F419290

General Info

Members Datasets Scaffolds Average Seq Length
353 223 706 221

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100273813|Ga0070667_1002738132
Length 222
Sequence MKFFVDTADVADIRDLAATGLLDGVTTNPSLIAKSGRPFLEVIREIADIVPGPVSAEVTATDAATMIKEGKKLHALGTGKNDNIAVKVPLTPDGLKACKALSGEGIMVNVTLCFSAAQAILTAKAGATFVSPFVGRLDDIGQDGMALIADIVEIYSQYPQFGTEILVASVRGPQHVVAAAKMGADICTIPPNILRQLFSHPLTDKGLASFLADWAKTGQSIL

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
214 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2842694124 Methylopila sp. R-72369 Isolate Unclassified
221 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
222 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
223 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 3.97
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.92
Nodule 0.28
Rhizoplane 1.42
Rhizosphere 82.44
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100273813 3300005367 Bacteria 1514
2 SwRhRL2b_contig_2692703 2162886007 Bacteria 2207
3 JGI25153J46596_10000322 3300003215 Bacteria 35141
4 JGI25160J50197_1010107 3300003354 Bacteria 3439
5 Ga0055529_1008464 3300003763 Bacteria 1368
6 Ga0055531_10021388 3300003794 Bacteria 2510
7 Ga0058863_11418109 3300004799 Bacteria 989
8 Ga0065704_10187252 3300005289 Bacteria 1207
9 Ga0070658_10219693 3300005327 Bacteria 1607
10 Ga0070690_100130277 3300005330 Bacteria 1698
11 Ga0070680_100036534 3300005336 Bacteria 3969
12 Ga0070680_100285854 3300005336 Bacteria 1398
13 Ga0070689_100302769 3300005340 Bacteria 1331
14 Ga0070674_100036832 3300005356 Bacteria 3287
15 Ga0070709_10307183 3300005434 Bacteria 1160
16 Ga0070713_100521569 3300005436 Bacteria 1123
17 Ga0070700_100292285 3300005441 Bacteria 1186
18 Ga0070708_100251269 3300005445 Bacteria 1661
19 Ga0070663_100579754 3300005455 Bacteria 941
20 Ga0070678_100018495 3300005456 Bacteria 4517
21 Ga0070681_10025749 3300005458 Bacteria 5914
22 Ga0070681_10214127 3300005458 Bacteria 1843
23 Ga0070681_10227893 3300005458 Bacteria 1778
24 Ga0070681_10249752 3300005458 Bacteria 1687
25 Ga0070681_10720095 3300005458 Bacteria 914
26 Ga0068867_100145262 3300005459 Bacteria 1858
27 Ga0070706_100091465 3300005467 Bacteria 2822
28 Ga0070707_100907274 3300005468 Bacteria 846
29 Ga0070698_100138251 3300005471 Bacteria 2389
30 Ga0070679_100027688 3300005530 Bacteria 5580
31 Ga0070679_100058610 3300005530 Bacteria 3837
32 Ga0070679_100131467 3300005530 Bacteria 2484
33 Ga0070679_100606738 3300005530 Bacteria 1038
34 Ga0070684_100486130 3300005535 Bacteria 1143
35 Ga0068853_100246614 3300005539 Bacteria 1638
36 Ga0070695_100819333 3300005545 Bacteria 747
37 Ga0070696_100164557 3300005546 Bacteria 1636
38 Ga0070693_100169767 3300005547 Bacteria 1396
39 Ga0070704_100037802 3300005549 Bacteria 3301
40 Ga0070664_100600934 3300005564 Bacteria 1020
41 Ga0068857_100095145 3300005577 Bacteria 2668
42 Ga0068856_100248048 3300005614 Bacteria 1796
43 Ga0068864_100558486 3300005618 Bacteria 1107
44 Ga0068866_10344899 3300005718 Bacteria 944
45 Ga0068866_10349642 3300005718 Bacteria 939
46 Ga0068861_100062462 3300005719 Bacteria 2862
47 Ga0068862_100147106 3300005844 Bacteria 2095
48 Ga0081455_10000448 3300005937 Bacteria 54262
49 Ga0081455_10246573 3300005937 Bacteria 1309
50 Ga0081455_10337438 3300005937 Bacteria 1068
51 Ga0081540_1052161 3300005983 Bacteria 2016
52 Ga0081540_1060114 3300005983 Bacteria 1820
