F419565

General Info

Members Datasets Scaffolds Average Seq Length
353 249 706 65

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581279|2585146599
Length 73
Sequence APNPYPAVMDRLFDFLVPAVLLAVLSALGVGLYALFRGGEFGRSYSNKLMRLRVVLQFVAILVLVAAFWWRTR

Samples

Sample ID Description Type Environment
1 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
229 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
232 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
233 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
236 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
237 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
238 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
239 2643221583 Caulobacter sp. Root655 Isolate Unclassified
240 2643221584 Caulobacter sp. Root656 Isolate Unclassified
241 2643221642 Caulobacter sp. Root343 Isolate Unclassified
242 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
243 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
244 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
245 2849560528 Caulobacter zeae 410 Isolate Unclassified
246 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
247 2851153111 Caulobacter radicis 736 Isolate Unclassified
248 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
249 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.47
Metatranscriptomes 0.28
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.96
Nodule 0
Rhizoplane 1.42
Rhizosphere 67.99
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARCol0yngRDRAFT_1017018 3300000652 Bacteria 554
2 JGI25157J39369_1018852 3300002741 Bacteria 830
3 rootH1_10063331 3300003316 Bacteria 2308
4 rootH2_10134767 3300003320 Bacteria 1341
5 rootL2_10025813 3300003322 Bacteria 3342
6 rootH1_10258202 3300003323 Bacteria 2417
7 Ga0055526_1048731 3300003771 Bacteria 984
8 Ga0065165_1005392 3300005262 Bacteria 7219
9 Ga0070670_100679567 3300005331 Bacteria 925
10 Ga0068869_100022267 3300005334 Bacteria 4365
11 Ga0068869_100542681 3300005334 Bacteria 976
12 Ga0070666_11421718 3300005335 Bacteria 518
13 Ga0070680_100107984 3300005336 Bacteria 2315
14 Ga0070680_101640794 3300005336 Bacteria 557
15 Ga0070660_100285140 3300005339 Bacteria 1352
16 Ga0070660_100865672 3300005339 Bacteria 761
17 Ga0070691_10045304 3300005341 Bacteria 2087
18 Ga0070661_100720444 3300005344 Bacteria 814
19 Ga0070661_101591805 3300005344 Bacteria 552
20 Ga0070668_100015525 3300005347 Bacteria 5694
21 Ga0070669_100866179 3300005353 Bacteria 770
22 Ga0070671_101284836 3300005355 Bacteria 645
23 Ga0070659_100003630 3300005366 Bacteria 10991
24 Ga0070667_100329426 3300005367 Bacteria 1379
25 Ga0070681_10132966 3300005458 Bacteria 2419
26 Ga0070679_100098173 3300005530 Bacteria 2917
27 Ga0068853_100540303 3300005539 Bacteria 1103
28 Ga0068853_102311002 3300005539 Bacteria 521
29 Ga0070665_100182597 3300005548 Bacteria 2099
30 Ga0070665_101082978 3300005548 Bacteria 813
31 Ga0070665_101134216 3300005548 Bacteria 793
32 Ga0068855_100032340 3300005563 Bacteria 6247
33 Ga0068855_100044853 3300005563 Bacteria 5230
34 Ga0068855_100134445 3300005563 Bacteria 2822
35 Ga0070664_100668425 3300005564 Bacteria 966
36 Ga0068857_100138125 3300005577 Bacteria 2202
37 Ga0068854_102106474 3300005578 Bacteria 521
