ga0105243_10601529 3300009148 Bacteria 1059
128 Ga0105241_10915227 3300009174 Unclassified 815
129 Ga0105242_11222199 3300009176 Bacteria 772
130 Ga0105242_11321007 3300009176 Bacteria 746
131 Ga0105248_12054415 3300009177 Bacteria 649
132 Ga0105238_11356659 3300009551 Bacteria 738
133 Ga0105249_10193339 3300009553 Bacteria 1987
134 Ga0105249_11862006 3300009553 Bacteria 674
135 Ga0105028_121344 3300009993 Unclassified 703
136 Ga0105239_10298438 3300010375 Bacteria 1814
137 Ga0105239_10553268 3300010375 Bacteria 1310
138 Ga0105239_12030609 3300010375 Bacteria 668
139 Ga0157370_11514004 3300013104 Unclassified 603
140 Ga0157378_10261473 3300013297 Unclassified 1661
141 Ga0163162_10482086 3300013306 Unclassified 1372
142 Ga0163163_11235310 3300014325 Unclassified 810
143 Ga0157380_10027998 3300014326 Bacteria 4292
144 Ga0157380_10408390 3300014326 Bacteria 1291
145 Ga0157377_10246596 3300014745 Unclassified 1155
146 Ga0157377_11009713 3300014745 Bacteria 631
147 Ga0157379_10850436 3300014968 Bacteria 863
148 Ga0157376_10216242 3300014969 Bacteria 1772
149 Ga0163161_11094107 3300017792 Unclassified 685
150 Ga0207656_10089684 3300025321 Bacteria 1394
151 Ga0207682_10371190 3300025893 Bacteria 675
152 Ga0207688_10447257 3300025901 Unclassified 805
153 Ga0207645_10062781 3300025907 Bacteria 2373
154 Ga0207645_10256778 3300025907 Bacteria 1157
155 Ga0207645_11150097 3300025907 Bacteria 522
156 Ga0207705_10294104 3300025909 Bacteria 1244
157 Ga0207684_10148497 3300025910 Bacteria 2016
158 Ga0207684_10235048 3300025910 Bacteria 1581
159 Ga0207707_10127405 3300025912 Bacteria 2226
160 Ga0207695_10014092 3300025913 Bacteria 9493
161 Ga0207671_10394173 3300025914 Bacteria 1101
162 Ga0207671_10720164 3300025914 Bacteria 793
163 Ga0207657_10046120 3300025919 Unclassified 3819
164 Ga0207649_10008002 3300025920 Bacteria 5752
165 Ga0207649_10126694 3300025920 Bacteria 1729
166 Ga0207646_10141455 3300025922 Bacteria 2167
167 Ga0207681_10328860 3300025923 Bacteria 1218
168 Ga0207694_10007371 3300025924 Bacteria 8345
169 Ga0207694_10719877 3300025924 Bacteria 842
170 Ga0207650_10214941 3300025925 Bacteria 1545
171 Ga0207650_10597027 3300025925 Bacteria 928
172 Ga0207659_10703206 3300025926 Bacteria 865
173 Ga0207700_11885642 3300025928 Unclassified 524
174 Ga0207664_10152911 3300025929 Bacteria 1961
175 Ga0207644_10091557 3300025931 Bacteria 2268
176 Ga0207690_10103397 3300025932 Bacteria 2039
177 Ga0207706_10366355 3300025933 Bacteria 1252
178 Ga0207706_11173445 3300025933 Bacteria 639
179 Ga0207686_10075358 3300025934 Bacteria 2184
180 Ga0207686_10582864 3300025934 Bacteria 878
181 Ga0207709_10552641 3300025935 Bacteria 906
182 Ga0207669_10389319 3300025937 Bacteria 1088
183 Ga0207691_10017993 3300025940 Bacteria 6692
184 Ga0207691_10058276 3300025940 Bacteria 3513
185 Ga0207689_10022611 3300025942 Bacteria 5283
186 Ga0207689_10538612 3300025942 Bacteria 980
187 Ga0207661_10035279 3300025944 Bacteria 3896
188 Ga0207679_10054205 3300025945 Bacteria 2951
189 Ga0207679_10083207 3300025945 Bacteria 2452
190 Ga0207679_10530957 3300025945 Unclassified 1053
191 Ga0207679_11178219 3300025945 Bacteria 703
192 Ga0207667_10016757 3300025949 Bacteria 8268
193 Ga0207651_10102549 3300025960 Bacteria 2127
194 Ga0207651_11484464 3300025960 Unclassified 610
195 Ga0207712_10434525 3300025961 Unclassified 1110
196 Ga0207640_10136506 3300025981 Bacteria 1781
197 Ga0207639_11159485 3300026041 Bacteria 725
198 Ga0207639_11208280 3300026041 Bacteria 709
199 Ga0207639_12267768 3300026041 Unclassified 504
200 Ga0207678_10243836 3300026067 Bacteria 1539
201 Ga0207708_10160585 3300026075 Unclassified 1774
202 Ga0207702_10003896 3300026078 Bacteria 13443
203 Ga0207702_10048228 3300026078 Bacteria 3591
204 Ga0207702_10699088 3300026078 Unclassified 999
205 Ga0207641_10742358 3300026088 Bacteria 969
206 Ga0207641_11310178 3300026088 Bacteria 725
207 Ga0207641_11727167 3300026088 Bacteria 628
208 Ga0207674_10000046 3300026116 Bacteria 122047
209 Ga0207675_102619652 3300026118 Bacteria 514
210 Ga0207698_10018846 3300026142 Bacteria 4712
211 Ga0207428_10201647 3300027907 Bacteria 1497
212 Ga0268266_10850043 3300028379 Unclassified 882