53 Ga0081540_1073908 3300005983 Bacteria 1564
54 Ga0075365_10276609 3300006038 Bacteria 1181
55 Ga0075363_100074734 3300006048 Bacteria 1845
56 Ga0070716_100321268 3300006173 Bacteria 1085
57 Ga0070712_100330392 3300006175 Bacteria 1242
58 Ga0075367_10235632 3300006178 Bacteria 1146
59 Ga0075428_100443416 3300006844 Bacteria 1391
60 Ga0075428_100986334 3300006844 Bacteria 892
61 Ga0075430_100064231 3300006846 Bacteria 3084
62 Ga0075436_100073974 3300006914 Bacteria 2359
63 Ga0097620_100261447 3300006931 Bacteria 1822
64 Ga0105240_10099095 3300009093 Bacteria 3548
65 Ga0111539_10010771 3300009094 Bacteria 11511
66 Ga0111539_10804927 3300009094 Bacteria 1094
67 Ga0105247_10314628 3300009101 Bacteria 1090
68 Ga0114129_10188402 3300009147 Bacteria 2803
69 Ga0114129_10909526 3300009147 Bacteria 1114
70 Ga0105248_10503820 3300009177 Bacteria 1365
71 Ga0105238_10238597 3300009551 Bacteria 1795
72 Ga0105033_104580 3300009986 Bacteria 1178
73 Ga0105239_10572995 3300010375 Bacteria 1286
74 Ga0157370_10028169 3300013104 Bacteria 5530
75 Ga0157370_10090895 3300013104 Bacteria 2866
76 Ga0157370_10108734 3300013104 Bacteria 2592
77 Ga0157369_10012938 3300013105 Bacteria 9457
78 Ga0157369_10311956 3300013105 Bacteria 1635
79 Ga0157374_10533964 3300013296 Bacteria 1180
80 Ga0157378_10196354 3300013297 Bacteria 1906
81 Ga0163162_10901299 3300013306 Bacteria 997
82 Ga0157372_10171300 3300013307 Bacteria 2512
83 Ga0157372_10251195 3300013307 Bacteria 2053
84 Ga0157380_10075158 3300014326 Bacteria 2745
85 Ga0157380_10431968 3300014326 Bacteria 1259
86 Ga0157379_10366067 3300014968 Bacteria 1322
87 Ga0157379_10662745 3300014968 Bacteria 978
88 Ga0197907_10657786 3300020069 Bacteria 1230
89 Ga0206356_10244267 3300020070 Bacteria 1288
90 Ga0206356_10311804 3300020070 Bacteria 1619
91 Ga0206349_1132236 3300020075 Bacteria 1335
92 Ga0206355_1497594 3300020076 Bacteria 1424
93 Ga0206351_10240489 3300020077 Bacteria 1241
94 Ga0206354_10514210 3300020081 Bacteria 1433
95 Ga0206353_10685217 3300020082 Bacteria 1048
96 Ga0154015_1281358 3300020610 Bacteria 863
97 Ga0213876_10034053 3300021384 Bacteria 2685
98 Ga0224712_10049308 3300022467 Bacteria 1630
99 Ga0224712_10098155 3300022467 Bacteria 1238
100 Ga0224712_10296581 3300022467 Bacteria 755
101 Ga0209148_1000923 3300025254 Bacteria 19487
102 Ga0209455_1000830 3300025272 Bacteria 16672
103 Ga0209130_1000514 3300025284 Bacteria 39017
104 Ga0209675_1021286 3300025291 Bacteria 1733
105 Ga0209676_1048624 3300025292 Bacteria 1131
106 Ga0209025_1002324 3300025294 Bacteria 20545
107 Ga0209758_1000202 3300025297 Bacteria 132401
108 Ga0209758_1022266 3300025297 Bacteria 2915
109 Ga0209050_1002212 3300025298 Bacteria 17468
110 Ga0207426_1000085 3300025302 Bacteria 293171
111 Ga0207426_1026964 3300025302 Bacteria 1919
112 Ga0209051_1050691 3300025303 Bacteria 1388
113 Ga0209257_1001008 3300025304 Bacteria 38052
114 Ga0207688_10285154 3300025901 Bacteria 1007
115 Ga0207699_10451141 3300025906 Bacteria 923
116 Ga0207684_10401638 3300025910 Bacteria 1178
117 Ga0207707_10059804 3300025912 Bacteria 3315
118 Ga0207707_10070511 3300025912 Bacteria 3045
119 Ga0207707_10226494 3300025912 Bacteria 1627
120 Ga0207707_10739645 3300025912 Bacteria 823
121 Ga0207695_10228517 3300025913 Bacteria 1766
122 Ga0207693_10173642 3300025915 Bacteria 1696
123 Ga0207660_10025352 3300025917 Bacteria 4024
124 Ga0207660_10034059 3300025917 Bacteria 3527