38 Ga0068856_100201057 3300005614 Bacteria 2007
39 Ga0068856_100460263 3300005614 Bacteria 1293
40 Ga0068856_100512365 3300005614 Bacteria 1221
41 Ga0068856_101007829 3300005614 Bacteria 851
42 Ga0068852_100489455 3300005616 Bacteria 1223
43 Ga0068852_101452364 3300005616 Bacteria 708
44 Ga0068852_101755983 3300005616 Bacteria 643
45 Ga0068864_100040888 3300005618 Bacteria 3965
46 Ga0068864_102635239 3300005618 Bacteria 509
47 Ga0068870_10224765 3300005840 Bacteria 1151
48 Ga0068863_100065761 3300005841 Bacteria 3431
49 Ga0068863_100178983 3300005841 Bacteria 2035
50 Ga0068863_101292542 3300005841 Bacteria 736
51 Ga0068860_100281651 3300005843 Bacteria 1625
52 Ga0068862_100025683 3300005844 Bacteria 4947
53 Ga0068862_100559010 3300005844 Bacteria 1093
54 Ga0068862_101419635 3300005844 Bacteria 698
55 Ga0075363_100047420 3300006048 Bacteria 2282
56 Ga0075363_100672463 3300006048 Bacteria 624
57 Ga0075364_10004307 3300006051 Bacteria 8167
58 Ga0075362_10196236 3300006177 Bacteria 982
59 Ga0075367_10017847 3300006178 Bacteria 3903
60 Ga0075369_10045935 3300006186 Bacteria 1879
61 Ga0075366_10004615 3300006195 Bacteria 7401
62 Ga0075366_10022863 3300006195 Bacteria 3640
63 Ga0075366_10085334 3300006195 Bacteria 1888
64 Ga0075366_10132429 3300006195 Bacteria 1505
65 Ga0075366_10372581 3300006195 Bacteria 877
66 Ga0097621_102341718 3300006237 Bacteria 511
67 Ga0075370_10014604 3300006353 Bacteria 4192
68 Ga0075370_10105144 3300006353 Bacteria 1636
69 Ga0105240_10076029 3300009093 Bacteria 4141
70 Ga0105240_10215134 3300009093 Bacteria 2242
71 Ga0105240_10430643 3300009093 Bacteria 1480
72 Ga0105240_10953716 3300009093 Unclassified 920
73 Ga0105240_12452484 3300009093 Bacteria 540
74 Ga0105245_12365265 3300009098 Bacteria 585
75 Ga0105242_10100957 3300009176 Bacteria 2445
76 Ga0105248_10004692 3300009177 Bacteria 15118
77 Ga0105237_10769973 3300009545 Bacteria 969
78 Ga0105238_10294122 3300009551 Bacteria 1607
79 Ga0105238_11431917 3300009551 Bacteria 719
80 Ga0105238_12271623 3300009551 Bacteria 577
81 Ga0105238_12567963 3300009551 Bacteria 546
82 Ga0105249_10915335 3300009553 Bacteria 944
83 Ga0105239_10180655 3300010375 Bacteria 2361
84 Ga0105239_10715295 3300010375 Bacteria 1145
85 Ga0105239_12057937 3300010375 Bacteria 663
86 Ga0105239_13325849 3300010375 Bacteria 523
87 Ga0157370_10374752 3300013104 Bacteria 1311
88 Ga0157369_10440165 3300013105 Bacteria 1350
89 Ga0157369_11407377 3300013105 Bacteria 710
90 Ga0157372_11219277 3300013307 Bacteria 869
91 Ga0157372_11918693 3300013307 Bacteria 681
92 Ga0163163_10216873 3300014325 Bacteria 1962
93 Ga0163163_10555928 3300014325 Bacteria 1210
94 Ga0163163_11760703 3300014325 Bacteria 680
95 Ga0157379_11437069 3300014968 Bacteria 669
96 Ga0213872_10369513 3300021361 Bacteria 585
97 Ga0213876_10000257 3300021384 Bacteria 49797
98 Ga0213876_10129571 3300021384 Bacteria 1340
99 Ga0209026_1010495 3300025250 Bacteria 1725
100 Ga0209565_1089031 3300025263 Bacteria 500
101 Ga0209673_1013487 3300025273 Bacteria 3221
102 Ga0209564_1002646 3300025295 Bacteria 13666
103 Ga0207680_10398659 3300025903 Bacteria 972
104 Ga0207645_11004212 3300025907 Bacteria 565
105 Ga0207643_10322246 3300025908 Bacteria 965
106 Ga0207705_10458578 3300025909 Bacteria 989
107 Ga0207707_11352230 3300025912 Bacteria 570