213 Ga0268266_11659051 3300028379 Bacteria 615
214 Ga0268265_10565711 3300028380 Bacteria 1081
215 Ga0268265_10962370 3300028380 Bacteria 842
216 Ga0268264_12558701 3300028381 Bacteria 515
217 Ga0307515_10320883 3300028794 Bacteria 1215
218 Ga0307513_10664047 3300031456 Bacteria 749
219 Ga0307408_100248574 3300031548 Unclassified 1466
220 Ga0316575_10146318 3300031665 Bacteria 973
221 Ga0316576_10949447 3300031727 Unclassified 614
222 Ga0316578_10279893 3300031728 Bacteria 999
223 Ga0307413_10047565 3300031824 Bacteria 2559
224 Ga0307410_10606874 3300031852 Bacteria 913
225 Ga0307406_10086779 3300031901 Bacteria 2096
226 Ga0307407_10032032 3300031903 Bacteria 2854
227 Ga0307414_11689499 3300032004 Bacteria 590
228 Ga0307411_12044497 3300032005 Unclassified 535
229 Ga0307415_100435945 3300032126 Bacteria 1129
230 Ga0316583_10297585 3300032133 Unclassified 558
231 Ga0307510_10007952 3300033180 Bacteria 12618
232 Ga0373946_0586652 3300035171 Unclassified 577
233 Ga0373947_0809008 3300035725 Unclassified 640
234 Ga0436360_0839257 3300039438 Unclassified 790
235 Ga0439448_0040680 3300042005 Bacteria 1502
236 Ga0439455_0122767 3300042012 Bacteria 729
237 Ga0439463_019489 3300042016 Bacteria 1690
238 Ga0450922_012262 3300042124 Unclassified 831
239 Ga0439458_0021296 3300042157 Bacteria 1500
240 Ga0439459_0009323 3300042438 Bacteria 1696
241 Ga0439464_0085904 3300042439 Bacteria 944
242 Ga0439460_0078436 3300042461 Bacteria 1033
243 Ga0451577_0147813 3300042876 Bacteria 2113
244 Ga0466964_0907410 3300044706 Bacteria 504
245 Ga0453684_0129937 3300044712 Bacteria 3024
246 Ga0466967_1139807 3300045976 Bacteria 777
247 Ga0495638_0192081 3300046460 Bacteria 1158
248 Ga0495580_1105563 3300046472 Unclassified 501
249 Ga0495630_1248830 3300046517 Unclassified 561
250 Ga0495644_0099707 3300046523 Unclassified 1099
251 Ga0495668_0189279 3300046616 Bacteria 1127
252 Ga0495647_0268472 3300046681 Bacteria 763
253 Ga0495626_0195237 3300048091 Bacteria 833
254 Ga0496102_0235913 3300048905 Bacteria 1725
255 Ga0496103_0415957 3300048906 Bacteria 863
256 Ga0496104_1095916 3300048907 Unclassified 700
257 Ga0496108_0625252 3300048911 Bacteria 937
258 Ga0496109_0050734 3300048912 Bacteria 3778
259 Ga0496110_1422538 3300048913 Bacteria 603
260 Ga0496111_0057949 3300048914 Bacteria 2804
261 Ga0496119_0233070 3300048922 Bacteria 936
262 Ga0496121_0668422 3300048924 Bacteria 630
263 Ga0501031_0002488 3300049568 Bacteria 11757
264 Ga0501032_0053110 3300049569 Bacteria 2730
265 Ga0501032_0317583 3300049569 Bacteria 1006
266 Ga0501033_0043090 3300049570 Bacteria 3362
267 Ga0501036_0015522 3300049572 Bacteria 6363
268 Ga0501036_0043537 3300049572 Bacteria 3802
269 Ga0501037_0267967 3300049573 Bacteria 1192
270 Ga0501038_0006158 3300049574 Bacteria 11103
271 Ga0501038_0023268 3300049574 Bacteria 5541
272 Ga0501039_0002834 3300049575 Bacteria 12956
273 Ga0501039_0042603 3300049575 Bacteria 3506
274 Ga0501040_0006782 3300049576 Bacteria 7426
275 Ga0501040_0008960 3300049576 Bacteria 6508
276 Ga0501040_0119277 3300049576 Bacteria 1850
277 Ga0501041_0000078 3300049577 Bacteria 37844
278 Ga0501041_0004671 3300049577 Bacteria 7945
279 Ga0501042_0004323 3300049578 Bacteria 9055
280 Ga0501042_0008213 3300049578 Bacteria 6878
281 Ga0501043_0159324 3300049579 Bacteria 1764
282 Ga0501043_0390319 3300049579 Bacteria 1053
283 Ga0501046_0025838 3300049580 Bacteria 4801
284 Ga0501046_0063468 3300049580 Bacteria 2884
285 Ga0501048_0000098 3300049582 Bacteria 47500
286 Ga0501048_0010873 3300049582 Bacteria 6787
287 Ga0501068_0094958 3300049584 Unclassified 1843
288 Ga0501068_0282665 3300049584 Bacteria 1061
289 Ga0501068_0489706 3300049584 Bacteria 797
290 Ga0501069_0260744 3300049585 Bacteria 1012
291 Ga0501070_0118395 3300049586 Bacteria 2189
292 Ga0501071_0000062 3300049587 Bacteria 37621
293 Ga0501071_0120023 3300049587 Bacteria 1948
294 Ga0501072_0011583 3300049588 Bacteria 6738
295 Ga0501072_0264401 3300049588 Bacteria 1369
296 Ga0501073_0091473 3300049589 Bacteria 2115
297 Ga0501073_0784929 3300049589 Unclassified 657
298 Ga0501074_0002586 3300049590 Bacteria 12637
299 Ga0501075_0004049 3300049591 Bacteria 9889
300 Ga0501075_0020098 3300049591 Bacteria 4850