125 Ga0207660_10155379 3300025917 Bacteria 1761
126 Ga0207652_10015894 3300025921 Bacteria 6132
127 Ga0207652_10106274 3300025921 Bacteria 2484
128 Ga0207652_10228787 3300025921 Bacteria 1676
129 Ga0207694_10134985 3300025924 Bacteria 1981
130 Ga0207664_10001732 3300025929 Bacteria 14363
131 Ga0207690_10043771 3300025932 Bacteria 2948
132 Ga0207670_10175109 3300025936 Bacteria 1612
133 Ga0207704_10029202 3300025938 Bacteria 3071
134 Ga0207661_10372030 3300025944 Bacteria 1292
135 Ga0207679_10352377 3300025945 Bacteria 1283
136 Ga0207658_10052318 3300025986 Bacteria 3013
137 Ga0207708_10154484 3300026075 Bacteria 1809
138 Ga0207641_10320374 3300026088 Bacteria 1470
139 Ga0207641_10773331 3300026088 Bacteria 949
140 Ga0207648_10088009 3300026089 Bacteria 2711
141 Ga0207676_10723375 3300026095 Bacteria 966
142 Ga0207674_10228075 3300026116 Bacteria 1811
143 Ga0207675_100392842 3300026118 Bacteria 1366
144 Ga0209983_1036218 3300027665 Bacteria 1060
145 Ga0207428_10000134 3300027907 Bacteria 99640
146 Ga0268265_10002561 3300028380 Bacteria 13591
147 Ga0268265_10052363 3300028380 Bacteria 3087
148 Ga0307517_10083165 3300028786 Bacteria 2709
149 Ga0307517_10272511 3300028786 Bacteria 972
150 Ga0307515_10202241 3300028794 Bacteria 1858
151 Ga0265338_10307866 3300028800 Bacteria 1150
152 Ga0265330_10112891 3300031235 Bacteria 1160
153 Ga0265340_10015971 3300031247 Bacteria 3893
154 Ga0265339_10209733 3300031249 Bacteria 957
155 Ga0265331_10008931 3300031250 Bacteria 5666
156 Ga0265327_10004225 3300031251 Bacteria 12896
157 Ga0265327_10022399 3300031251 Bacteria 3778
158 Ga0265327_10046972 3300031251 Bacteria 2281
159 Ga0265316_10016179 3300031344 Bacteria 6482
160 Ga0265316_10055061 3300031344 Bacteria 3113
161 Ga0265316_10153739 3300031344 Bacteria 1723
162 Ga0307513_10099459 3300031456 Bacteria 2937
163 Ga0307513_10342143 3300031456 Bacteria 1246
164 Ga0265313_10000110 3300031595 Bacteria 82958
165 Ga0265313_10000296 3300031595 Bacteria 54068
166 Ga0307508_10217371 3300031616 Bacteria 1511
167 Ga0265314_10009115 3300031711 Bacteria 8427
168 Ga0265314_10054631 3300031711 Bacteria 2763
169 Ga0265314_10144966 3300031711 Bacteria 1464
170 Ga0265342_10009374 3300031712 Bacteria 6907
171 Ga0265342_10161364 3300031712 Bacteria 1239
172 Ga0307516_10183213 3300031730 Bacteria 1826
173 Ga0307516_10258422 3300031730 Bacteria 1433
174 Ga0307516_10443444 3300031730 Bacteria 955
175 Ga0307413_10445940 3300031824 Bacteria 1026
176 Ga0373934_0050191 3300035086 Bacteria 1653
177 Ga0373956_0224513 3300035119 Bacteria 892
178 Ga0373957_0132245 3300035120 Bacteria 1016
179 Ga0373943_0236461 3300035170 Bacteria 1022
180 Ga0373927_0087157 3300035695 Bacteria 2027
181 Ga0373933_0221880 3300035724 Bacteria 1213
182 Ga0373947_0197301 3300035725 Bacteria 1316
183 Ga0373947_0382813 3300035725 Bacteria 947
184 Ga0373937_0012900 3300036401 Bacteria 7360
185 Ga0373937_0229752 3300036401 Bacteria 1747
186 Ga0373937_0899289 3300036401 Bacteria 834
187 Ga0395899_0015093 3300037312 Bacteria 5887
188 Ga0395900_0016578 3300037418 Bacteria 7515
189 Ga0395900_0080366 3300037418 Bacteria 3350
190 Ga0395900_0219722 3300037418 Bacteria 1916
191 Ga0395898_0013734 3300037466 Bacteria 8328
192 Ga0395898_0391529 3300037466 Bacteria 1325
193 Ga0395901_0010398 3300038443 Bacteria 9426
194 Ga0395901_0335290 3300038443 Unclassified 1563
195 Ga0400483_107845 3300039062 Bacteria 7564