108 Ga0207695_10000806 3300025913 Bacteria 58371
109 Ga0207695_10110163 3300025913 Bacteria 2733
110 Ga0207671_10814666 3300025914 Bacteria 740
111 Ga0207660_10087902 3300025917 Bacteria 2297
112 Ga0207657_10222745 3300025919 Bacteria 1511
113 Ga0207657_10785392 3300025919 Bacteria 737
114 Ga0207657_10950728 3300025919 Bacteria 661
115 Ga0207649_10435492 3300025920 Bacteria 987
116 Ga0207652_10136635 3300025921 Bacteria 2189
117 Ga0207681_11868600 3300025923 Bacteria 501
118 Ga0207694_10123050 3300025924 Bacteria 2073
119 Ga0207650_11485523 3300025925 Bacteria 576
120 Ga0207687_11470557 3300025927 Bacteria 585
121 Ga0207644_11002482 3300025931 Bacteria 701
122 Ga0207690_10002575 3300025932 Bacteria 10945
123 Ga0207686_10223973 3300025934 Bacteria 1360
124 Ga0207711_10000919 3300025941 Bacteria 28369
125 Ga0207689_10056609 3300025942 Bacteria 3227
126 Ga0207689_11124680 3300025942 Bacteria 662
127 Ga0207679_10812860 3300025945 Bacteria 853
128 Ga0207667_10027059 3300025949 Bacteria 6253
129 Ga0207667_10037905 3300025949 Bacteria 5151
130 Ga0207667_10085307 3300025949 Bacteria 3269
131 Ga0207712_11479176 3300025961 Bacteria 608
132 Ga0207668_10172777 3300025972 Bacteria 1696
133 Ga0207640_11531045 3300025981 Bacteria 600
134 Ga0207658_10302301 3300025986 Bacteria 1379
135 Ga0207639_10530378 3300026041 Bacteria 1079
136 Ga0207678_10974323 3300026067 Bacteria 750
137 Ga0207702_10155240 3300026078 Bacteria 2086
138 Ga0207702_11171531 3300026078 Bacteria 763
139 Ga0207641_10139677 3300026088 Bacteria 2184
140 Ga0207641_11329879 3300026088 Bacteria 719
141 Ga0207674_10291194 3300026116 Bacteria 1581
142 Ga0207675_102383514 3300026118 Bacteria 542
143 Ga0207698_10386545 3300026142 Bacteria 1333
144 Ga0207698_11421192 3300026142 Bacteria 709
145 Ga0209813_10010202 3300027866 Bacteria 2422
146 Ga0268266_10237595 3300028379 Bacteria 1680
147 Ga0268266_11350076 3300028379 Bacteria 688
148 Ga0268265_10175968 3300028380 Bacteria 1834
149 Ga0268265_10523995 3300028380 Bacteria 1121
150 Ga0268265_11575449 3300028380 Bacteria 661
151 Ga0268264_10274650 3300028381 Bacteria 1576
152 Ga0268264_12390759 3300028381 Bacteria 534
153 Ga0265336_10212439 3300028666 Bacteria 575
154 Ga0307515_10023623 3300028794 Bacteria 10764
155 Ga0265338_11001964 3300028800 Bacteria 565
156 Ga0307512_10264690 3300030522 Bacteria 840
157 Ga0265760_10206052 3300031090 Bacteria 666
158 Ga0265327_10004124 3300031251 Bacteria 13125
159 Ga0307508_10310917 3300031616 Bacteria 1168
160 Ga0307516_10000001 3300031730 Bacteria 510338
161 Ga0307416_103536759 3300032002 Bacteria 523
162 Ga0307414_10847570 3300032004 Bacteria 836
163 Ga0307415_101871836 3300032126 Bacteria 582
164 Ga0307510_10019906 3300033180 Bacteria 7860
165 Ga0373929_0162262 3300035085 Bacteria 606
166 Ga0373936_0016179 3300035113 Bacteria 2867
167 Ga0373945_0238810 3300035116 Bacteria 764
168 Ga0373943_0181018 3300035170 Bacteria 1158
169 Ga0373931_0553717 3300035691 Bacteria 747
170 Ga0373935_1058165 3300035692 Bacteria 603
171 Ga0373927_0003465 3300035695 Bacteria 11301
172 Ga0373933_0203079 3300035724 Bacteria 1269
173 Ga0373925_0000049 3300037068 Bacteria 128065
174 Ga0373925_0486550 3300037068 Bacteria 1012
175 Ga0395899_0001404 3300037312 Bacteria 20645