301 Ga0501076_0010781 3300049592 Bacteria 6794
302 Ga0501076_0027021 3300049592 Bacteria 4450
303 Ga0501077_0064653 3300049593 Bacteria 2320
304 Ga0501077_0077083 3300049593 Bacteria 2111
305 Ga0501079_0002497 3300049741 Bacteria 13359
306 Ga0501079_0025148 3300049741 Bacteria 4567
307 Ga0501079_0048732 3300049741 Bacteria 3269
308 Ga0501080_0177267 3300049742 Bacteria 1963
309 Ga0501080_0220213 3300049742 Bacteria 1737
310 Ga0501081_0003543 3300049743 Bacteria 9972
311 Ga0501081_0255611 3300049743 Unclassified 1279
312 Ga0501083_0390397 3300049744 Bacteria 905
313 Ga0501035_0062953 3300049822 Bacteria 3300
314 Ga0501035_0339761 3300049822 Bacteria 1258
315 Ga0501045_0000139 3300049824 Bacteria 38463
316 Ga0501045_0004789 3300049824 Bacteria 9352
317 Ga0501045_0163208 3300049824 Bacteria 1659
318 nmdc:mga03683_615796_c1 3300050489 Bacteria 532
319 nmdc:mga00v17_418679_c1 3300050491 Unclassified 870
320 nmdc:mga0yw44_1040774_c1 3300050492 Bacteria 554
321 nmdc:mga05p37_261464_c1 3300050507 Bacteria 2071
322 nmdc:mga05p37_314165_c1 3300050507 Bacteria 1857
323 nmdc:mga09592_1669073_c1 3300050508 Bacteria 514
324 nmdc:mga09592_54001_c1 3300050508 Bacteria 3394
325 nmdc:mga0qj67_178507_c1 3300050509 Bacteria 1725
326 nmdc:mga0qj67_344518_c1 3300050509 Bacteria 1205
327 nmdc:mga06r32_1525198_c1 3300050510 Bacteria 608
328 nmdc:mga06r32_180009_c1 3300050510 Bacteria 2099
329 nmdc:mga06r32_3476_c1 3300050510 Bacteria 14067
330 nmdc:mga06r32_566736_c1 3300050510 Bacteria 1109
331 nmdc:mga08y16_62413_c1 3300050511 Bacteria 3892
332 nmdc:mga0n895_29127_c1 3300050512 Bacteria 5261
333 nmdc:mga08x19_23852_c1 3300050514 Bacteria 3797
334 nmdc:mga0a205_329386_c1 3300050515 Bacteria 1397
335 nmdc:mga0a205_9734_c2 3300050515 Bacteria 8427
336 nmdc:mga0sz30_271796_c1 3300050516 Bacteria 755
337 nmdc:mga0sz30_315164_c1 3300050516 Bacteria 698
338 Ga0495601_1029727 3300053077 Archaea 517
339 Ga0500641_0235513 3300053096 Bacteria 772
340 Ga0500591_042680 3300053115 Bacteria 2152
341 Ga0500568_0140402 3300053139 Bacteria 896
342 Ga0500616_0289743 3300053153 Bacteria 684
343 Ga0500630_098258 3300053159 Bacteria 1339
344 Ga0500601_052044 3300053737 Unclassified 511
345 Ga0501084_0004017 3300054114 Bacteria 11986
346 Ga0501084_0045111 3300054114 Bacteria 3691
347 Ga0501084_1307919 3300054114 Unclassified 608
348 Ga0590075_020940 3300059424 Bacteria 1629
349 Ga0501082_0000902 3300060353 Bacteria 26115
350 Ga0501082_0004681 3300060353 Bacteria 11931
351 Ga0501082_1604493 3300060353 Unclassified 568
352 Ga0530510_0225806 3300061734 Bacteria 1392
353 Ga0530510_0746315 3300061734 Bacteria 746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100259538 Ga0070678_1002595383 86
2 3300009176 Ga0105242_11222199 Ga0105242_112221992 86
3 3300009993 Ga0105028_121344 Ga0105028_1213442 86
4 3300013297 Ga0157378_10261473 Ga0157378_102614732 86
5 3300013306 Ga0163162_10482086 Ga0163162_104820862 86
6 3300014326 Ga0157380_10408390 Ga0157380_104083904 86
7 3300046460 Ga0495638_0192081 Ga0495638_0192081_29_292 86
8 3300049568 Ga0501031_0002488 Ga0501031_0002488_697_975 86
9 3300049569 Ga0501032_0053110 Ga0501032_0053110_1578_1856 86
10 3300049572 Ga0501036_0015522 Ga0501036_0015522_2744_3022 86
11 3300049573 Ga0501037_0267967 Ga0501037_0267967_635_913 86
12 3300049574 Ga0501038_0006158 Ga0501038_0006158_10134_10412 86
13 3300049575 Ga0501039_0002834 Ga0501039_0002834_1425_1703 86
14 3300049576 Ga0501040_0006782 Ga0501040_0006782_6806_7084 86
15 3300049577 Ga0501041_0004671 Ga0501041_0004671_3672_3950 86
16 3300049578 Ga0501042_0004323 Ga0501042_0004323_393_671 86
17 3300049579 Ga0501043_0159324 Ga0501043_0159324_455_733 86
18 3300049580 Ga0501046_0063468 Ga0501046_0063468_2128_2406 86
19 3300049582 Ga0501048_0010873 Ga0501048_0010873_2724_3002 86
20 3300049584 Ga0501068_0282665 Ga0501068_0282665_281_559 86
21 3300049586 Ga0501070_0118395 Ga0501070_0118395_1278_1556 86
22 3300049587 Ga0501071_0000062 Ga0501071_0000062_37001_37279 86
23 3300049588 Ga0501072_0011583 Ga0501072_0011583_662_940 86
24 3300049589 Ga0501073_0091473 Ga0501073_0091473_1085_1363 86
25 3300049591 Ga0501075_0020098 Ga0501075_0020098_2534_2812 86
26 3300049592 Ga0501076_0027021 Ga0501076_0027021_3672_3950 86