196 Ga0400483_231484 3300039062 Bacteria 3780
197 Ga0436365_0587552 3300039437 Bacteria 2695
198 Ga0436365_0813186 3300039437 Bacteria 7408
199 Ga0436363_1578732 3300039450 Bacteria 1129
200 Ga0439456_058533 3300042013 Bacteria 846
201 Ga0451577_0076542 3300042876 Bacteria 2983
202 Ga0453684_0056997 3300044712 Bacteria 5063
203 Ga0453684_0341521 3300044712 Bacteria 1690
204 Ga0466960_0403318 3300044901 Bacteria 788
205 Ga0451576_0000056 3300045051 Bacteria 303398
206 Ga0451576_0003094 3300045051 Bacteria 23346
207 Ga0451576_0189867 3300045051 Bacteria 2146
208 Ga0451576_0215501 3300045051 Bacteria 2005
209 Ga0466967_0020579 3300045976 Bacteria 5338
210 Ga0466967_0686067 3300045976 Bacteria 1014
211 Ga0495610_0004095 3300046512 Bacteria 10922
212 Ga0495640_0124960 3300046533 Bacteria 1669
213 Ga0495668_0430647 3300046616 Bacteria 726
214 Ga0495625_0309429 3300046660 Bacteria 1009
215 Ga0495623_0122928 3300046679 Bacteria 1561
216 Ga0495649_0065905 3300046694 Bacteria 1944
217 Ga0495686_0137184 3300047472 Bacteria 1446
218 Ga0496102_0815171 3300048905 Bacteria 855
219 Ga0496106_0690999 3300048909 Bacteria 813
220 Ga0496112_0521003 3300048915 Bacteria 1123
221 Ga0496113_0256734 3300048916 Bacteria 1396
222 Ga0496115_0098637 3300048918 Bacteria 2393
223 Ga0496117_0178384 3300048920 Bacteria 1224
224 Ga0496121_0001812 3300048924 Bacteria 34516
225 Ga0496124_0083375 3300048927 Bacteria 2622
226 Ga0496125_0182047 3300048928 Bacteria 1399
227 Ga0496126_0033365 3300048929 Bacteria 4843
228 Ga0501031_0014610 3300049568 Bacteria 5105
229 Ga0501031_0043913 3300049568 Bacteria 2916
230 Ga0501032_0094146 3300049569 Bacteria 1986
231 Ga0501032_0141594 3300049569 Bacteria 1583
232 Ga0501032_0355677 3300049569 Bacteria 943
233 Ga0501033_0019769 3300049570 Bacteria 5090
234 Ga0501033_0137118 3300049570 Bacteria 1770
235 Ga0501033_0244877 3300049570 Bacteria 1271
236 Ga0501034_0041441 3300049571 Bacteria 4658
237 Ga0501034_0277751 3300049571 Bacteria 1615
238 Ga0501034_0286772 3300049571 Bacteria 1585
239 Ga0501034_0358509 3300049571 Bacteria 1385
240 Ga0501036_0008397 3300049572 Bacteria 8462
241 Ga0501036_0017669 3300049572 Bacteria 5968
242 Ga0501036_0089437 3300049572 Bacteria 2602
243 Ga0501037_0012554 3300049573 Bacteria 6241
244 Ga0501037_0015700 3300049573 Bacteria 5572
245 Ga0501037_0151972 3300049573 Bacteria 1654
246 Ga0501037_0317754 3300049573 Bacteria 1079
247 Ga0501038_0001289 3300049574 Bacteria 22805
248 Ga0501038_0059728 3300049574 Bacteria 3265
249 Ga0501038_0214818 3300049574 Bacteria 1537
250 Ga0501038_0301029 3300049574 Bacteria 1259
251 Ga0501038_0347205 3300049574 Bacteria 1156
252 Ga0501039_0036546 3300049575 Bacteria 3791
253 Ga0501039_0229172 3300049575 Bacteria 1461
254 Ga0501039_0304965 3300049575 Bacteria 1252
255 Ga0501039_0596829 3300049575 Bacteria 866
256 Ga0501042_0265556 3300049578 Bacteria 1239
257 Ga0501042_0480516 3300049578 Bacteria 902
258 Ga0501043_0006176 3300049579 Bacteria 9624
259 Ga0501043_0084137 3300049579 Bacteria 2500
260 Ga0501043_0209679 3300049579 Bacteria 1510
261 Ga0501046_0001203 3300049580 Bacteria 25174
262 Ga0501046_0250084 3300049580 Bacteria 1305
263 Ga0501047_0009332 3300049581 Bacteria 9262
264 Ga0501047_0047675 3300049581 Bacteria 4138
265 Ga0501047_0061911 3300049581 Bacteria 3611
266 Ga0501047_0107625 3300049581 Bacteria 2669
267 Ga0501047_0174685 3300049581 Bacteria 2016