176 Ga0395899_0079785 3300037312 Bacteria 2383
177 Ga0395899_0341713 3300037312 Bacteria 1003
178 Ga0395899_0770549 3300037312 Bacteria 597
179 Ga0395900_0000072 3300037418 Bacteria 187428
180 Ga0395900_0035094 3300037418 Bacteria 5166
181 Ga0395900_0131631 3300037418 Bacteria 2563
182 Ga0395900_1667431 3300037418 Bacteria 548
183 Ga0395898_0017968 3300037466 Bacteria 7215
184 Ga0395898_0249418 3300037466 Bacteria 1693
185 Ga0395898_0322133 3300037466 Bacteria 1474
186 Ga0395898_0440098 3300037466 Bacteria 1242
187 Ga0395898_0759815 3300037466 Bacteria 910
188 Ga0395905_0002499 3300037471 Bacteria 20331
189 Ga0395905_1119860 3300037471 Bacteria 690
190 Ga0436364_1310278 3300037853 Bacteria 644
191 Ga0436364_1379328 3300037853 Bacteria 1821
192 Ga0395901_0006683 3300038443 Bacteria 11656
193 Ga0395901_0063417 3300038443 Bacteria 3846
194 Ga0395901_0185858 3300038443 Bacteria 2179
195 Ga0395901_0606238 3300038443 Bacteria 1103
196 Ga0395901_1097301 3300038443 Bacteria 766
197 Ga0436365_0384557 3300039437 Bacteria 7460
198 Ga0436365_0439594 3300039437 Bacteria 58263
199 Ga0436361_0553807 3300039447 Bacteria 20297
200 Ga0436363_0951087 3300039450 Bacteria 2830
201 Ga0451849_1023052 3300041505 Bacteria 549
202 Ga0439445_0057063 3300042004 Bacteria 1063
203 Ga0466972_0534564 3300044658 Bacteria 553
204 Ga0466965_0223130 3300044683 Bacteria 1005
205 Ga0466961_0143994 3300044693 Bacteria 1491
206 Ga0466963_0700590 3300044694 Bacteria 715
207 Ga0466968_0258349 3300044735 Bacteria 829
208 Ga0466957_0548593 3300044842 Bacteria 805
209 Ga0495629_0144912 3300046459 Bacteria 1652
210 Ga0495638_0060879 3300046460 Bacteria 2333
211 Ga0495638_0444731 3300046460 Bacteria 663
212 Ga0495650_0107090 3300046471 Bacteria 1042
213 Ga0495585_0252411 3300046492 Bacteria 880
214 Ga0495585_0416898 3300046492 Bacteria 645
215 Ga0495583_0147641 3300046506 Bacteria 976
216 Ga0495606_0383147 3300046507 Bacteria 737
217 Ga0495610_0082883 3300046512 Bacteria 1469
218 Ga0495610_0200119 3300046512 Bacteria 818
219 Ga0495616_0000270 3300046513 Bacteria 42085
220 Ga0495620_0017817 3300046515 Bacteria 3531
221 Ga0495628_0436067 3300046516 Bacteria 953
222 Ga0495631_0120626 3300046518 Bacteria 1128
223 Ga0495632_0095397 3300046519 Bacteria 1405
224 Ga0495637_0117272 3300046520 Bacteria 1027
225 Ga0495648_0000575 3300046524 Bacteria 39312
226 Ga0495648_0015374 3300046524 Bacteria 5559
227 Ga0495663_0222568 3300046525 Bacteria 664
228 Ga0495654_0064554 3300046530 Bacteria 1750
229 Ga0495609_0011706 3300046538 Bacteria 4174
230 Ga0495609_0120188 3300046538 Bacteria 1130
231 Ga0495597_0003372 3300046542 Bacteria 9375
232 Ga0495597_0405282 3300046542 Bacteria 518
233 Ga0495622_0002042 3300046557 Bacteria 9864
234 Ga0495668_0769198 3300046616 Bacteria 533
235 Ga0495625_0007597 3300046660 Bacteria 9413
236 Ga0495625_0074153 3300046660 Bacteria 2384
237 Ga0495625_0295838 3300046660 Bacteria 1037
238 Ga0495613_0746808 3300046689 Bacteria 641
239 Ga0495624_0551316 3300046690 Bacteria 688
240 Ga0495670_0410215 3300046691 Bacteria 732
241 Ga0495670_0550558 3300046691 Bacteria 628
242 Ga0495660_0428474 3300046810 Unclassified 575
243 Ga0495660_0472632 3300046810 Bacteria 539
244 Ga0495683_0330509 3300047323 Bacteria 648
245 Ga0495687_018131 3300047443 Bacteria 3488