27 3300049593 Ga0501077_0077083 Ga0501077_0077083_826_1104 86
28 3300049741 Ga0501079_0025148 Ga0501079_0025148_3161_3439 86
29 3300049742 Ga0501080_0177267 Ga0501080_0177267_1555_1833 86
30 3300049743 Ga0501081_0003543 Ga0501081_0003543_5189_5467 86
31 3300049822 Ga0501035_0339761 Ga0501035_0339761_963_1241 86
32 3300049824 Ga0501045_0004789 Ga0501045_0004789_572_850 86
33 3300054114 Ga0501084_0045111 Ga0501084_0045111_280_558 86
34 3300060353 Ga0501082_0004681 Ga0501082_0004681_9865_10143 86
35 iso_pu_bacteria 2643221654 2644302285 86
36 3300003322 rootL2_10144494 rootL2_101444942 90
37 3300003323 rootH1_10123136 rootH1_101231366 90
38 3300005295 Ga0065707_10740710 Ga0065707_107407101 90
39 3300005327 Ga0070658_10130454 Ga0070658_101304542 90
40 3300005328 Ga0070676_11090934 Ga0070676_110909341 90
41 3300005329 Ga0070683_100080817 Ga0070683_1000808172 90
42 3300005329 Ga0070683_101819928 Ga0070683_1018199281 90
43 3300005331 Ga0070670_100014129 Ga0070670_1000141292 90
44 3300005331 Ga0070670_100416428 Ga0070670_1004164282 90
45 3300005333 Ga0070677_10001935 Ga0070677_1000193512 90
46 3300005334 Ga0068869_100098926 Ga0068869_1000989262 90
47 3300005334 Ga0068869_100623243 Ga0068869_1006232432 90
48 3300005335 Ga0070666_11168036 Ga0070666_111680362 90
49 3300005338 Ga0068868_100619219 Ga0068868_1006192192 90
50 3300005339 Ga0070660_100001170 Ga0070660_10000117014 90
51 3300005339 Ga0070660_100275156 Ga0070660_1002751562 90
52 3300005344 Ga0070661_100002225 Ga0070661_1000022259 90
53 3300005344 Ga0070661_100074024 Ga0070661_1000740242 90
54 3300005345 Ga0070692_10238707 Ga0070692_102387072 90
55 3300005345 Ga0070692_11283003 Ga0070692_112830031 90
56 3300005347 Ga0070668_100440326 Ga0070668_1004403261 90
57 3300005347 Ga0070668_101994409 Ga0070668_1019944092 90
58 3300005353 Ga0070669_100242993 Ga0070669_1002429934 90
59 3300005353 Ga0070669_100422663 Ga0070669_1004226631 90
60 3300005353 Ga0070669_100910828 Ga0070669_1009108281 90
61 3300005354 Ga0070675_100020031 Ga0070675_1000200318 90
62 3300005356 Ga0070674_100138957 Ga0070674_1001389574 90
63 3300005364 Ga0070673_100239355 Ga0070673_1002393552 90
64 3300005364 Ga0070673_101985158 Ga0070673_1019851581 90
65 3300005365 Ga0070688_100535766 Ga0070688_1005357661 90
66 3300005366 Ga0070659_100019067 Ga0070659_1000190672 90
67 3300005367 Ga0070667_100322029 Ga0070667_1003220292 90
68 3300005367 Ga0070667_101103704 Ga0070667_1011037041 90
69 3300005435 Ga0070714_100095726 Ga0070714_1000957262 90
70 3300005436 Ga0070713_102277295 Ga0070713_1022772951 90
71 3300005437 Ga0070710_10372934 Ga0070710_103729342 90
72 3300005445 Ga0070708_100128254 Ga0070708_1001282542 90
73 3300005455 Ga0070663_101317578 Ga0070663_1013175781 90
74 3300005457 Ga0070662_101036072 Ga0070662_1010360721 90
75 3300005457 Ga0070662_101887502 Ga0070662_1018875021 90
76 3300005458 Ga0070681_10007876 Ga0070681_100078764 90
77 3300005459 Ga0068867_100174839 Ga0068867_1001748392 90
78 3300005459 Ga0068867_100248835 Ga0068867_1002488352 90
79 3300005467 Ga0070706_100342734 Ga0070706_1003427342 90
80 3300005467 Ga0070706_100568610 Ga0070706_1005686102 90
81 3300005468 Ga0070707_100285179 Ga0070707_1002851792 90
82 3300005468 Ga0070707_100287265 Ga0070707_1002872652 90
83 3300005471 Ga0070698_100156988 Ga0070698_1001569881 90
84 3300005471 Ga0070698_100305790 Ga0070698_1003057902 90
85 3300005518 Ga0070699_100040596 Ga0070699_1000405963 90
86 3300005530 Ga0070679_100069194 Ga0070679_1000691942 90
87 3300005535 Ga0070684_100017786 Ga0070684_1000177862 90
88 3300005535 Ga0070684_101107423 Ga0070684_1011074231 90
89 3300005536 Ga0070697_101543649 Ga0070697_1015436492 90
90 3300005539 Ga0068853_100100522 Ga0068853_1001005222 90
91 3300005539 Ga0068853_101236640 Ga0068853_1012366402 90
92 3300005539 Ga0068853_101251734 Ga0068853_1012517342 90
93 3300005543 Ga0070672_100050097 Ga0070672_1000500975 90
94 3300005543 Ga0070672_100161026 Ga0070672_1001610262 90
95 3300005545 Ga0070695_101383542 Ga0070695_1013835422 90
96 3300005546 Ga0070696_101551646 Ga0070696_1015516461 90
97 3300005548 Ga0070665_100264005 Ga0070665_1002640052 90
98 3300005548 Ga0070665_101087696 Ga0070665_1010876964 90