268 Ga0501047_0190883 3300049581 Bacteria 1912
269 Ga0501047_0254273 3300049581 Bacteria 1605
270 Ga0501047_0390026 3300049581 Bacteria 1226
271 Ga0501048_0042429 3300049582 Bacteria 3257
272 Ga0501048_0169372 3300049582 Bacteria 1547
273 Ga0501048_0660472 3300049582 Bacteria 751
274 Ga0501067_0018094 3300049583 Bacteria 3901
275 Ga0501067_0046376 3300049583 Bacteria 2412
276 Ga0501067_0057043 3300049583 Bacteria 2163
277 Ga0501068_0201001 3300049584 Bacteria 1264
278 Ga0501069_0007920 3300049585 Bacteria 5580
279 Ga0501069_0377810 3300049585 Bacteria 837
280 Ga0501070_0000948 3300049586 Bacteria 26193
281 Ga0501070_0072044 3300049586 Bacteria 2860
282 Ga0501070_0231959 3300049586 Bacteria 1512
283 Ga0501071_0199448 3300049587 Bacteria 1503
284 Ga0501072_0156180 3300049588 Bacteria 1819
285 Ga0501072_0407206 3300049588 Bacteria 1079
286 Ga0501073_0012204 3300049589 Bacteria 6274
287 Ga0501073_0012245 3300049589 Bacteria 6260
288 Ga0501073_0013597 3300049589 Bacteria 5919
289 Ga0501073_0060636 3300049589 Bacteria 2640
290 Ga0501074_0007096 3300049590 Bacteria 8096
291 Ga0501074_0080457 3300049590 Bacteria 2338
292 Ga0501075_0124427 3300049591 Bacteria 1963
293 Ga0501076_0162834 3300049592 Bacteria 1818
294 Ga0501076_0611197 3300049592 Bacteria 899
295 Ga0501077_0130312 3300049593 Bacteria 1595
296 Ga0501079_0066718 3300049741 Bacteria 2777
297 Ga0501080_0014933 3300049742 Bacteria 7149
298 Ga0501080_0024897 3300049742 Bacteria 5551
299 Ga0501080_0025476 3300049742 Bacteria 5490
300 Ga0501080_0034372 3300049742 Bacteria 4732
301 Ga0501080_0066627 3300049742 Bacteria 3349
302 Ga0501080_0141692 3300049742 Bacteria 2222
303 Ga0501080_0155313 3300049742 Bacteria 2114
304 Ga0501080_0183534 3300049742 Bacteria 1924
305 Ga0501080_0852892 3300049742 Bacteria 796
306 Ga0501081_0178512 3300049743 Bacteria 1535
307 Ga0501081_0461067 3300049743 Bacteria 945
308 Ga0501083_0021307 3300049744 Bacteria 4503
309 Ga0501083_0022148 3300049744 Bacteria 4410
310 Ga0501083_0467923 3300049744 Bacteria 820
311 Ga0501035_0005545 3300049822 Bacteria 11921
312 Ga0501035_0039018 3300049822 Bacteria 4299
313 Ga0501044_0035314 3300049823 Bacteria 5236
314 Ga0501044_0036447 3300049823 Bacteria 5146
315 Ga0501044_0174089 3300049823 Bacteria 2122
316 Ga0501044_0228027 3300049823 Bacteria 1811
317 Ga0501044_0257131 3300049823 Bacteria 1685
318 Ga0501045_0353753 3300049824 Bacteria 1093
319 Ga0501045_0758726 3300049824 Bacteria 715
320 nmdc:mga05p37_841933_c1 3300050507 Bacteria 997
321 nmdc:mga06r32_655112_c1 3300050510 Bacteria 1018
322 nmdc:mga08y16_199379_c1 3300050511 Bacteria 2074
323 nmdc:mga08y16_375_c1 3300050511 Bacteria 40600
324 nmdc:mga0n895_199100_c1 3300050512 Bacteria 2034
325 nmdc:mga08x19_29366_c1 3300050514 Bacteria 3448
326 Ga0500578_0072444 3300053086 Bacteria 2195
327 Ga0500646_0003957 3300053090 Bacteria 3769
328 Ga0500651_0122458 3300053093 Bacteria 1578
329 Ga0500595_000972 3300053119 Bacteria 16106
330 Ga0500642_0044512 3300053130 Bacteria 1933
331 Ga0500658_0004596 3300053134 Bacteria 5147
332 Ga0500658_0078905 3300053134 Bacteria 1404
333 Ga0500568_0010845 3300053139 Bacteria 4250
334 Ga0500604_0023269 3300053151 Bacteria 1766
335 Ga0500616_0001141 3300053153 Bacteria 27277
336 Ga0500616_0060997 3300053153 Bacteria 1954
337 Ga0500633_0081459 3300053160 Bacteria 1172
338 Ga0500636_0007706 3300053177 Bacteria 6227
339 Ga0500637_0297828 3300053178 Bacteria 881