246 Ga0495673_0000264 3300047469 Bacteria 72931
247 Ga0495681_0041115 3300047470 Bacteria 2246
248 Ga0495686_0037972 3300047472 Bacteria 3083
249 Ga0495686_0235001 3300047472 Bacteria 1036
250 Ga0495615_0044788 3300048090 Bacteria 1118
251 Ga0495626_0368773 3300048091 Bacteria 558
252 Ga0496102_0027948 3300048905 Bacteria 5040
253 Ga0496103_0440514 3300048906 Bacteria 836
254 Ga0496112_0799245 3300048915 Bacteria 868
255 Ga0496112_1565210 3300048915 Bacteria 573
256 Ga0496115_0253841 3300048918 Bacteria 1447
257 Ga0496117_0018382 3300048920 Bacteria 5790
258 Ga0496118_0009118 3300048921 Bacteria 10095
259 Ga0496119_0016273 3300048922 Bacteria 5670
260 Ga0496121_0000397 3300048924 Bacteria 87422
261 Ga0496124_0296246 3300048927 Bacteria 1171
262 Ga0495682_0031562 3300049460 Bacteria 1958
263 Ga0501032_0378918 3300049569 Bacteria 910
264 Ga0501032_0571743 3300049569 Bacteria 720
265 Ga0501033_0878183 3300049570 Bacteria 603
266 Ga0501034_0146259 3300049571 Bacteria 2341
267 Ga0501034_0159951 3300049571 Bacteria 2224
268 Ga0501034_0875781 3300049571 Bacteria 787
269 Ga0501036_0550826 3300049572 Bacteria 958
270 Ga0501037_0118589 3300049573 Bacteria 1904
271 Ga0501038_1020269 3300049574 Bacteria 607
272 Ga0501047_0117499 3300049581 Bacteria 2541
273 Ga0501047_0293873 3300049581 Bacteria 1468
274 Ga0501047_0522532 3300049581 Bacteria 1013
275 Ga0501069_0489845 3300049585 Bacteria 733
276 Ga0501070_0119445 3300049586 Bacteria 2179
277 Ga0501071_1041497 3300049587 Bacteria 632
278 Ga0501080_0939920 3300049742 Bacteria 752
279 Ga0501044_0013504 3300049823 Bacteria 8832
280 Ga0501044_0344185 3300049823 Bacteria 1412
281 Ga0501044_0638533 3300049823 Bacteria 955
282 Ga0501044_1410356 3300049823 Bacteria 562
283 nmdc:mga03683_86170_c1 3300050489 Bacteria 1363
284 nmdc:mga03n38_15027_c1 3300050490 Bacteria 2982
285 nmdc:mga00v17_3414_c1 3300050491 Bacteria 8209
286 nmdc:mga0k408_101575_c1 3300050493 Bacteria 1696
287 nmdc:mga0k408_114817_c1 3300050493 Bacteria 1593
288 nmdc:mga0k408_124411_c1 3300050493 Bacteria 1529
289 nmdc:mga0k408_31906_c1 3300050493 Bacteria 3010
290 nmdc:mga0k408_631233_c1 3300050493 Bacteria 631
291 nmdc:mga06z11_25019_c1 3300050494 Bacteria 2824
292 nmdc:mga04h51_5941_c1 3300050495 Bacteria 3135
293 nmdc:mga07m45_12598_c1 3300050496 Bacteria 4472
294 nmdc:mga07m45_13528_c1 3300050496 Bacteria 4333
295 nmdc:mga0sz30_16219_c1 3300050516 Bacteria 2954
296 Ga0500635_0000338 3300053080 Bacteria 15659
297 Ga0500643_024519 3300053087 Bacteria 1914
298 Ga0500644_0000087 3300053088 Bacteria 56947
299 Ga0500647_0029605 3300053091 Bacteria 2598
300 Ga0500583_0160448 3300053092 Bacteria 1120
301 Ga0500583_0162493 3300053092 Bacteria 1112
302 Ga0500651_0032375 3300053093 Bacteria 3294
303 Ga0500566_0009628 3300053094 Bacteria 5710
304 Ga0500641_0073296 3300053096 Bacteria 1444
305 Ga0500555_001559 3300053103 Bacteria 6936
306 Ga0500555_180497 3300053103 Bacteria 511
307 Ga0500569_000746 3300053109 Bacteria 5684
308 Ga0500572_087124 3300053111 Bacteria 985
309 Ga0500595_004485 3300053119 Bacteria 6254
310 Ga0500607_021543 3300053121 Bacteria 3632
311 Ga0500608_000915 3300053122 Bacteria 10631
312 Ga0500614_003964 3300053123 Bacteria 3158
313 Ga0500642_0062140 3300053130 Bacteria 1680
314 Ga0500642_0455293 3300053130 Unclassified 548