99 3300005549 Ga0070704_100465757 Ga0070704_1004657572 90
100 3300005549 Ga0070704_101066524 Ga0070704_1010665241 90
101 3300005564 Ga0070664_100004762 Ga0070664_1000047627 90
102 3300005564 Ga0070664_100210430 Ga0070664_1002104302 90
103 3300005564 Ga0070664_100497340 Ga0070664_1004973402 90
104 3300005564 Ga0070664_100554527 Ga0070664_1005545272 90
105 3300005577 Ga0068857_100008196 Ga0068857_1000081966 90
106 3300005578 Ga0068854_100135459 Ga0068854_1001354592 90
107 3300005578 Ga0068854_100236897 Ga0068854_1002368972 90
108 3300005578 Ga0068854_101421571 Ga0068854_1014215712 90
109 3300005614 Ga0068856_100011186 Ga0068856_1000111866 90
110 3300005614 Ga0068856_100022903 Ga0068856_1000229038 90
111 3300005614 Ga0068856_100042496 Ga0068856_1000424964 90
112 3300005616 Ga0068852_100105641 Ga0068852_1001056412 90
113 3300005617 Ga0068859_101521199 Ga0068859_1015211992 90
114 3300005719 Ga0068861_100872739 Ga0068861_1008727392 90
115 3300005834 Ga0068851_10005593 Ga0068851_100055932 90
116 3300005840 Ga0068870_10427125 Ga0068870_104271251 90
117 3300005841 Ga0068863_102080888 Ga0068863_1020808882 90
118 3300005843 Ga0068860_100429327 Ga0068860_1004293272 90
119 3300005843 Ga0068860_102561444 Ga0068860_1025614442 90
120 3300005843 Ga0068860_102647107 Ga0068860_1026471071 90
121 3300005844 Ga0068862_100624560 Ga0068862_1006245602 90
122 3300005937 Ga0081455_10018717 Ga0081455_100187172 90
123 3300005937 Ga0081455_10091413 Ga0081455_100914132 90
124 3300005937 Ga0081455_10456872 Ga0081455_104568722 90
125 3300005983 Ga0081540_1000346 Ga0081540_100034615 90
126 3300006038 Ga0075365_11123685 Ga0075365_111236851 90
127 3300006163 Ga0070715_10006494 Ga0070715_100064946 90
128 3300006177 Ga0075362_10343761 Ga0075362_103437611 90
129 3300006186 Ga0075369_10179761 Ga0075369_101797612 90
130 3300006186 Ga0075369_10245442 Ga0075369_102454421 90
131 3300006353 Ga0075370_10413380 Ga0075370_104133802 90
132 3300006844 Ga0075428_100095677 Ga0075428_1000956773 90
133 3300006844 Ga0075428_100170475 Ga0075428_1001704752 90
134 3300006844 Ga0075428_100413133 Ga0075428_1004131332 90
135 3300006846 Ga0075430_100999263 Ga0075430_1009992632 90
136 3300006847 Ga0075431_100018753 Ga0075431_1000187536 90
137 3300006847 Ga0075431_101468561 Ga0075431_1014685612 90
138 3300006852 Ga0075433_10013203 Ga0075433_100132036 90
139 3300006852 Ga0075433_10137898 Ga0075433_101378982 90
140 3300006871 Ga0075434_100047681 Ga0075434_1000476813 90
141 3300006871 Ga0075434_100210045 Ga0075434_1002100453 90
142 3300006871 Ga0075434_100354165 Ga0075434_1003541653 90
143 3300006880 Ga0075429_100041999 Ga0075429_1000419994 90
144 3300006880 Ga0075429_100553887 Ga0075429_1005538872 90
145 3300006881 Ga0068865_100206415 Ga0068865_1002064152 90
146 3300006881 Ga0068865_101255820 Ga0068865_1012558202 90
147 3300006914 Ga0075436_100025179 Ga0075436_1000251793 90
148 3300006931 Ga0097620_101520787 Ga0097620_1015207872 90
149 3300007076 Ga0075435_100261094 Ga0075435_1002610942 90
150 3300007076 Ga0075435_100276102 Ga0075435_1002761022 90
151 3300007076 Ga0075435_101071140 Ga0075435_1010711401 90
152 3300009093 Ga0105240_10707135 Ga0105240_107071352 90
153 3300009094 Ga0111539_10070947 Ga0111539_100709473 90
154 3300009094 Ga0111539_10361071 Ga0111539_103610713 90
155 3300009098 Ga0105245_10248578 Ga0105245_102485782 90
156 3300009101 Ga0105247_10638189 Ga0105247_106381892 90
157 3300009101 Ga0105247_10895795 Ga0105247_108957952 90
158 3300009147 Ga0114129_10384666 Ga0114129_103846663 90
159 3300009147 Ga0114129_10481135 Ga0114129_104811351 90
160 3300009147 Ga0114129_12886791 Ga0114129_128867911 90
161 3300009148 Ga0105243_10601529 Ga0105243_106015291 90
162 3300009174 Ga0105241_10915227 Ga0105241_109152272 90
163 3300009176 Ga0105242_11321007 Ga0105242_113210072 90
164 3300009177 Ga0105248_12054415 Ga0105248_120544152 90
165 3300009551 Ga0105238_11356659 Ga0105238_113566592 90
166 3300009553 Ga0105249_10193339 Ga0105249_101933393 90
167 3300009553 Ga0105249_11862006 Ga0105249_118620061 90
168 3300010375 Ga0105239_10298438 Ga0105239_102984382 90
169 3300010375 Ga0105239_10553268 Ga0105239_105532681 90
170 3300010375 Ga0105239_12030609 Ga0105239_120306092 90