340 Ga0500611_017833 3300053727 Bacteria 1299
341 Ga0501084_0018297 3300054114 Bacteria 5834
342 Ga0501084_0031847 3300054114 Bacteria 4410
343 Ga0590074_011686 3300059423 Bacteria 1472
344 Ga0587075_018938 3300059644 Bacteria 1003
345 Ga0501082_0019104 3300060353 Bacteria 5905
346 Ga0501082_0022100 3300060353 Bacteria 5484
347 Ga0501082_0108750 3300060353 Bacteria 2400
348 Ga0501082_0122686 3300060353 Bacteria 2253
349 Ga0530510_0075373 3300061734 Bacteria 2450
350 2842696316 2842694124 Bacteria 4063419
351 2883296793 2883291878 Bacteria 5894118
352 2883359556 2883354860 Bacteria 5865246
353 2987642588 2987636660 Bacteria 8088555
354 Ga0070667_100273813
355 SwRhRL2b_contig_2692703
356 JGI25153J46596_10000322
357 JGI25160J50197_1010107
358 Ga0055529_1008464
359 Ga0055531_10021388
360 Ga0058863_11418109
361 Ga0065704_10187252
362 Ga0070658_10219693
363 Ga0070690_100130277
364 Ga0070680_100036534
365 Ga0070680_100285854
366 Ga0070689_100302769
367 Ga0070674_100036832
368 Ga0070709_10307183
369 Ga0070713_100521569
370 Ga0070700_100292285
371 Ga0070708_100251269
372 Ga0070663_100579754
373 Ga0070678_100018495
374 Ga0070681_10025749
375 Ga0070681_10214127
376 Ga0070681_10227893
377 Ga0070681_10249752
378 Ga0070681_10720095
379 Ga0068867_100145262
380 Ga0070706_100091465
381 Ga0070707_100907274
382 Ga0070698_100138251
383 Ga0070679_100027688
384 Ga0070679_100058610
385 Ga0070679_100131467
386 Ga0070679_100606738
387 Ga0070684_100486130
388 Ga0068853_100246614
389 Ga0070695_100819333
390 Ga0070696_100164557
391 Ga0070693_100169767
392 Ga0070704_100037802
393 Ga0070664_100600934
394 Ga0068857_100095145
395 Ga0068856_100248048
396 Ga0068864_100558486
397 Ga0068866_10344899
398 Ga0068866_10349642
399 Ga0068861_100062462
400 Ga0068862_100147106
401 Ga0081455_10000448
402 Ga0081455_10246573
403 Ga0081455_10337438
404 Ga0081540_1052161
405 Ga0081540_1060114
406 Ga0081540_1073908
407 Ga0075365_10276609
408 Ga0075363_100074734
409 Ga0070716_100321268
410 Ga0070712_100330392
411 Ga0075367_10235632
412 Ga0075428_100443416
413 Ga0075428_100986334
414 Ga0075430_100064231
415 Ga0075436_100073974
416 Ga0097620_100261447
417 Ga0105240_10099095
418 Ga0111539_10010771
419 Ga0111539_10804927
420 Ga0105247_10314628
421 Ga0114129_10188402
422 Ga0114129_10909526
423 Ga0105248_10503820
424 Ga0105238_10238597
425 Ga0105033_104580
426 Ga0105239_10572995
427 Ga0157370_10028169
428 Ga0157370_10090895
429 Ga0157370_10108734
430 Ga0157369_10012938
431 Ga0157369_10311956
432 Ga0157374_10533964
433 Ga0157378_10196354
434 Ga0163162_10901299
435 Ga0157372_10171300
436 Ga0157372_10251195
437 Ga0157380_10075158
438 Ga0157380_10431968
439 Ga0157379_10366067
440 Ga0157379_10662745
441 Ga0197907_10657786
442 Ga0206356_10244267
443 Ga0206356_10311804
444 Ga0206349_1132236
445 Ga0206355_1497594
446 Ga0206351_10240489
447 Ga0206354_10514210
448 Ga0206353_10685217
449 Ga0154015_1281358
450 Ga0213876_10034053
451 Ga0224712_10049308
452 Ga0224712_10098155
453 Ga0224712_10296581
454 Ga0209148_1000923
455 Ga0209455_1000830
456 Ga0209130_1000514
457 Ga0209675_1021286
458 Ga0209676_1048624
459 Ga0209025_1002324
460 Ga0209758_1000202
461 Ga0209758_1022266
462 Ga0209050_1002212
463 Ga0207426_1000085
464 Ga0207426_1026964
465 Ga0209051_1050691
466 Ga0209257_1001008
467 Ga0207688_10285154
468 Ga0207699_10451141
469 Ga0207684_10401638
470 Ga0207707_10059804
471 Ga0207707_10070511