315 Ga0500658_0124512 3300053134 Bacteria 1145
316 Ga0500559_0052409 3300053136 Bacteria 1803
317 Ga0500564_000023 3300053138 Bacteria 45842
318 Ga0500564_165798 3300053138 Bacteria 932
319 Ga0500577_0405892 3300053142 Bacteria 596
320 Ga0500577_0409886 3300053142 Bacteria 593
321 Ga0500590_063140 3300053148 Bacteria 1857
322 Ga0500619_034498 3300053154 Bacteria 1564
323 Ga0500619_085385 3300053154 Bacteria 1063
324 Ga0500622_0065581 3300053156 Bacteria 1844
325 Ga0500624_014113 3300053157 Bacteria 1204
326 Ga0500627_0272396 3300053158 Bacteria 745
327 Ga0500638_012587 3300053162 Bacteria 3795
328 Ga0500636_0019412 3300053177 Bacteria 4024
329 Ga0500636_0278099 3300053177 Bacteria 837
330 Ga0500637_0019685 3300053178 Bacteria 3643
331 Ga0500637_0040734 3300053178 Bacteria 2624
332 Ga0500611_145146 3300053727 Bacteria 648
333 Ga0500625_069606 3300053729 Bacteria 1570
334 Ga0500645_180514 3300053730 Bacteria 574
335 Ga0500596_003742 3300053735 Bacteria 2852
336 Ga0500599_083516 3300053736 Unclassified 545
337 Ga0500601_001323 3300053737 Bacteria 2733
338 Ga0501082_1875310 3300060353 Bacteria 523
339 2585146599 2582581279 Bacteria 4980720
340 2511125000 2510917020 Bacteria 5657507
341 2643750087 2643221545 Bacteria 5083237
342 2643782496 2643221552 Bacteria 5708754
343 2643924252 2643221583 Bacteria 5218014
344 2643928705 2643221584 Bacteria 5511711
345 2644233786 2643221642 Bacteria 5357871
346 2644510757 2643221691 Bacteria 5093099
347 2792460355 2791355048 Bacteria 5832535
348 2843745043 2843744320 Bacteria 5659202
349 2849564164 2849560528 Bacteria 5393480
350 2849575505 2849573788 Bacteria 5421256
351 2851155295 2851153111 Bacteria 5542585
352 2898334089 2898329390 Bacteria 5168154
353 2928531387 2928531327 Bacteria 5101314
354 ARCol0yngRDRAFT_1017018
355 JGI25157J39369_1018852
356 rootH1_10063331
357 rootH2_10134767
358 rootL2_10025813
359 rootH1_10258202
360 Ga0055526_1048731
361 Ga0065165_1005392
362 Ga0070670_100679567
363 Ga0068869_100022267
364 Ga0068869_100542681
365 Ga0070666_11421718
366 Ga0070680_100107984
367 Ga0070680_101640794
368 Ga0070660_100285140
369 Ga0070660_100865672
370 Ga0070691_10045304
371 Ga0070661_100720444
372 Ga0070661_101591805
373 Ga0070668_100015525
374 Ga0070669_100866179
375 Ga0070671_101284836
376 Ga0070659_100003630
377 Ga0070667_100329426
378 Ga0070681_10132966
379 Ga0070679_100098173
380 Ga0068853_100540303
381 Ga0068853_102311002
382 Ga0070665_100182597
383 Ga0070665_101082978
384 Ga0070665_101134216
385 Ga0068855_100032340
386 Ga0068855_100044853
387 Ga0068855_100134445
388 Ga0070664_100668425
389 Ga0068857_100138125
390 Ga0068854_102106474
391 Ga0068856_100201057
392 Ga0068856_100460263
393 Ga0068856_100512365
394 Ga0068856_101007829
395 Ga0068852_100489455
396 Ga0068852_101452364
397 Ga0068852_101755983
398 Ga0068864_100040888
399 Ga0068864_102635239
400 Ga0068870_10224765
401 Ga0068863_100065761
402 Ga0068863_100178983
403 Ga0068863_101292542
404 Ga0068860_100281651
405 Ga0068862_100025683
406 Ga0068862_100559010
407 Ga0068862_101419635
408 Ga0075363_100047420
409 Ga0075363_100672463
410 Ga0075364_10004307
411 Ga0075362_10196236
412 Ga0075367_10017847
413 Ga0075369_10045935
414 Ga0075366_10004615
415 Ga0075366_10022863
416 Ga0075366_10085334
417 Ga0075366_10132429