171 3300013104 Ga0157370_11514004 Ga0157370_115140041 90
172 3300014325 Ga0163163_11235310 Ga0163163_112353102 90
173 3300014326 Ga0157380_10027998 Ga0157380_100279982 90
174 3300014745 Ga0157377_10246596 Ga0157377_102465962 90
175 3300014745 Ga0157377_11009713 Ga0157377_110097131 90
176 3300014968 Ga0157379_10850436 Ga0157379_108504362 90
177 3300014969 Ga0157376_10216242 Ga0157376_102162422 90
178 3300017792 Ga0163161_11094107 Ga0163161_110941072 90
179 3300025321 Ga0207656_10089684 Ga0207656_100896841 90
180 3300025893 Ga0207682_10371190 Ga0207682_103711902 90
181 3300025901 Ga0207688_10447257 Ga0207688_104472571 90
182 3300025907 Ga0207645_10062781 Ga0207645_100627812 90
183 3300025907 Ga0207645_10256778 Ga0207645_102567781 90
184 3300025907 Ga0207645_11150097 Ga0207645_111500971 90
185 3300025909 Ga0207705_10294104 Ga0207705_102941041 90
186 3300025910 Ga0207684_10148497 Ga0207684_101484972 90
187 3300025910 Ga0207684_10235048 Ga0207684_102350482 90
188 3300025912 Ga0207707_10127405 Ga0207707_101274052 90
189 3300025913 Ga0207695_10014092 Ga0207695_100140926 90
190 3300025914 Ga0207671_10394173 Ga0207671_103941731 90
191 3300025914 Ga0207671_10720164 Ga0207671_107201641 90
192 3300025919 Ga0207657_10046120 Ga0207657_100461202 90
193 3300025920 Ga0207649_10008002 Ga0207649_100080022 90
194 3300025920 Ga0207649_10126694 Ga0207649_101266944 90
195 3300025922 Ga0207646_10141455 Ga0207646_101414552 90
196 3300025923 Ga0207681_10328860 Ga0207681_103288604 90
197 3300025924 Ga0207694_10007371 Ga0207694_100073712 90
198 3300025924 Ga0207694_10719877 Ga0207694_107198772 90
199 3300025925 Ga0207650_10214941 Ga0207650_102149412 90
200 3300025925 Ga0207650_10597027 Ga0207650_105970272 90
201 3300025926 Ga0207659_10703206 Ga0207659_107032062 90
202 3300025928 Ga0207700_11885642 Ga0207700_118856421 90
203 3300025929 Ga0207664_10152911 Ga0207664_101529112 90
204 3300025931 Ga0207644_10091557 Ga0207644_100915572 90
205 3300025932 Ga0207690_10103397 Ga0207690_101033972 90
206 3300025933 Ga0207706_10366355 Ga0207706_103663552 90
207 3300025933 Ga0207706_11173445 Ga0207706_111734452 90
208 3300025934 Ga0207686_10075358 Ga0207686_100753584 90
209 3300025934 Ga0207686_10582864 Ga0207686_105828642 90
210 3300025935 Ga0207709_10552641 Ga0207709_105526412 90
211 3300025937 Ga0207669_10389319 Ga0207669_103893192 90
212 3300025940 Ga0207691_10017993 Ga0207691_100179934 90
213 3300025940 Ga0207691_10058276 Ga0207691_100582762 90
214 3300025942 Ga0207689_10022611 Ga0207689_100226115 90
215 3300025942 Ga0207689_10538612 Ga0207689_105386122 90
216 3300025944 Ga0207661_10035279 Ga0207661_100352792 90
217 3300025945 Ga0207679_10054205 Ga0207679_100542052 90
218 3300025945 Ga0207679_10083207 Ga0207679_100832072 90
219 3300025945 Ga0207679_10530957 Ga0207679_105309571 90
220 3300025945 Ga0207679_11178219 Ga0207679_111782192 90
221 3300025949 Ga0207667_10016757 Ga0207667_100167576 90
222 3300025960 Ga0207651_10102549 Ga0207651_101025492 90
223 3300025960 Ga0207651_11484464 Ga0207651_114844641 90
224 3300025961 Ga0207712_10434525 Ga0207712_104345251 90
225 3300025981 Ga0207640_10136506 Ga0207640_101365062 90
226 3300026041 Ga0207639_11159485 Ga0207639_111594852 90
227 3300026041 Ga0207639_11208280 Ga0207639_112082801 90
228 3300026041 Ga0207639_12267768 Ga0207639_122677682 90
229 3300026067 Ga0207678_10243836 Ga0207678_102438362 90
230 3300026075 Ga0207708_10160585 Ga0207708_101605853 90
231 3300026078 Ga0207702_10003896 Ga0207702_100038965 90
232 3300026078 Ga0207702_10048228 Ga0207702_100482281 90
233 3300026078 Ga0207702_10699088 Ga0207702_106990882 90
234 3300026088 Ga0207641_10742358 Ga0207641_107423583 90
235 3300026088 Ga0207641_11310178 Ga0207641_113101782 90
236 3300026088 Ga0207641_11727167 Ga0207641_117271672 90
237 3300026116 Ga0207674_10000046 Ga0207674_1000004670 90
238 3300026118 Ga0207675_102619652 Ga0207675_1026196521 90
239 3300026142 Ga0207698_10018846 Ga0207698_100188463 90
240 3300027907 Ga0207428_10201647 Ga0207428_102016471 90
241 3300028379 Ga0268266_10850043 Ga0268266_108500431 90
242 3300028379 Ga0268266_11659051 Ga0268266_116590511 90
243 3300028380 Ga0268265_10565711 Ga0268265_105657112 90