472 Ga0207707_10226494
473 Ga0207707_10739645
474 Ga0207695_10228517
475 Ga0207693_10173642
476 Ga0207660_10025352
477 Ga0207660_10034059
478 Ga0207660_10155379
479 Ga0207652_10015894
480 Ga0207652_10106274
481 Ga0207652_10228787
482 Ga0207694_10134985
483 Ga0207664_10001732
484 Ga0207690_10043771
485 Ga0207670_10175109
486 Ga0207704_10029202
487 Ga0207661_10372030
488 Ga0207679_10352377
489 Ga0207658_10052318
490 Ga0207708_10154484
491 Ga0207641_10320374
492 Ga0207641_10773331
493 Ga0207648_10088009
494 Ga0207676_10723375
495 Ga0207674_10228075
496 Ga0207675_100392842
497 Ga0209983_1036218
498 Ga0207428_10000134
499 Ga0268265_10002561
500 Ga0268265_10052363
501 Ga0307517_10083165
502 Ga0307517_10272511
503 Ga0307515_10202241
504 Ga0265338_10307866
505 Ga0265330_10112891
506 Ga0265340_10015971
507 Ga0265339_10209733
508 Ga0265331_10008931
509 Ga0265327_10004225
510 Ga0265327_10022399
511 Ga0265327_10046972
512 Ga0265316_10016179
513 Ga0265316_10055061
514 Ga0265316_10153739
515 Ga0307513_10099459
516 Ga0307513_10342143
517 Ga0265313_10000110
518 Ga0265313_10000296
519 Ga0307508_10217371
520 Ga0265314_10009115
521 Ga0265314_10054631
522 Ga0265314_10144966
523 Ga0265342_10009374
524 Ga0265342_10161364
525 Ga0307516_10183213
526 Ga0307516_10258422
527 Ga0307516_10443444
528 Ga0307413_10445940
529 Ga0373934_0050191
530 Ga0373956_0224513
531 Ga0373957_0132245
532 Ga0373943_0236461
533 Ga0373927_0087157
534 Ga0373933_0221880
535 Ga0373947_0197301
536 Ga0373947_0382813
537 Ga0373937_0012900
538 Ga0373937_0229752
539 Ga0373937_0899289
540 Ga0395899_0015093
541 Ga0395900_0016578
542 Ga0395900_0080366
543 Ga0395900_0219722
544 Ga0395898_0013734
545 Ga0395898_0391529
546 Ga0395901_0010398
547 Ga0395901_0335290
548 Ga0400483_107845
549 Ga0400483_231484
550 Ga0436365_0587552
551 Ga0436365_0813186
552 Ga0436363_1578732
553 Ga0439456_058533
554 Ga0451577_0076542
555 Ga0453684_0056997
556 Ga0453684_0341521
557 Ga0466960_0403318
558 Ga0451576_0000056
559 Ga0451576_0003094
560 Ga0451576_0189867
561 Ga0451576_0215501
562 Ga0466967_0020579
563 Ga0466967_0686067
564 Ga0495610_0004095
565 Ga0495640_0124960
566 Ga0495668_0430647
567 Ga0495625_0309429
568 Ga0495623_0122928
569 Ga0495649_0065905
570 Ga0495686_0137184
571 Ga0496102_0815171
572 Ga0496106_0690999
573 Ga0496112_0521003
574 Ga0496113_0256734
575 Ga0496115_0098637
576 Ga0496117_0178384
577 Ga0496121_0001812
578 Ga0496124_0083375
579 Ga0496125_0182047
580 Ga0496126_0033365
581 Ga0501031_0014610
582 Ga0501031_0043913
583 Ga0501032_0094146
584 Ga0501032_0141594
585 Ga0501032_0355677
586 Ga0501033_0019769
587 Ga0501033_0137118
588 Ga0501033_0244877
589 Ga0501034_0041441
590 Ga0501034_0277751
591 Ga0501034_0286772
592 Ga0501034_0358509
593 Ga0501036_0008397
594 Ga0501036_0017669
595 Ga0501036_0089437
596 Ga0501037_0012554
597 Ga0501037_0015700
598 Ga0501037_0151972
599 Ga0501037_0317754
600 Ga0501038_0001289
601 Ga0501038_0059728
602 Ga0501038_0214818
603 Ga0501038_0301029
604 Ga0501038_0347205
605 Ga0501039_0036546
606 Ga0501039_0229172
607 Ga0501039_0304965
608 Ga0501039_0596829
609 Ga0501042_0265556
610 Ga0501042_0480516
611 Ga0501043_0006176
612 Ga0501043_0084137
613 Ga0501043_0209679
614 Ga0501046_0001203
615 Ga0501046_0250084
616 Ga0501047_0009332
617 Ga0501047_0047675
618 Ga0501047_0061911
619 Ga0501047_0107625
620 Ga0501047_0174685
621 Ga0501047_0190883
622 Ga0501047_0254273
623 Ga0501047_0390026