418 Ga0075366_10372581
419 Ga0097621_102341718
420 Ga0075370_10014604
421 Ga0075370_10105144
422 Ga0105240_10076029
423 Ga0105240_10215134
424 Ga0105240_10430643
425 Ga0105240_10953716
426 Ga0105240_12452484
427 Ga0105245_12365265
428 Ga0105242_10100957
429 Ga0105248_10004692
430 Ga0105237_10769973
431 Ga0105238_10294122
432 Ga0105238_11431917
433 Ga0105238_12271623
434 Ga0105238_12567963
435 Ga0105249_10915335
436 Ga0105239_10180655
437 Ga0105239_10715295
438 Ga0105239_12057937
439 Ga0105239_13325849
440 Ga0157370_10374752
441 Ga0157369_10440165
442 Ga0157369_11407377
443 Ga0157372_11219277
444 Ga0157372_11918693
445 Ga0163163_10216873
446 Ga0163163_10555928
447 Ga0163163_11760703
448 Ga0157379_11437069
449 Ga0213872_10369513
450 Ga0213876_10000257
451 Ga0213876_10129571
452 Ga0209026_1010495
453 Ga0209565_1089031
454 Ga0209673_1013487
455 Ga0209564_1002646
456 Ga0207680_10398659
457 Ga0207645_11004212
458 Ga0207643_10322246
459 Ga0207705_10458578
460 Ga0207707_11352230
461 Ga0207695_10000806
462 Ga0207695_10110163
463 Ga0207671_10814666
464 Ga0207660_10087902
465 Ga0207657_10222745
466 Ga0207657_10785392
467 Ga0207657_10950728
468 Ga0207649_10435492
469 Ga0207652_10136635
470 Ga0207681_11868600
471 Ga0207694_10123050
472 Ga0207650_11485523
473 Ga0207687_11470557
474 Ga0207644_11002482
475 Ga0207690_10002575
476 Ga0207686_10223973
477 Ga0207711_10000919
478 Ga0207689_10056609
479 Ga0207689_11124680
480 Ga0207679_10812860
481 Ga0207667_10027059
482 Ga0207667_10037905
483 Ga0207667_10085307
484 Ga0207712_11479176
485 Ga0207668_10172777
486 Ga0207640_11531045
487 Ga0207658_10302301
488 Ga0207639_10530378
489 Ga0207678_10974323
490 Ga0207702_10155240
491 Ga0207702_11171531
492 Ga0207641_10139677
493 Ga0207641_11329879
494 Ga0207674_10291194
495 Ga0207675_102383514
496 Ga0207698_10386545
497 Ga0207698_11421192
498 Ga0209813_10010202
499 Ga0268266_10237595
500 Ga0268266_11350076
501 Ga0268265_10175968
502 Ga0268265_10523995
503 Ga0268265_11575449
504 Ga0268264_10274650
505 Ga0268264_12390759
506 Ga0265336_10212439
507 Ga0307515_10023623
508 Ga0265338_11001964
509 Ga0307512_10264690
510 Ga0265760_10206052
511 Ga0265327_10004124
512 Ga0307508_10310917
513 Ga0307516_10000001
514 Ga0307416_103536759
515 Ga0307414_10847570
516 Ga0307415_101871836
517 Ga0307510_10019906
518 Ga0373929_0162262
519 Ga0373936_0016179
520 Ga0373945_0238810
521 Ga0373943_0181018
522 Ga0373931_0553717
523 Ga0373935_1058165
524 Ga0373927_0003465
525 Ga0373933_0203079
526 Ga0373925_0000049
527 Ga0373925_0486550
528 Ga0395899_0001404
529 Ga0395899_0079785
530 Ga0395899_0341713
531 Ga0395899_0770549
532 Ga0395900_0000072
533 Ga0395900_0035094
534 Ga0395900_0131631
535 Ga0395900_1667431
536 Ga0395898_0017968
537 Ga0395898_0249418
538 Ga0395898_0322133
539 Ga0395898_0440098
540 Ga0395898_0759815
541 Ga0395905_0002499
542 Ga0395905_1119860
543 Ga0436364_1310278
544 Ga0436364_1379328
545 Ga0395901_0006683
546 Ga0395901_0063417
547 Ga0395901_0185858
548 Ga0395901_0606238
549 Ga0395901_1097301
550 Ga0436365_0384557
551 Ga0436365_0439594
552 Ga0436361_0553807
553 Ga0436363_0951087
554 Ga0451849_1023052
555 Ga0439445_0057063
556 Ga0466972_0534564
557 Ga0466965_0223130
558 Ga0466961_0143994
559 Ga0466963_0700590
560 Ga0466968_0258349