244 3300028380 Ga0268265_10962370 Ga0268265_109623701 90
245 3300028381 Ga0268264_12558701 Ga0268264_125587011 90
246 3300028794 Ga0307515_10320883 Ga0307515_103208832 90
247 3300031456 Ga0307513_10664047 Ga0307513_106640472 90
248 3300031548 Ga0307408_100248574 Ga0307408_1002485742 90
249 3300031665 Ga0316575_10146318 Ga0316575_101463181 90
250 3300031727 Ga0316576_10949447 Ga0316576_109494471 90
251 3300031728 Ga0316578_10279893 Ga0316578_102798931 90
252 3300031824 Ga0307413_10047565 Ga0307413_100475652 90
253 3300031852 Ga0307410_10606874 Ga0307410_106068742 90
254 3300031901 Ga0307406_10086779 Ga0307406_100867791 90
255 3300031903 Ga0307407_10032032 Ga0307407_100320322 90
256 3300032004 Ga0307414_11689499 Ga0307414_116894992 90
257 3300032005 Ga0307411_12044497 Ga0307411_120444972 90
258 3300032126 Ga0307415_100435945 Ga0307415_1004359452 90
259 3300032133 Ga0316583_10297585 Ga0316583_102975851 90
260 3300033180 Ga0307510_10007952 Ga0307510_100079526 90
261 3300035171 Ga0373946_0586652 Ga0373946_0586652_138_410 90
262 3300035725 Ga0373947_0809008 Ga0373947_0809008_19_291 90
263 3300039438 Ga0436360_0839257 Ga0436360_0839257_227_517 90
264 3300042005 Ga0439448_0040680 Ga0439448_0040680_178_450 90
265 3300042012 Ga0439455_0122767 Ga0439455_0122767_435_707 90
266 3300042016 Ga0439463_019489 Ga0439463_019489_697_969 90
267 3300042124 Ga0450922_012262 Ga0450922_012262_355_627 90
268 3300042157 Ga0439458_0021296 Ga0439458_0021296_117_389 90
269 3300042438 Ga0439459_0009323 Ga0439459_0009323_463_735 90
270 3300042439 Ga0439464_0085904 Ga0439464_0085904_549_821 90
271 3300042461 Ga0439460_0078436 Ga0439460_0078436_192_464 90
272 3300042876 Ga0451577_0147813 Ga0451577_0147813_510_785 90
273 3300044706 Ga0466964_0907410 Ga0466964_0907410_174_446 90
274 3300044712 Ga0453684_0129937 Ga0453684_0129937_140_415 90
275 3300045976 Ga0466967_1139807 Ga0466967_1139807_297_569 90
276 3300046472 Ga0495580_1105563 Ga0495580_1105563_120_392 90
277 3300046517 Ga0495630_1248830 Ga0495630_1248830_90_362 90
278 3300046523 Ga0495644_0099707 Ga0495644_0099707_814_1086 90
279 3300046616 Ga0495668_0189279 Ga0495668_0189279_216_488 90
280 3300046681 Ga0495647_0268472 Ga0495647_0268472_380_652 90
281 3300048091 Ga0495626_0195237 Ga0495626_0195237_38_310 90
282 3300048905 Ga0496102_0235913 Ga0496102_0235913_640_912 90
283 3300048906 Ga0496103_0415957 Ga0496103_0415957_362_634 90
284 3300048907 Ga0496104_1095916 Ga0496104_1095916_248_520 90
285 3300048911 Ga0496108_0625252 Ga0496108_0625252_21_293 90
286 3300048912 Ga0496109_0050734 Ga0496109_0050734_2175_2447 90
287 3300048913 Ga0496110_1422538 Ga0496110_1422538_149_421 90
288 3300048914 Ga0496111_0057949 Ga0496111_0057949_1394_1696 90
289 3300048922 Ga0496119_0233070 Ga0496119_0233070_167_442 90
290 3300048924 Ga0496121_0668422 Ga0496121_0668422_266_538 90
291 3300049569 Ga0501032_0317583 Ga0501032_0317583_535_807 90
292 3300049570 Ga0501033_0043090 Ga0501033_0043090_2087_2359 90
293 3300049572 Ga0501036_0043537 Ga0501036_0043537_2801_3073 90
294 3300049574 Ga0501038_0023268 Ga0501038_0023268_4523_4795 90
295 3300049575 Ga0501039_0042603 Ga0501039_0042603_760_1032 90
296 3300049576 Ga0501040_0008960 Ga0501040_0008960_5860_6132 90
297 3300049576 Ga0501040_0119277 Ga0501040_0119277_1551_1823 90
298 3300049577 Ga0501041_0000078 Ga0501041_0000078_548_820 90
299 3300049578 Ga0501042_0008213 Ga0501042_0008213_4485_4757 90
300 3300049579 Ga0501043_0390319 Ga0501043_0390319_471_743 90
301 3300049580 Ga0501046_0025838 Ga0501046_0025838_3736_4008 90
302 3300049582 Ga0501048_0000098 Ga0501048_0000098_30947_31219 90
303 3300049584 Ga0501068_0094958 Ga0501068_0094958_752_1024 90
304 3300049584 Ga0501068_0489706 Ga0501068_0489706_361_633 90
305 3300049585 Ga0501069_0260744 Ga0501069_0260744_352_624 90
306 3300049587 Ga0501071_0120023 Ga0501071_0120023_633_905 90
307 3300049588 Ga0501072_0264401 Ga0501072_0264401_785_1057 90
308 3300049589 Ga0501073_0784929 Ga0501073_0784929_77_349 90
309 3300049590 Ga0501074_0002586 Ga0501074_0002586_11789_12061 90
310 3300049591 Ga0501075_0004049 Ga0501075_0004049_70_342 90
311 3300049592 Ga0501076_0010781 Ga0501076_0010781_5762_6034 90