624 Ga0501048_0042429
625 Ga0501048_0169372
626 Ga0501048_0660472
627 Ga0501067_0018094
628 Ga0501067_0046376
629 Ga0501067_0057043
630 Ga0501068_0201001
631 Ga0501069_0007920
632 Ga0501069_0377810
633 Ga0501070_0000948
634 Ga0501070_0072044
635 Ga0501070_0231959
636 Ga0501071_0199448
637 Ga0501072_0156180
638 Ga0501072_0407206
639 Ga0501073_0012204
640 Ga0501073_0012245
641 Ga0501073_0013597
642 Ga0501073_0060636
643 Ga0501074_0007096
644 Ga0501074_0080457
645 Ga0501075_0124427
646 Ga0501076_0162834
647 Ga0501076_0611197
648 Ga0501077_0130312
649 Ga0501079_0066718
650 Ga0501080_0014933
651 Ga0501080_0024897
652 Ga0501080_0025476
653 Ga0501080_0034372
654 Ga0501080_0066627
655 Ga0501080_0141692
656 Ga0501080_0155313
657 Ga0501080_0183534
658 Ga0501080_0852892
659 Ga0501081_0178512
660 Ga0501081_0461067
661 Ga0501083_0021307
662 Ga0501083_0022148
663 Ga0501083_0467923
664 Ga0501035_0005545
665 Ga0501035_0039018
666 Ga0501044_0035314
667 Ga0501044_0036447
668 Ga0501044_0174089
669 Ga0501044_0228027
670 Ga0501044_0257131
671 Ga0501045_0353753
672 Ga0501045_0758726
673 nmdc:mga05p37_841933_c1
674 nmdc:mga06r32_655112_c1
675 nmdc:mga08y16_199379_c1
676 nmdc:mga08y16_375_c1
677 nmdc:mga0n895_199100_c1
678 nmdc:mga08x19_29366_c1
679 Ga0500578_0072444
680 Ga0500646_0003957
681 Ga0500651_0122458
682 Ga0500595_000972
683 Ga0500642_0044512
684 Ga0500658_0004596
685 Ga0500658_0078905
686 Ga0500568_0010845
687 Ga0500604_0023269
688 Ga0500616_0001141
689 Ga0500616_0060997
690 Ga0500633_0081459
691 Ga0500636_0007706
692 Ga0500637_0297828
693 Ga0500611_017833
694 Ga0501084_0018297
695 Ga0501084_0031847
696 Ga0590074_011686
697 Ga0587075_018938
698 Ga0501082_0019104
699 Ga0501082_0022100
700 Ga0501082_0108750
701 Ga0501082_0122686
702 Ga0530510_0075373
703 2842696316
704 2883296793
705 2883359556
706 2987642588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

3

221

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yrt-assembly1.cif.gz_E-2 transaldolase variant t30d from t. acidophilum in complex with d-fructose 6-phosphate schiff-base intermediate 0.9528 1 200
6ys0-assembly1.cif.gz_A-2 transaldolase variant d211a from t. acidophilum in complex with d-fructose 6-phosphate schiff-base intermediate 0.952 1 200
1vpx-assembly1.cif.gz_D crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9485 1 193
3s1w-assembly1.cif.gz_A transaldolase variant lys86ala from thermoplasma acidophilum in complex with glycerol and citrate 0.9477 1 203
6yre-assembly1.cif.gz_C transaldolase variant t30c/d211c from t. acidophilum 0.9465 1 203
ID Description Score Start End Superfamily
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9422 1 196 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9172 1 203 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.913 1 203 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9067 1 196 3.20.20.70
af_P37837_1_337_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8547 1 178 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A442LUU8-F1-model_v4 Fructose-6-phosphate aldolase 1.005 54 123 GO:0005975
AF-A0A7V2RV52-F1-model_v4 Fructose-6-phosphate aldolase 0.9911 1 95 GO:0005975
AF-A0A442LUU8-F1-model_v4 Fructose-6-phosphate aldolase 0.9904 54 123 GO:0005975
AF-A0A530QW44-F1-model_v4 Fructose-6-phosphate aldolase 0.9903 1 126 GO:0005975
AF-A0A530KQ01-F1-model_v4 Fructose-6-phosphate aldolase 0.9893 1 106 GO:0005975

Map