561 Ga0466957_0548593
562 Ga0495629_0144912
563 Ga0495638_0060879
564 Ga0495638_0444731
565 Ga0495650_0107090
566 Ga0495585_0252411
567 Ga0495585_0416898
568 Ga0495583_0147641
569 Ga0495606_0383147
570 Ga0495610_0082883
571 Ga0495610_0200119
572 Ga0495616_0000270
573 Ga0495620_0017817
574 Ga0495628_0436067
575 Ga0495631_0120626
576 Ga0495632_0095397
577 Ga0495637_0117272
578 Ga0495648_0000575
579 Ga0495648_0015374
580 Ga0495663_0222568
581 Ga0495654_0064554
582 Ga0495609_0011706
583 Ga0495609_0120188
584 Ga0495597_0003372
585 Ga0495597_0405282
586 Ga0495622_0002042
587 Ga0495668_0769198
588 Ga0495625_0007597
589 Ga0495625_0074153
590 Ga0495625_0295838
591 Ga0495613_0746808
592 Ga0495624_0551316
593 Ga0495670_0410215
594 Ga0495670_0550558
595 Ga0495660_0428474
596 Ga0495660_0472632
597 Ga0495683_0330509
598 Ga0495687_018131
599 Ga0495673_0000264
600 Ga0495681_0041115
601 Ga0495686_0037972
602 Ga0495686_0235001
603 Ga0495615_0044788
604 Ga0495626_0368773
605 Ga0496102_0027948
606 Ga0496103_0440514
607 Ga0496112_0799245
608 Ga0496112_1565210
609 Ga0496115_0253841
610 Ga0496117_0018382
611 Ga0496118_0009118
612 Ga0496119_0016273
613 Ga0496121_0000397
614 Ga0496124_0296246
615 Ga0495682_0031562
616 Ga0501032_0378918
617 Ga0501032_0571743
618 Ga0501033_0878183
619 Ga0501034_0146259
620 Ga0501034_0159951
621 Ga0501034_0875781
622 Ga0501036_0550826
623 Ga0501037_0118589
624 Ga0501038_1020269
625 Ga0501047_0117499
626 Ga0501047_0293873
627 Ga0501047_0522532
628 Ga0501069_0489845
629 Ga0501070_0119445
630 Ga0501071_1041497
631 Ga0501080_0939920
632 Ga0501044_0013504
633 Ga0501044_0344185
634 Ga0501044_0638533
635 Ga0501044_1410356
636 nmdc:mga03683_86170_c1
637 nmdc:mga03n38_15027_c1
638 nmdc:mga00v17_3414_c1
639 nmdc:mga0k408_101575_c1
640 nmdc:mga0k408_114817_c1
641 nmdc:mga0k408_124411_c1
642 nmdc:mga0k408_31906_c1
643 nmdc:mga0k408_631233_c1
644 nmdc:mga06z11_25019_c1
645 nmdc:mga04h51_5941_c1
646 nmdc:mga07m45_12598_c1
647 nmdc:mga07m45_13528_c1
648 nmdc:mga0sz30_16219_c1
649 Ga0500635_0000338
650 Ga0500643_024519
651 Ga0500644_0000087
652 Ga0500647_0029605
653 Ga0500583_0160448
654 Ga0500583_0162493
655 Ga0500651_0032375
656 Ga0500566_0009628
657 Ga0500641_0073296
658 Ga0500555_001559
659 Ga0500555_180497
660 Ga0500569_000746
661 Ga0500572_087124
662 Ga0500595_004485
663 Ga0500607_021543
664 Ga0500608_000915
665 Ga0500614_003964
666 Ga0500642_0062140
667 Ga0500642_0455293
668 Ga0500658_0124512
669 Ga0500559_0052409
670 Ga0500564_000023
671 Ga0500564_165798
672 Ga0500577_0405892
673 Ga0500577_0409886
674 Ga0500590_063140
675 Ga0500619_034498
676 Ga0500619_085385
677 Ga0500622_0065581
678 Ga0500624_014113
679 Ga0500627_0272396
680 Ga0500638_012587
681 Ga0500636_0019412
682 Ga0500636_0278099
683 Ga0500637_0019685
684 Ga0500637_0040734
685 Ga0500611_145146
686 Ga0500625_069606
687 Ga0500645_180514
688 Ga0500596_003742
689 Ga0500599_083516
690 Ga0500601_001323
691 Ga0501082_1875310
692 2585146599
693 2511125000
694 2643750087
695 2643782496
696 2643924252
697 2643928705
698 2644233786
699 2644510757
700 2792460355
701 2843745043
702 2849564164
703 2849575505
704 2851155295
705 2898334089
706 2928531387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04588

HIG_1_N

Hypoxia induced protein conserved region

14

67

0.93

Map