312 3300049593 Ga0501077_0064653 Ga0501077_0064653_25_297 90
313 3300049741 Ga0501079_0002497 Ga0501079_0002497_12421_12693 90
314 3300049741 Ga0501079_0048732 Ga0501079_0048732_2937_3209 90
315 3300049742 Ga0501080_0220213 Ga0501080_0220213_1157_1429 90
316 3300049743 Ga0501081_0255611 Ga0501081_0255611_711_983 90
317 3300049744 Ga0501083_0390397 Ga0501083_0390397_314_586 90
318 3300049822 Ga0501035_0062953 Ga0501035_0062953_208_480 90
319 3300049824 Ga0501045_0000139 Ga0501045_0000139_733_1005 90
320 3300049824 Ga0501045_0163208 Ga0501045_0163208_1376_1648 90
321 3300050489 nmdc:mga03683_615796_c1 nmdc:mga03683_615796_c1_113_385 90
322 3300050491 nmdc:mga00v17_418679_c1 nmdc:mga00v17_418679_c1_39_311 90
323 3300050492 nmdc:mga0yw44_1040774_c1 nmdc:mga0yw44_1040774_c1_65_337 90
324 3300050507 nmdc:mga05p37_261464_c1 nmdc:mga05p37_261464_c1_219_515 90
325 3300050507 nmdc:mga05p37_314165_c1 nmdc:mga05p37_314165_c1_219_491 90
326 3300050508 nmdc:mga09592_1669073_c1 nmdc:mga09592_1669073_c1_213_485 90
327 3300050508 nmdc:mga09592_54001_c1 nmdc:mga09592_54001_c1_1417_1689 90
328 3300050509 nmdc:mga0qj67_178507_c1 nmdc:mga0qj67_178507_c1_1440_1712 90
329 3300050509 nmdc:mga0qj67_344518_c1 nmdc:mga0qj67_344518_c1_648_971 90
330 3300050510 nmdc:mga06r32_1525198_c1 nmdc:mga06r32_1525198_c1_301_573 90
331 3300050510 nmdc:mga06r32_180009_c1 nmdc:mga06r32_180009_c1_1477_1749 90
332 3300050510 nmdc:mga06r32_3476_c1 nmdc:mga06r32_3476_c1_5556_5852 90
333 3300050510 nmdc:mga06r32_566736_c1 nmdc:mga06r32_566736_c1_221_493 90
334 3300050511 nmdc:mga08y16_62413_c1 nmdc:mga08y16_62413_c1_1222_1494 90
335 3300050512 nmdc:mga0n895_29127_c1 nmdc:mga0n895_29127_c1_1580_1852 90
336 3300050514 nmdc:mga08x19_23852_c1 nmdc:mga08x19_23852_c1_2855_3127 90
337 3300050515 nmdc:mga0a205_329386_c1 nmdc:mga0a205_329386_c1_398_670 90
338 3300050515 nmdc:mga0a205_9734_c2 nmdc:mga0a205_9734_c2_2715_2987 90
339 3300050516 nmdc:mga0sz30_271796_c1 nmdc:mga0sz30_271796_c1_408_680 90
340 3300050516 nmdc:mga0sz30_315164_c1 nmdc:mga0sz30_315164_c1_281_553 90
341 3300053077 Ga0495601_1029727 Ga0495601_1029727_107_391 90
342 3300053096 Ga0500641_0235513 Ga0500641_0235513_148_459 90
343 3300053115 Ga0500591_042680 Ga0500591_042680_1561_1833 90
344 3300053139 Ga0500568_0140402 Ga0500568_0140402_489_764 90
345 3300053153 Ga0500616_0289743 Ga0500616_0289743_365_640 90
346 3300053159 Ga0500630_098258 Ga0500630_098258_597_869 90
347 3300053737 Ga0500601_052044 Ga0500601_052044_38_310 90
348 3300054114 Ga0501084_0004017 Ga0501084_0004017_745_1017 90
349 3300054114 Ga0501084_1307919 Ga0501084_1307919_211_489 90
350 3300059424 Ga0590075_020940 Ga0590075_020940_366_644 90
351 3300060353 Ga0501082_0000902 Ga0501082_0000902_25111_25383 90
352 3300060353 Ga0501082_1604493 Ga0501082_1604493_270_542 90
353 3300061734 Ga0530510_0225806 Ga0530510_0225806_761_1033 90
354 3300061734 Ga0530510_0746315 Ga0530510_0746315_23_295 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

21

98

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8279 3 85
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8098 3 85
6v0g-assembly1.cif.gz_A lipophilic envelope-spanning tunnel b (letb), model 5 0.6215 38 62
4uy5-assembly1.cif.gz_A crystal structure of histidine-specific methyltransferase egtd from mycobacterium smegmatis 0.6142 27 60
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.6098 2 84
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7959 4 85 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7808 1 81 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7782 4 85 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7392 1 81 3.30.70.3090
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6939 38 60 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A535HV97-F1-model_v4 DUF4242 domain-containing protein 0.997 1 89
AF-A0A527X0F6-F1-model_v4 DUF4242 domain-containing protein 0.9967 1 83
AF-V7F045-F1-model_v4 DUF4242 domain-containing protein 0.9947 1 90
AF-A0A7W1ANW6-F1-model_v4 DUF4242 domain-containing protein 0.9944 1 59
AF-Q98DV8-F1-model_v4 Mlr4527 protein 0.9869 1 90

Feature Viewer

pLDDT pTM Quality
94.49 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map